Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Rho GTPase-activating protein 20

Gene

Arhgap20

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

GTPase activator for the Rho-type GTPases by converting them to an inactive GDP-bound state.By similarity

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionGTPase activation

Enzyme and pathway databases

ReactomeiR-MMU-194840 Rho GTPase cycle

Names & Taxonomyi

Protein namesi
Recommended name:
Rho GTPase-activating protein 20
Alternative name(s):
RA and RhoGAP domain-containing protein
Short name:
RARhoGAP
Rho-type GTPase-activating protein 20
Gene namesi
Name:Arhgap20
Synonyms:Kiaa1391
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 9

Organism-specific databases

MGIiMGI:2445175 Arhgap20

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002830871 – 1182Rho GTPase-activating protein 20Add BLAST1182

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei46PhosphoserineCombined sources1
Modified residuei704PhosphoserineCombined sources1
Modified residuei730PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiQ6IFT4
PRIDEiQ6IFT4

PTM databases

iPTMnetiQ6IFT4
PhosphoSitePlusiQ6IFT4

Expressioni

Gene expression databases

BgeeiENSMUSG00000053199
CleanExiMM_ARHGAP20
ExpressionAtlasiQ6IFT4 baseline and differential
GenevisibleiQ6IFT4 MM

Interactioni

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000065633

Structurei

3D structure databases

ProteinModelPortaliQ6IFT4
SMRiQ6IFT4
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini85 – 185PHAdd BLAST101
Domaini194 – 283Ras-associatingPROSITE-ProRule annotationAdd BLAST90
Domaini365 – 551Rho-GAPPROSITE-ProRule annotationAdd BLAST187

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi913 – 1012Ser-richAdd BLAST100

Phylogenomic databases

eggNOGiKOG4724 Eukaryota
ENOG410YV4E LUCA
GeneTreeiENSGT00530000063299
HOGENOMiHOG000048702
HOVERGENiHBG061748
InParanoidiQ6IFT4
KOiK20641
OMAiNICENDN
OrthoDBiEOG091G02C4
PhylomeDBiQ6IFT4
TreeFamiTF331062

Family and domain databases

Gene3Di1.10.555.10, 1 hit
2.30.29.30, 1 hit
InterProiView protein in InterPro
IPR011993 PH-like_dom_sf
IPR001849 PH_domain
IPR000159 RA_dom
IPR008936 Rho_GTPase_activation_prot
IPR000198 RhoGAP_dom
IPR029071 Ubiquitin-like_domsf
PfamiView protein in Pfam
PF00788 RA, 1 hit
PF00620 RhoGAP, 1 hit
SMARTiView protein in SMART
SM00233 PH, 1 hit
SM00324 RhoGAP, 1 hit
SUPFAMiSSF48350 SSF48350, 1 hit
SSF54236 SSF54236, 1 hit
PROSITEiView protein in PROSITE
PS50200 RA, 1 hit
PS50238 RHOGAP, 1 hit

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q6IFT4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MEAMSPQQDA LGAQPGRSSS LTGMSRIAGG PGTKKKMKTL AERRRSAPSL
60 70 80 90 100
ILDKALQKRP STRDSHSASI DTCAFLSSFM CSSRTLLIDG PVELKRGLQR
110 120 130 140 150
QERHLFLFND LFVSAKIKYN NNFKIKNKIR LTDMWTASCV EEVGEGNMNA
160 170 180 190 200
QKSFVLGWPT VNFVATFSSP EQKDKWLSLL QRYIALEKEK DYPKSIPLKI
210 220 230 240 250
FAKDIGNCAY FKTITVMNSD TASEVINMSL QMLGITGSER DYQLWVNSGK
260 270 280 290 300
EAAPYPLIGH EYPYGIKMSH LRDTALLTQG SRDSASPSQL QEPFLMEQLP
310 320 330 340 350
REMQCQFILK PTRLATAQQL SDSSQKTFKR RRSIINWAFW RGSSTHLDNL
360 370 380 390 400
PMSPTSPMPG QLFGVSLPDL CENDNLPKPI LDMLSFLNQK GPLTKGIFRQ
410 420 430 440 450
SANMKSCREL KEKLNSGIEV HLDCESIFVI ASVLKDFLRN IPESIFSSDL
460 470 480 490 500
YDHWVCVMDQ GNDEEKINII QRLLDQLPRA NVVFLRYLFG VLHNIEQHSL
510 520 530 540 550
SNQMTAFNLA VCIAPSILWP PASSSPELEN EFTKKVSLLI QFLIENCCRV
560 570 580 590 600
FGEEIASLLG ELSERSDREH TPDITCFQMN DSSYDSLENE LNEEADAPCS
610 620 630 640 650
DLVKKLGQGS RSMDSVLTLS DYDLEQPEVE GLLTLSNFDL DQSKEEHIPI
660 670 680 690 700
KPPLEPKPVN VFVGYRKVSL GEHARAPAGP GTLSCLPVAA ADAPKVLRRH
710 720 730 740 750
RRSSEPSIDY LDTKLSYLRE FYQKKLRKSS CDAVLSRKDE DYLKQTQPQK
760 770 780 790 800
KGDKVCLKQS SVTGTDVSKR NTANENIKKK SLSGHEGTQV TLFTKSKPVP
810 820 830 840 850
ISVASYSHGS SQDHPRKQAF DADPCRFSPP HLTDAQKSSR VQHRRCSEPS
860 870 880 890 900
IDDQNYKLSY LRGIYSMKQN KASCEAGLLH GEDDYLRRHK SLQIEGQKLI
910 920 930 940 950
NQSLVMGIEV GKSSSSHQST EKVLPPRLNL CPRASYSSLS SPGSSPSGSS
960 970 980 990 1000
VSSQDSAFSQ ISEHSVFTPT ETSSPIDCTF QTQRKQEELS SDFDSPSRLS
1010 1020 1030 1040 1050
GMPGPSMGQA SSHLAYLRKG TTEQPSQMHS VTLHPSAWLR SGLVTLKNWS
1060 1070 1080 1090 1100
LKKKTKAARP EDRKVCSLKE PLELPSCASG TPEADSLQES QDDLQGDEGP
1110 1120 1130 1140 1150
GQTACGFSSY ACQDSEQHAG SPFHLAESRL KPCMKLYKGE ESGGQYPCDN
1160 1170 1180
PWEGASSSLE TTEDTANPGA EPTTFAMTGT DI
Length:1,182
Mass (Da):131,374
Last modified:July 5, 2004 - v1
Checksum:i39B0BC5CC944D50B
GO
Isoform 2 (identifier: Q6IFT4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     184-217: IALEKEKDYPKSIPLKIFAKDIGNCAYFKTITVM → VPVHTVLMLSLTCLNQTCYCQICPRGAPFFLNGN
     218-1182: Missing.

Note: No experimental confirmation available.
Show »
Length:217
Mass (Da):24,243
Checksum:iBC778AADD67E3E13
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_024300184 – 217IALEK…TITVM → VPVHTVLMLSLTCLNQTCYC QICPRGAPFFLNGN in isoform 2. 1 PublicationAdd BLAST34
Alternative sequenceiVSP_024301218 – 1182Missing in isoform 2. 1 PublicationAdd BLAST965

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK040756 mRNA Translation: BAC30694.1
AK046916 mRNA Translation: BAC32919.1
AK129345 mRNA Translation: BAC98155.1
BK004077 mRNA Translation: DAA04568.1
CCDSiCCDS23177.1 [Q6IFT4-1]
RefSeqiNP_780744.2, NM_175535.3 [Q6IFT4-1]
UniGeneiMm.400352
Mm.443529

Genome annotation databases

EnsembliENSMUST00000065496; ENSMUSP00000065633; ENSMUSG00000053199 [Q6IFT4-1]
GeneIDi244867
KEGGimmu:244867
UCSCiuc009pli.1 mouse [Q6IFT4-2]
uc009plj.1 mouse [Q6IFT4-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiRHG20_MOUSE
AccessioniPrimary (citable) accession number: Q6IFT4
Secondary accession number(s): Q6ZPS4, Q8BLZ7, Q8BXI4
Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 3, 2007
Last sequence update: July 5, 2004
Last modified: March 28, 2018
This is version 101 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health