Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

IQ domain-containing protein E

Gene

IQCE

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

Enzyme and pathway databases

ReactomeiR-HSA-5635838. Activation of SMO.

Names & Taxonomyi

Protein namesi
Recommended name:
IQ domain-containing protein E
Gene namesi
Name:IQCE
Synonyms:KIAA1023
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 7

Organism-specific databases

HGNCiHGNC:29171. IQCE.

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000106012.
PharmGKBiPA134894706.

Polymorphism and mutation databases

BioMutaiIQCE.
DMDMi145566781.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002841101 – 695IQ domain-containing protein EAdd BLAST695

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei322PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ6IPM2.
PaxDbiQ6IPM2.
PeptideAtlasiQ6IPM2.
PRIDEiQ6IPM2.
TopDownProteomicsiQ6IPM2-1. [Q6IPM2-1]

PTM databases

iPTMnetiQ6IPM2.
PhosphoSitePlusiQ6IPM2.

Expressioni

Gene expression databases

BgeeiENSG00000106012.
CleanExiHS_IQCE.
ExpressionAtlasiQ6IPM2. baseline and differential.
GenevisibleiQ6IPM2. HS.

Organism-specific databases

HPAiHPA019515.

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
Q9BRL53EBI-3893098,EBI-10296986
HEL-S-72B4DJ513EBI-3893098,EBI-10171450
PSMA3P257883EBI-3893098,EBI-348380

Protein-protein interaction databases

BioGridi116886. 16 interactors.
IntActiQ6IPM2. 6 interactors.
MINTiMINT-4717824.
STRINGi9606.ENSP00000385597.

Structurei

3D structure databases

ProteinModelPortaliQ6IPM2.
SMRiQ6IPM2.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini542 – 571IQ 1PROSITE-ProRule annotationAdd BLAST30
Domaini601 – 630IQ 2PROSITE-ProRule annotationAdd BLAST30

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili157 – 264Sequence analysisAdd BLAST108
Coiled coili292 – 358Sequence analysisAdd BLAST67
Coiled coili387 – 477Sequence analysisAdd BLAST91

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi534 – 539Poly-Lys6

Sequence similaritiesi

Contains 2 IQ domains.PROSITE-ProRule annotation

Keywords - Domaini

Coiled coil, Repeat

Phylogenomic databases

eggNOGiENOG410IFFR. Eukaryota.
ENOG41104K8. LUCA.
GeneTreeiENSGT00390000006040.
HOVERGENiHBG103684.
InParanoidiQ6IPM2.
PhylomeDBiQ6IPM2.
TreeFamiTF351136.

Family and domain databases

InterProiIPR000048. IQ_motif_EF-hand-BS.
[Graphical view]
PfamiPF00612. IQ. 2 hits.
[Graphical view]
SMARTiSM00015. IQ. 2 hits.
[Graphical view]
PROSITEiPS50096. IQ. 2 hits.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q6IPM2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MFLGTGEPAL DTGDDSLSAV TFDSDVETKA KRKAFHKPPP TSPKSPYLSK
60 70 80 90 100
PRKVASWRSL RTAGSMPLGG RASLTPQKLW LGTAKPGSLT QALNSPLTWE
110 120 130 140 150
HAWTGVPGGT PDCLTDTFRV KRPHLRRSAS NGHVPGTPVY REKEDMYDEI
160 170 180 190 200
IELKKSLHVQ KSDVDLMRTK LRRLEEENSR KDRQIEQLLD PSRGTDFVRT
210 220 230 240 250
LAEKRPDASW VINGLKQRIL KLEQQCKEKD GTISKLQTDM KTTNLEEMRI
260 270 280 290 300
AMETYYEEVH RLQTLLASSE TTGKKPLGEK KTGAKRQKKM GSALLSLSRS
310 320 330 340 350
VQELTEENQS LKEDLDRVLS TSPTISKTQG YVEWSKPRLL RRIVELEKKL
360 370 380 390 400
SVMESSKSHA AEPVRSHPPA CLASSSALHR QPRGDRNKDH ERLRGAVRDL
410 420 430 440 450
KEERTALQEQ LLQRDLEVKQ LLQAKADLEK ELECAREGEE ERREREEVLR
460 470 480 490 500
EEIQTLTSKL QELQEMKKEE KEDCPEVPHK AQELPAPTPS SRHCEQDWPP
510 520 530 540 550
DSSEEGLPRP RSPCSDGRRD AAARVLQAQW KVYKHKKKKA VLDEAAVVLQ
560 570 580 590 600
AAFRGHLTRT KLLASKAHGS EPPSVPGLPD QSSPVPRVPS PIAQATGSPV
610 620 630 640 650
QEEAIVIIQS ALRAHLARAR HSATGKRTTT AASTRRRSAS ATHGDASSPP
660 670 680 690
FLAALPDPSP SGPQALAPLP GDDVNSDDSD DIVIAPSLPT KNFPV
Length:695
Mass (Da):77,298
Last modified:April 17, 2007 - v2
Checksum:iAA1F428E90D395AA
GO
Isoform 2 (identifier: Q6IPM2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-65: Missing.

Show »
Length:630
Mass (Da):70,295
Checksum:i9BC324072D5E5F34
GO
Isoform 3 (identifier: Q6IPM2-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     13-70: GDDSLSAVTFDSDVETKAKRKAFHKPPPTSPKSPYLSKPRKVASWRSLRTAGSMPLGG → SHLISLS

Show »
Length:644
Mass (Da):71,810
Checksum:i730FED80139A863B
GO
Isoform 4 (identifier: Q6IPM2-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     12-27: Missing.

Show »
Length:679
Mass (Da):75,658
Checksum:i9A5A61414612145E
GO

Sequence cautioni

The sequence BAA82975 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti197F → L in AAH43150 (PubMed:15489334).Curated1
Sequence conflicti234S → R in AAH71858 (PubMed:15489334).Curated1
Sequence conflicti579P → S in AAH71858 (PubMed:15489334).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_031697101H → N.Corresponds to variant rs11976972dbSNPEnsembl.1
Natural variantiVAR_031698546A → V.Corresponds to variant rs2293404dbSNPEnsembl.1
Natural variantiVAR_031699587R → H.Corresponds to variant rs10950797dbSNPEnsembl.1
Natural variantiVAR_031700596T → A.Corresponds to variant rs2293407dbSNPEnsembl.1
Natural variantiVAR_031701666L → V.1 PublicationCorresponds to variant rs3735109dbSNPEnsembl.1
Natural variantiVAR_031702690T → M.1 PublicationCorresponds to variant rs1061566dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0244331 – 65Missing in isoform 2. 2 PublicationsAdd BLAST65
Alternative sequenceiVSP_02443412 – 27Missing in isoform 4. 1 PublicationAdd BLAST16
Alternative sequenceiVSP_02443513 – 70GDDSL…MPLGG → SHLISLS in isoform 3. 1 PublicationAdd BLAST58

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB028946 mRNA. Translation: BAA82975.2. Different initiation.
AL136792 mRNA. Translation: CAB66726.1.
BC043150 mRNA. Translation: AAH43150.1.
BC061518 mRNA. Translation: AAH61518.1. Different termination.
BC071858 mRNA. Translation: AAH71858.1.
CCDSiCCDS43542.1. [Q6IPM2-1]
CCDS75560.1. [Q6IPM2-2]
RefSeqiNP_001274430.1. NM_001287501.1. [Q6IPM2-2]
NP_689771.3. NM_152558.4. [Q6IPM2-1]
UniGeneiHs.520627.

Genome annotation databases

EnsembliENST00000325979; ENSP00000313772; ENSG00000106012. [Q6IPM2-2]
ENST00000402050; ENSP00000385597; ENSG00000106012. [Q6IPM2-1]
ENST00000404984; ENSP00000385945; ENSG00000106012. [Q6IPM2-3]
ENST00000438376; ENSP00000396178; ENSG00000106012. [Q6IPM2-4]
ENST00000623361; ENSP00000485601; ENSG00000106012. [Q6IPM2-2]
GeneIDi23288.
KEGGihsa:23288.
UCSCiuc003smn.6. human. [Q6IPM2-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB028946 mRNA. Translation: BAA82975.2. Different initiation.
AL136792 mRNA. Translation: CAB66726.1.
BC043150 mRNA. Translation: AAH43150.1.
BC061518 mRNA. Translation: AAH61518.1. Different termination.
BC071858 mRNA. Translation: AAH71858.1.
CCDSiCCDS43542.1. [Q6IPM2-1]
CCDS75560.1. [Q6IPM2-2]
RefSeqiNP_001274430.1. NM_001287501.1. [Q6IPM2-2]
NP_689771.3. NM_152558.4. [Q6IPM2-1]
UniGeneiHs.520627.

3D structure databases

ProteinModelPortaliQ6IPM2.
SMRiQ6IPM2.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi116886. 16 interactors.
IntActiQ6IPM2. 6 interactors.
MINTiMINT-4717824.
STRINGi9606.ENSP00000385597.

PTM databases

iPTMnetiQ6IPM2.
PhosphoSitePlusiQ6IPM2.

Polymorphism and mutation databases

BioMutaiIQCE.
DMDMi145566781.

Proteomic databases

MaxQBiQ6IPM2.
PaxDbiQ6IPM2.
PeptideAtlasiQ6IPM2.
PRIDEiQ6IPM2.
TopDownProteomicsiQ6IPM2-1. [Q6IPM2-1]

Protocols and materials databases

DNASUi23288.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000325979; ENSP00000313772; ENSG00000106012. [Q6IPM2-2]
ENST00000402050; ENSP00000385597; ENSG00000106012. [Q6IPM2-1]
ENST00000404984; ENSP00000385945; ENSG00000106012. [Q6IPM2-3]
ENST00000438376; ENSP00000396178; ENSG00000106012. [Q6IPM2-4]
ENST00000623361; ENSP00000485601; ENSG00000106012. [Q6IPM2-2]
GeneIDi23288.
KEGGihsa:23288.
UCSCiuc003smn.6. human. [Q6IPM2-1]

Organism-specific databases

CTDi23288.
GeneCardsiIQCE.
H-InvDBHIX0006435.
HGNCiHGNC:29171. IQCE.
HPAiHPA019515.
neXtProtiNX_Q6IPM2.
OpenTargetsiENSG00000106012.
PharmGKBiPA134894706.
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IFFR. Eukaryota.
ENOG41104K8. LUCA.
GeneTreeiENSGT00390000006040.
HOVERGENiHBG103684.
InParanoidiQ6IPM2.
PhylomeDBiQ6IPM2.
TreeFamiTF351136.

Enzyme and pathway databases

ReactomeiR-HSA-5635838. Activation of SMO.

Miscellaneous databases

ChiTaRSiIQCE. human.
GeneWikiiIQCE.
GenomeRNAii23288.
PROiQ6IPM2.

Gene expression databases

BgeeiENSG00000106012.
CleanExiHS_IQCE.
ExpressionAtlasiQ6IPM2. baseline and differential.
GenevisibleiQ6IPM2. HS.

Family and domain databases

InterProiIPR000048. IQ_motif_EF-hand-BS.
[Graphical view]
PfamiPF00612. IQ. 2 hits.
[Graphical view]
SMARTiSM00015. IQ. 2 hits.
[Graphical view]
PROSITEiPS50096. IQ. 2 hits.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiIQCE_HUMAN
AccessioniPrimary (citable) accession number: Q6IPM2
Secondary accession number(s): Q4G0P7
, Q6P7T4, Q9H0H7, Q9UPX7
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 17, 2007
Last sequence update: April 17, 2007
Last modified: November 30, 2016
This is version 98 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 7
    Human chromosome 7: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.