Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Pannexin-2

Gene

Panx2

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Structural component of the gap junctions and the hemichannels.

GO - Molecular functioni

  • channel activity Source: MGI
  • gap junction hemi-channel activity Source: UniProtKB

GO - Biological processi

  • ion transport Source: UniProtKB-KW
  • protein hexamerization Source: UniProtKB
  • response to ischemia Source: MGI
  • transmembrane transport Source: MGI
Complete GO annotation...

Keywords - Molecular functioni

Ion channel

Keywords - Biological processi

Ion transport, Transport

Enzyme and pathway databases

ReactomeiR-MMU-112303. Electric Transmission Across Gap Junctions.

Names & Taxonomyi

Protein namesi
Recommended name:
Pannexin-2
Gene namesi
Name:Panx2
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 15

Organism-specific databases

MGIiMGI:1890615. Panx2.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini11 – 53CytoplasmicSequence analysisAdd BLAST43
Transmembranei54 – 74HelicalPROSITE-ProRule annotationAdd BLAST21
Topological domaini75 – 125ExtracellularSequence analysisAdd BLAST51
Transmembranei126 – 146HelicalPROSITE-ProRule annotationAdd BLAST21
Topological domaini147 – 230CytoplasmicSequence analysisAdd BLAST84
Transmembranei231 – 251HelicalPROSITE-ProRule annotationAdd BLAST21
Topological domaini252 – 295ExtracellularSequence analysisAdd BLAST44
Transmembranei296 – 316HelicalPROSITE-ProRule annotationAdd BLAST21
Topological domaini317 – 617CytoplasmicSequence analysisAdd BLAST301

GO - Cellular componenti

  • cytoplasm Source: MGI
  • gap junction Source: UniProtKB-SubCell
  • integral component of membrane Source: UniProtKB-KW
  • plasma membrane Source: MGI
Complete GO annotation...

Keywords - Cellular componenti

Cell junction, Cell membrane, Gap junction, Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002084891 – 677Pannexin-2Add BLAST677

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi86N-linked (GlcNAc...)Sequence analysis1
Modified residuei593PhosphoserineCombined sources1
Modified residuei604PhosphoserineCombined sources1

Keywords - PTMi

Glycoprotein, Phosphoprotein

Proteomic databases

PaxDbiQ6IMP4.
PeptideAtlasiQ6IMP4.
PRIDEiQ6IMP4.

PTM databases

iPTMnetiQ6IMP4.
PhosphoSitePlusiQ6IMP4.

Expressioni

Gene expression databases

BgeeiENSMUSG00000058441.
CleanExiMM_PANX2.
ExpressionAtlasiQ6IMP4. baseline and differential.
GenevisibleiQ6IMP4. MM.

Interactioni

Subunit structurei

Forms PANX1/PANX2-heteromeric intercellular channels on coexpression in paired Xenopus oocytes. Does not form homomeric channels (By similarity).By similarity

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000124354.

Structurei

3D structure databases

ProteinModelPortaliQ6IMP4.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the pannexin family.PROSITE-ProRule annotation

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410IGKS. Eukaryota.
ENOG4110P9D. LUCA.
GeneTreeiENSGT00390000009703.
HOGENOMiHOG000082414.
HOVERGENiHBG053498.
InParanoidiQ6IMP4.
KOiK03443.
OMAiRAAHHYK.
OrthoDBiEOG091G086D.
PhylomeDBiQ6IMP4.
TreeFamiTF333142.

Family and domain databases

InterProiIPR000990. Innexin.
[Graphical view]
PfamiPF00876. Innexin. 1 hit.
[Graphical view]
PROSITEiPS51013. PANNEXIN. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q6IMP4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MHHLLEQSAD MATALLAGEK LRELILPGSQ DDKAGALAAL LLQLKLELPF
60 70 80 90 100
DRVVTIGTVL VPILLVTLVF TKNFAEEPIY CYTPHNFTRD QALYARGYCW
110 120 130 140 150
TELRDALPGV DASLWPSLFE HKFLPYALLA FAAIMYVPAL GWEFLASTRL
160 170 180 190 200
TSELNFLLQE IDNCYHRAAE GRAPKIEKQI QSKGPGITER EKREIIENAE
210 220 230 240 250
KEKSPEQNLF EKYLERRGRS NFLAKLYLAR HVLILLLSVV PISYLCTYYA
260 270 280 290 300
TQKQNEFTCA LGASPDGPVG SAGPTVRVSC KLPSVQLQRI IAGVDIVLLC
310 320 330 340 350
FMNLIILVNL IHLFIFRKSN FIFDKLNKVG IKTRRQWRRS QFCDINILAM
360 370 380 390 400
FCNENRDHIK SLNRLDFITN ESDLMYDNVV RQLLAALAQS NHDTTPTVRD
410 420 430 440 450
SGIQTVDPSI NPAEPDGSAE PPVVKRPRKK MKWIPTSNPL PQPFKEQLAI
460 470 480 490 500
MRVENSKTEK PKPVRRKTAT DTLIAPLLDA GARAAHHYKG SGGDSGPSSA
510 520 530 540 550
PPAASEKKHT RHFSLDVHPY ILGTKKAKTE AVPPALPASR SQEGGFLSQT
560 570 580 590 600
EECGLGLAAA PTKDAPLPEK EIPYPTEPAL PGLPSGGSFH VCSPPAAPAA
610 620 630 640 650
ASLSPGSLGK ADPLTILSRN ATHPLLHIST LYEAREEEEG GPCAPSDMGD
660 670
LLSIPPPQQI LIATFEEPRT VVSTVEF
Length:677
Mass (Da):74,614
Last modified:May 18, 2010 - v2
Checksum:i38B0BE8B5771FD35
GO
Isoform 2 (identifier: Q6IMP4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     75-75: A → AARVSSLPS
     632-677: YEAREEEEGGPCAPSDMGDLLSIPPPQQILIATFEEPRTVVSTVEF → SSSPPSRSREQL

Note: No experimental confirmation available.
Show »
Length:651
Mass (Da):71,693
Checksum:i7F7098A6668D5BD6
GO

Sequence cautioni

The sequence DAA00307 differs from that shown. Reason: Frameshift at positions 563, 584 and 589.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti47E → G in ACA30452 (Ref. 1) Curated1
Sequence conflicti57G → D in ACA30452 (Ref. 1) Curated1
Sequence conflicti526K → E in ACA30452 (Ref. 1) Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_03909375A → AARVSSLPS in isoform 2. 1 Publication1
Alternative sequenceiVSP_039094632 – 677YEARE…STVEF → SSSPPSRSREQL in isoform 2. 1 PublicationAdd BLAST46

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
EU446266 mRNA. Translation: ACA30452.1.
AC113069 Genomic DNA. No translation available.
DQ093579 mRNA. Translation: AAY98749.1.
BK000624 mRNA. Translation: DAA00307.1. Frameshift.
CCDSiCCDS49695.1. [Q6IMP4-1]
RefSeqiNP_001002005.2. NM_001002005.2. [Q6IMP4-1]
UniGeneiMm.483059.

Genome annotation databases

EnsembliENSMUST00000161372; ENSMUSP00000125514; ENSMUSG00000058441. [Q6IMP4-2]
ENSMUST00000162424; ENSMUSP00000124354; ENSMUSG00000058441. [Q6IMP4-1]
GeneIDi406218.
KEGGimmu:406218.
UCSCiuc007xfa.2. mouse. [Q6IMP4-1]
uc011zxq.1. mouse. [Q6IMP4-2]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
EU446266 mRNA. Translation: ACA30452.1.
AC113069 Genomic DNA. No translation available.
DQ093579 mRNA. Translation: AAY98749.1.
BK000624 mRNA. Translation: DAA00307.1. Frameshift.
CCDSiCCDS49695.1. [Q6IMP4-1]
RefSeqiNP_001002005.2. NM_001002005.2. [Q6IMP4-1]
UniGeneiMm.483059.

3D structure databases

ProteinModelPortaliQ6IMP4.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000124354.

PTM databases

iPTMnetiQ6IMP4.
PhosphoSitePlusiQ6IMP4.

Proteomic databases

PaxDbiQ6IMP4.
PeptideAtlasiQ6IMP4.
PRIDEiQ6IMP4.

Protocols and materials databases

DNASUi406218.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000161372; ENSMUSP00000125514; ENSMUSG00000058441. [Q6IMP4-2]
ENSMUST00000162424; ENSMUSP00000124354; ENSMUSG00000058441. [Q6IMP4-1]
GeneIDi406218.
KEGGimmu:406218.
UCSCiuc007xfa.2. mouse. [Q6IMP4-1]
uc011zxq.1. mouse. [Q6IMP4-2]

Organism-specific databases

CTDi56666.
MGIiMGI:1890615. Panx2.

Phylogenomic databases

eggNOGiENOG410IGKS. Eukaryota.
ENOG4110P9D. LUCA.
GeneTreeiENSGT00390000009703.
HOGENOMiHOG000082414.
HOVERGENiHBG053498.
InParanoidiQ6IMP4.
KOiK03443.
OMAiRAAHHYK.
OrthoDBiEOG091G086D.
PhylomeDBiQ6IMP4.
TreeFamiTF333142.

Enzyme and pathway databases

ReactomeiR-MMU-112303. Electric Transmission Across Gap Junctions.

Miscellaneous databases

PROiQ6IMP4.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000058441.
CleanExiMM_PANX2.
ExpressionAtlasiQ6IMP4. baseline and differential.
GenevisibleiQ6IMP4. MM.

Family and domain databases

InterProiIPR000990. Innexin.
[Graphical view]
PfamiPF00876. Innexin. 1 hit.
[Graphical view]
PROSITEiPS51013. PANNEXIN. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiPANX2_MOUSE
AccessioniPrimary (citable) accession number: Q6IMP4
Secondary accession number(s): B1PL20, Q4JGM2
Entry historyi
Integrated into UniProtKB/Swiss-Prot: August 31, 2004
Last sequence update: May 18, 2010
Last modified: November 2, 2016
This is version 98 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.