Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Rho GTPase-activating protein 20

Gene

Arhgap20

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at protein leveli

Functioni

GTPase activator for the Rho-type GTPases by converting them to an inactive GDP-bound state.By similarity

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

GTPase activation

Enzyme and pathway databases

ReactomeiR-MMU-194840. Rho GTPase cycle.

Names & Taxonomyi

Protein namesi
Recommended name:
Rho GTPase-activating protein 20
Alternative name(s):
RA and RhoGAP domain-containing protein
Short name:
RARhoGAP
Rho-type GTPase-activating protein 20
Gene namesi
Name:Arhgap20
Synonyms:Kiaa1391
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 9

Organism-specific databases

MGIiMGI:2445175. Arhgap20.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 11821182Rho GTPase-activating protein 20PRO_0000283087Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei46 – 461PhosphoserineCombined sources
Modified residuei704 – 7041PhosphoserineCombined sources
Modified residuei730 – 7301PhosphoserineCombined sources

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ6IFT4.
PaxDbiQ6IFT4.
PRIDEiQ6IFT4.

PTM databases

iPTMnetiQ6IFT4.
PhosphoSiteiQ6IFT4.

Expressioni

Gene expression databases

BgeeiQ6IFT4.
CleanExiMM_ARHGAP20.
ExpressionAtlasiQ6IFT4. baseline and differential.
GenevisibleiQ6IFT4. MM.

Interactioni

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000065633.

Structurei

3D structure databases

ProteinModelPortaliQ6IFT4.
SMRiQ6IFT4. Positions 360-551.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini85 – 185101PHAdd
BLAST
Domaini194 – 28390Ras-associatingPROSITE-ProRule annotationAdd
BLAST
Domaini365 – 551187Rho-GAPPROSITE-ProRule annotationAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi913 – 1012100Ser-richAdd
BLAST

Sequence similaritiesi

Contains 1 PH domain.Curated
Contains 1 Ras-associating domain.PROSITE-ProRule annotation
Contains 1 Rho-GAP domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiKOG4724. Eukaryota.
ENOG410YV4E. LUCA.
GeneTreeiENSGT00530000063299.
HOGENOMiHOG000048702.
HOVERGENiHBG061748.
InParanoidiQ6IFT4.
OMAiEQLPREM.
OrthoDBiEOG7NCV2Q.
PhylomeDBiQ6IFT4.
TreeFamiTF331062.

Family and domain databases

Gene3Di1.10.555.10. 1 hit.
2.30.29.30. 1 hit.
InterProiIPR011993. PH_dom-like.
IPR001849. PH_domain.
IPR000159. RA_dom.
IPR008936. Rho_GTPase_activation_prot.
IPR000198. RhoGAP_dom.
IPR029071. Ubiquitin-rel_dom.
[Graphical view]
PfamiPF00788. RA. 1 hit.
PF00620. RhoGAP. 1 hit.
[Graphical view]
SMARTiSM00233. PH. 1 hit.
SM00324. RhoGAP. 1 hit.
[Graphical view]
SUPFAMiSSF48350. SSF48350. 1 hit.
SSF50729. SSF50729. 1 hit.
SSF54236. SSF54236. 1 hit.
PROSITEiPS50200. RA. 1 hit.
PS50238. RHOGAP. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q6IFT4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MEAMSPQQDA LGAQPGRSSS LTGMSRIAGG PGTKKKMKTL AERRRSAPSL
60 70 80 90 100
ILDKALQKRP STRDSHSASI DTCAFLSSFM CSSRTLLIDG PVELKRGLQR
110 120 130 140 150
QERHLFLFND LFVSAKIKYN NNFKIKNKIR LTDMWTASCV EEVGEGNMNA
160 170 180 190 200
QKSFVLGWPT VNFVATFSSP EQKDKWLSLL QRYIALEKEK DYPKSIPLKI
210 220 230 240 250
FAKDIGNCAY FKTITVMNSD TASEVINMSL QMLGITGSER DYQLWVNSGK
260 270 280 290 300
EAAPYPLIGH EYPYGIKMSH LRDTALLTQG SRDSASPSQL QEPFLMEQLP
310 320 330 340 350
REMQCQFILK PTRLATAQQL SDSSQKTFKR RRSIINWAFW RGSSTHLDNL
360 370 380 390 400
PMSPTSPMPG QLFGVSLPDL CENDNLPKPI LDMLSFLNQK GPLTKGIFRQ
410 420 430 440 450
SANMKSCREL KEKLNSGIEV HLDCESIFVI ASVLKDFLRN IPESIFSSDL
460 470 480 490 500
YDHWVCVMDQ GNDEEKINII QRLLDQLPRA NVVFLRYLFG VLHNIEQHSL
510 520 530 540 550
SNQMTAFNLA VCIAPSILWP PASSSPELEN EFTKKVSLLI QFLIENCCRV
560 570 580 590 600
FGEEIASLLG ELSERSDREH TPDITCFQMN DSSYDSLENE LNEEADAPCS
610 620 630 640 650
DLVKKLGQGS RSMDSVLTLS DYDLEQPEVE GLLTLSNFDL DQSKEEHIPI
660 670 680 690 700
KPPLEPKPVN VFVGYRKVSL GEHARAPAGP GTLSCLPVAA ADAPKVLRRH
710 720 730 740 750
RRSSEPSIDY LDTKLSYLRE FYQKKLRKSS CDAVLSRKDE DYLKQTQPQK
760 770 780 790 800
KGDKVCLKQS SVTGTDVSKR NTANENIKKK SLSGHEGTQV TLFTKSKPVP
810 820 830 840 850
ISVASYSHGS SQDHPRKQAF DADPCRFSPP HLTDAQKSSR VQHRRCSEPS
860 870 880 890 900
IDDQNYKLSY LRGIYSMKQN KASCEAGLLH GEDDYLRRHK SLQIEGQKLI
910 920 930 940 950
NQSLVMGIEV GKSSSSHQST EKVLPPRLNL CPRASYSSLS SPGSSPSGSS
960 970 980 990 1000
VSSQDSAFSQ ISEHSVFTPT ETSSPIDCTF QTQRKQEELS SDFDSPSRLS
1010 1020 1030 1040 1050
GMPGPSMGQA SSHLAYLRKG TTEQPSQMHS VTLHPSAWLR SGLVTLKNWS
1060 1070 1080 1090 1100
LKKKTKAARP EDRKVCSLKE PLELPSCASG TPEADSLQES QDDLQGDEGP
1110 1120 1130 1140 1150
GQTACGFSSY ACQDSEQHAG SPFHLAESRL KPCMKLYKGE ESGGQYPCDN
1160 1170 1180
PWEGASSSLE TTEDTANPGA EPTTFAMTGT DI
Length:1,182
Mass (Da):131,374
Last modified:July 5, 2004 - v1
Checksum:i39B0BC5CC944D50B
GO
Isoform 2 (identifier: Q6IFT4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     184-217: IALEKEKDYPKSIPLKIFAKDIGNCAYFKTITVM → VPVHTVLMLSLTCLNQTCYCQICPRGAPFFLNGN
     218-1182: Missing.

Note: No experimental confirmation available.
Show »
Length:217
Mass (Da):24,243
Checksum:iBC778AADD67E3E13
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei184 – 21734IALEK…TITVM → VPVHTVLMLSLTCLNQTCYC QICPRGAPFFLNGN in isoform 2. 1 PublicationVSP_024300Add
BLAST
Alternative sequencei218 – 1182965Missing in isoform 2. 1 PublicationVSP_024301Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK040756 mRNA. Translation: BAC30694.1.
AK046916 mRNA. Translation: BAC32919.1.
AK129345 mRNA. Translation: BAC98155.1.
BK004077 mRNA. Translation: DAA04568.1.
CCDSiCCDS23177.1. [Q6IFT4-1]
RefSeqiNP_780744.2. NM_175535.3. [Q6IFT4-1]
UniGeneiMm.400352.
Mm.443529.

Genome annotation databases

EnsembliENSMUST00000065496; ENSMUSP00000065633; ENSMUSG00000053199. [Q6IFT4-1]
GeneIDi244867.
KEGGimmu:244867.
UCSCiuc009pli.1. mouse. [Q6IFT4-2]
uc009plj.1. mouse. [Q6IFT4-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK040756 mRNA. Translation: BAC30694.1.
AK046916 mRNA. Translation: BAC32919.1.
AK129345 mRNA. Translation: BAC98155.1.
BK004077 mRNA. Translation: DAA04568.1.
CCDSiCCDS23177.1. [Q6IFT4-1]
RefSeqiNP_780744.2. NM_175535.3. [Q6IFT4-1]
UniGeneiMm.400352.
Mm.443529.

3D structure databases

ProteinModelPortaliQ6IFT4.
SMRiQ6IFT4. Positions 360-551.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000065633.

PTM databases

iPTMnetiQ6IFT4.
PhosphoSiteiQ6IFT4.

Proteomic databases

MaxQBiQ6IFT4.
PaxDbiQ6IFT4.
PRIDEiQ6IFT4.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000065496; ENSMUSP00000065633; ENSMUSG00000053199. [Q6IFT4-1]
GeneIDi244867.
KEGGimmu:244867.
UCSCiuc009pli.1. mouse. [Q6IFT4-2]
uc009plj.1. mouse. [Q6IFT4-1]

Organism-specific databases

CTDi57569.
MGIiMGI:2445175. Arhgap20.
RougeiSearch...

Phylogenomic databases

eggNOGiKOG4724. Eukaryota.
ENOG410YV4E. LUCA.
GeneTreeiENSGT00530000063299.
HOGENOMiHOG000048702.
HOVERGENiHBG061748.
InParanoidiQ6IFT4.
OMAiEQLPREM.
OrthoDBiEOG7NCV2Q.
PhylomeDBiQ6IFT4.
TreeFamiTF331062.

Enzyme and pathway databases

ReactomeiR-MMU-194840. Rho GTPase cycle.

Miscellaneous databases

ChiTaRSiArhgap20. mouse.
PROiQ6IFT4.
SOURCEiSearch...

Gene expression databases

BgeeiQ6IFT4.
CleanExiMM_ARHGAP20.
ExpressionAtlasiQ6IFT4. baseline and differential.
GenevisibleiQ6IFT4. MM.

Family and domain databases

Gene3Di1.10.555.10. 1 hit.
2.30.29.30. 1 hit.
InterProiIPR011993. PH_dom-like.
IPR001849. PH_domain.
IPR000159. RA_dom.
IPR008936. Rho_GTPase_activation_prot.
IPR000198. RhoGAP_dom.
IPR029071. Ubiquitin-rel_dom.
[Graphical view]
PfamiPF00788. RA. 1 hit.
PF00620. RhoGAP. 1 hit.
[Graphical view]
SMARTiSM00233. PH. 1 hit.
SM00324. RhoGAP. 1 hit.
[Graphical view]
SUPFAMiSSF48350. SSF48350. 1 hit.
SSF50729. SSF50729. 1 hit.
SSF54236. SSF54236. 1 hit.
PROSITEiPS50200. RA. 1 hit.
PS50238. RHOGAP. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-388 (ISOFORM 1).
    Strain: C57BL/6J.
    Tissue: Aorta, Cerebellum and Vein.
  2. "Prediction of the coding sequences of mouse homologues of KIAA gene: III. The complete nucleotide sequences of 500 mouse KIAA-homologous cDNAs identified by screening of terminal sequences of cDNA clones randomly sampled from size-fractionated libraries."
    Okazaki N., Kikuno R., Ohara R., Inamoto S., Koseki H., Hiraoka S., Saga Y., Nagase T., Ohara O., Koga H.
    DNA Res. 10:167-180(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 120-1182 (ISOFORM 1).
    Tissue: Brain.
  3. "Identification of RARhoGAP, a novel putative RhoGAP gene expressed in male germ cells."
    Curry B.J., Su H., Law E.G., McLaughlin E.A., Nixon B., Aitken R.J.
    Genomics 84:406-418(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION.
  4. "Identification and characterization of human KIAA1391 and mouse Kiaa1391 genes encoding novel RhoGAP family proteins with RA domain and ANXL repeats."
    Katoh M., Katoh M.
    Int. J. Oncol. 23:1471-1476(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION.
  5. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-46; SER-704 AND SER-730, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Brain and Testis.

Entry informationi

Entry nameiRHG20_MOUSE
AccessioniPrimary (citable) accession number: Q6IFT4
Secondary accession number(s): Q6ZPS4, Q8BLZ7, Q8BXI4
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 3, 2007
Last sequence update: July 5, 2004
Last modified: June 8, 2016
This is version 92 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.