Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Elongator complex protein 2

Gene

ELP2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Regulates the ligand-dependent activation of STAT3.By similarity
Acts as subunit of the RNA polymerase II elongator complex, which is a histone acetyltransferase component of the RNA polymerase II (Pol II) holoenzyme and is involved in transcriptional elongation. Elongator may play a role in chromatin remodeling and is involved in acetylation of histones H3 and probably H4.2 Publications

GO - Molecular functioni

GO - Biological processi

  • regulation of JAK-STAT cascade Source: Ensembl
  • regulation of transcription from RNA polymerase II promoter Source: HGNC
  • transcription elongation from RNA polymerase II promoter Source: BHF-UCL
Complete GO annotation...

Keywords - Biological processi

Transcription, Transcription regulation

Enzyme and pathway databases

ReactomeiR-HSA-3214847. HATs acetylate histones.
SignaLinkiQ6IA86.

Names & Taxonomyi

Protein namesi
Recommended name:
Elongator complex protein 2
Short name:
ELP2
Alternative name(s):
SHINC-2
STAT3-interacting protein 1
Short name:
StIP1
Gene namesi
Name:ELP2
Synonyms:STATIP1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 18

Organism-specific databases

HGNCiHGNC:18248. ELP2.

Subcellular locationi

GO - Cellular componenti

  • cytoplasm Source: HGNC
  • Elongator holoenzyme complex Source: UniProtKB
  • histone acetyltransferase complex Source: BHF-UCL
  • transcriptional repressor complex Source: GO_Central
  • transcription elongation factor complex Source: HGNC
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi55250.
OpenTargetsiENSG00000134759.
PharmGKBiPA162385051.

Polymorphism and mutation databases

BioMutaiELP2.
DMDMi83305834.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000512411 – 826Elongator complex protein 2Add BLAST826

Proteomic databases

EPDiQ6IA86.
MaxQBiQ6IA86.
PeptideAtlasiQ6IA86.
PRIDEiQ6IA86.

PTM databases

iPTMnetiQ6IA86.
PhosphoSitePlusiQ6IA86.

Expressioni

Gene expression databases

BgeeiENSG00000134759.
CleanExiHS_ELP2.
ExpressionAtlasiQ6IA86. baseline and differential.
GenevisibleiQ6IA86. HS.

Organism-specific databases

HPAiCAB020835.
HPA002996.

Interactioni

Subunit structurei

Interacts with STAT3 and JAKs (By similarity). Component of the RNA polymerase II elongator complex (Elongator), which consists of IKBKAP/ELP1, STIP1/ELP2, ELP3, ELP4, and two yet unidentified proteins, p30 and p38. Elongator associates with the C-terminal domain (CTD) of Pol II largest subunit.By similarity3 Publications

GO - Molecular functioni

Protein-protein interaction databases

BioGridi120541. 32 interactors.
DIPiDIP-56235N.
IntActiQ6IA86. 3 interactors.

Structurei

3D structure databases

ProteinModelPortaliQ6IA86.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Repeati13 – 53WD 1Add BLAST41
Repeati56 – 100WD 2Add BLAST45
Repeati105 – 152WD 3Add BLAST48
Repeati158 – 200WD 4Add BLAST43
Repeati205 – 246WD 5Add BLAST42
Repeati281 – 329WD 6Add BLAST49
Repeati339 – 378WD 7Add BLAST40
Repeati386 – 425WD 8Add BLAST40
Repeati436 – 474WD 9Add BLAST39
Repeati565 – 609WD 10Add BLAST45
Repeati612 – 651WD 11Add BLAST40
Repeati667 – 706WD 12Add BLAST40
Repeati712 – 753WD 13Add BLAST42
Repeati777 – 826WD 14Add BLAST50

Sequence similaritiesi

Belongs to the WD repeat ELP2 family.Curated
Contains 14 WD repeats.PROSITE-ProRule annotation

Keywords - Domaini

Repeat, WD repeat

Phylogenomic databases

GeneTreeiENSGT00390000000916.
HOGENOMiHOG000200623.
HOVERGENiHBG087208.
InParanoidiQ6IA86.
KOiK11374.
OMAiLQFRPGK.
OrthoDBiEOG091G02XJ.
PhylomeDBiQ6IA86.
TreeFamiTF105985.

Family and domain databases

Gene3Di2.130.10.10. 4 hits.
InterProiIPR015943. WD40/YVTN_repeat-like_dom.
IPR001680. WD40_repeat.
IPR017986. WD40_repeat_dom.
[Graphical view]
PfamiPF00400. WD40. 5 hits.
[Graphical view]
SMARTiSM00320. WD40. 12 hits.
[Graphical view]
SUPFAMiSSF50978. SSF50978. 6 hits.
PROSITEiPS50082. WD_REPEATS_2. 5 hits.
PS50294. WD_REPEATS_REGION. 2 hits.
[Graphical view]

Sequences (7)i

Sequence statusi: Complete.

This entry describes 7 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q6IA86-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MVAPVLETSH VFCCPNRVRG VLNWSSGPRG LLAFGTSCSV VLYDPLKRVV
60 70 80 90 100
VTNLNGHTAR VNCIQWICKQ DGSPSTELVS GGSDNQVIHW EIEDNQLLKA
110 120 130 140 150
VHLQGHEGPV YAVHAVYQRR TSDPALCTLI VSAAADSAVR LWSKKGPEVM
160 170 180 190 200
CLQTLNFGNG FALALCLSFL PNTDVPILAC GNDDCRIHIF AQQNDQFQKV
210 220 230 240 250
LSLCGHEDWI RGVEWAAFGR DLFLASCSQD CLIRIWKLYI KSTSLETQDD
260 270 280 290 300
DNIRLKENTF TIENESVKIA FAVTLETVLA GHENWVNAVH WQPVFYKDGV
310 320 330 340 350
LQQPVRLLSA SMDKTMILWA PDEESGVWLE QVRVGEVGGN TLGFYDCQFN
360 370 380 390 400
EDGSMIIAHA FHGALHLWKQ NTVNPREWTP EIVISGHFDG VQDLVWDPEG
410 420 430 440 450
EFIITVGTDQ TTRLFAPWKR KDQSQVTWHE IARPQIHGYD LKCLAMINRF
460 470 480 490 500
QFVSGADEKV LRVFSAPRNF VENFCAITGQ SLNHVLCNQD SDLPEGATVP
510 520 530 540 550
ALGLSNKAVF QGDIASQPSD EEELLTSTGF EYQQVAFQPS ILTEPPTEDH
560 570 580 590 600
LLQNTLWPEV QKLYGHGYEI FCVTCNSSKT LLASACKAAK KEHAAIILWN
610 620 630 640 650
TTSWKQVQNL VFHSLTVTQM AFSPNEKFLL AVSRDRTWSL WKKQDTISPE
660 670 680 690 700
FEPVFSLFAF TNKITSVHSR IIWSCDWSPD SKYFFTGSRD KKVVVWGECD
710 720 730 740 750
STDDCIEHNI GPCSSVLDVG GAVTAVSVCP VLHPSQRYVV AVGLECGKIC
760 770 780 790 800
LYTWKKTDQV PEINDWTHCV ETSQSQSHTL AIRKLCWKNC SGKTEQKEAE
810 820
GAEWLHFASC GEDHTVKIHR VNKCAL
Length:826
Mass (Da):92,500
Last modified:December 6, 2005 - v2
Checksum:i949B417D4170B47B
GO
Isoform 2 (identifier: Q6IA86-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     149-174: Missing.
     332-375: Missing.

Show »
Length:756
Mass (Da):84,888
Checksum:iC9B6CC4C7CD62964
GO
Isoform 3 (identifier: Q6IA86-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     149-174: Missing.

Show »
Length:800
Mass (Da):89,715
Checksum:i6431208FC5B5AF7D
GO
Isoform 4 (identifier: Q6IA86-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     652-826: EPVFSLFAFT...KIHRVNKCAL → VELFGLVIGV...APQSWTWVGL

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Show »
Length:705
Mass (Da):78,576
Checksum:i6B1920C182C9097B
GO
Isoform 5 (identifier: Q6IA86-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     150-175: MCLQTLNFGNGFALALCLSFLPNTDV → TWKTGQVERG...SFLPSAFRPI
     332-375: Missing.

Note: No experimental confirmation available.
Show »
Length:821
Mass (Da):92,376
Checksum:i957180BEDAF50689
GO
Isoform 6 (identifier: Q6IA86-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     175-175: V → VTWKTGQVERGRAWKPPASLALCSRSCDSMVSCYASILCKALWKEKLHTFWHHNRISFLPSAFRPI

Note: No experimental confirmation available.
Show »
Length:891
Mass (Da):99,988
Checksum:i0BB79C8AA3766F60
GO
Isoform 7 (identifier: Q6IA86-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     149-218: Missing.

Note: No experimental confirmation available.
Show »
Length:756
Mass (Da):84,688
Checksum:i44E53C5158F5AF2E
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti66W → R in AAQ03093 (Ref. 2) Curated1
Sequence conflicti267V → F in CAG33550 (Ref. 4) Curated1
Sequence conflicti302Q → R in CAG33550 (Ref. 4) Curated1
Sequence conflicti376R → G in BAB14193 (PubMed:14702039).Curated1
Sequence conflicti412T → A in BAF85740 (PubMed:14702039).Curated1
Sequence conflicti590K → E in AAQ03093 (Ref. 2) Curated1
Sequence conflicti621A → T in BAG63452 (PubMed:14702039).Curated1
Sequence conflicti698E → V in AAK97355 (Ref. 1) Curated1
Sequence conflicti698E → V in BAB14193 (PubMed:14702039).Curated1
Sequence conflicti782I → V in BAF85740 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_024072128T → P.2 PublicationsCorresponds to variant rs1785934dbSNPEnsembl.1
Natural variantiVAR_024073305V → M.2 PublicationsCorresponds to variant rs1785928dbSNPEnsembl.1
Natural variantiVAR_024074359H → R.Corresponds to variant rs16967474dbSNPEnsembl.1
Natural variantiVAR_033804541I → T.Corresponds to variant rs28463092dbSNPEnsembl.1
Natural variantiVAR_033805543T → P.Corresponds to variant rs17563617dbSNPEnsembl.1
Natural variantiVAR_024075795E → G.Corresponds to variant rs12607773dbSNPEnsembl.1
Natural variantiVAR_024076806H → P.Corresponds to variant rs1044128dbSNPEnsembl.1
Natural variantiVAR_033806815T → P.Corresponds to variant rs1044134dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_044978149 – 218Missing in isoform 7. 1 PublicationAdd BLAST70
Alternative sequenceiVSP_016531149 – 174Missing in isoform 2 and isoform 3. 3 PublicationsAdd BLAST26
Alternative sequenceiVSP_043410150 – 175MCLQT…PNTDV → TWKTGQVERGRAWKPPASLA LCSRSCDSMVSCYASILCKA LWKEKLHTFWHHNRISFLPS AFRPI in isoform 5. 1 PublicationAdd BLAST26
Alternative sequenceiVSP_044979175V → VTWKTGQVERGRAWKPPASL ALCSRSCDSMVSCYASILCK ALWKEKLHTFWHHNRISFLP SAFRPI in isoform 6. 1 Publication1
Alternative sequenceiVSP_016532332 – 375Missing in isoform 2 and isoform 5. 2 PublicationsAdd BLAST44
Alternative sequenceiVSP_016533652 – 826EPVFS…NKCAL → VELFGLVIGVLTASISSLGV ETKRWLSGVSATPLMTVLST TLAPAPQSWTWVGL in isoform 4. 1 PublicationAdd BLAST175

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF332505 mRNA. Translation: AAK97355.1.
AF403223 mRNA. Translation: AAQ03093.1.
AK001741 mRNA. Translation: BAA91874.1.
AK022709 mRNA. Translation: BAB14193.1.
AK293051 mRNA. Translation: BAF85740.1.
AK300201 mRNA. Translation: BAG61972.1.
AK302062 mRNA. Translation: BAG63452.1.
CR457269 mRNA. Translation: CAG33550.1.
AK222791 mRNA. Translation: BAD96511.1.
AC023043 Genomic DNA. No translation available.
AC091060 Genomic DNA. No translation available.
BC009211 mRNA. Translation: AAH09211.2.
BC032553 mRNA. Translation: AAH32553.1.
CCDSiCCDS11918.1. [Q6IA86-1]
CCDS56065.1. [Q6IA86-6]
CCDS56066.1. [Q6IA86-5]
CCDS56067.1. [Q6IA86-3]
CCDS56068.1. [Q6IA86-2]
CCDS56069.1. [Q6IA86-7]
RefSeqiNP_001229804.1. NM_001242875.2. [Q6IA86-6]
NP_001229805.1. NM_001242876.2. [Q6IA86-5]
NP_001229806.1. NM_001242877.2. [Q6IA86-3]
NP_001229807.1. NM_001242878.2. [Q6IA86-2]
NP_001229808.1. NM_001242879.2. [Q6IA86-7]
NP_060725.1. NM_018255.3. [Q6IA86-1]
UniGeneiHs.606040.
Hs.8739.

Genome annotation databases

EnsembliENST00000350494; ENSP00000316051; ENSG00000134759. [Q6IA86-5]
ENST00000351393; ENSP00000257191; ENSG00000134759. [Q6IA86-3]
ENST00000358232; ENSP00000350967; ENSG00000134759. [Q6IA86-1]
ENST00000423854; ENSP00000391202; ENSG00000134759. [Q6IA86-7]
ENST00000442325; ENSP00000414851; ENSG00000134759. [Q6IA86-6]
ENST00000539560; ENSP00000443555; ENSG00000134759. [Q6IA86-4]
ENST00000542824; ENSP00000443800; ENSG00000134759. [Q6IA86-2]
GeneIDi55250.
KEGGihsa:55250.
UCSCiuc002kzk.4. human. [Q6IA86-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF332505 mRNA. Translation: AAK97355.1.
AF403223 mRNA. Translation: AAQ03093.1.
AK001741 mRNA. Translation: BAA91874.1.
AK022709 mRNA. Translation: BAB14193.1.
AK293051 mRNA. Translation: BAF85740.1.
AK300201 mRNA. Translation: BAG61972.1.
AK302062 mRNA. Translation: BAG63452.1.
CR457269 mRNA. Translation: CAG33550.1.
AK222791 mRNA. Translation: BAD96511.1.
AC023043 Genomic DNA. No translation available.
AC091060 Genomic DNA. No translation available.
BC009211 mRNA. Translation: AAH09211.2.
BC032553 mRNA. Translation: AAH32553.1.
CCDSiCCDS11918.1. [Q6IA86-1]
CCDS56065.1. [Q6IA86-6]
CCDS56066.1. [Q6IA86-5]
CCDS56067.1. [Q6IA86-3]
CCDS56068.1. [Q6IA86-2]
CCDS56069.1. [Q6IA86-7]
RefSeqiNP_001229804.1. NM_001242875.2. [Q6IA86-6]
NP_001229805.1. NM_001242876.2. [Q6IA86-5]
NP_001229806.1. NM_001242877.2. [Q6IA86-3]
NP_001229807.1. NM_001242878.2. [Q6IA86-2]
NP_001229808.1. NM_001242879.2. [Q6IA86-7]
NP_060725.1. NM_018255.3. [Q6IA86-1]
UniGeneiHs.606040.
Hs.8739.

3D structure databases

ProteinModelPortaliQ6IA86.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi120541. 32 interactors.
DIPiDIP-56235N.
IntActiQ6IA86. 3 interactors.

PTM databases

iPTMnetiQ6IA86.
PhosphoSitePlusiQ6IA86.

Polymorphism and mutation databases

BioMutaiELP2.
DMDMi83305834.

Proteomic databases

EPDiQ6IA86.
MaxQBiQ6IA86.
PeptideAtlasiQ6IA86.
PRIDEiQ6IA86.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000350494; ENSP00000316051; ENSG00000134759. [Q6IA86-5]
ENST00000351393; ENSP00000257191; ENSG00000134759. [Q6IA86-3]
ENST00000358232; ENSP00000350967; ENSG00000134759. [Q6IA86-1]
ENST00000423854; ENSP00000391202; ENSG00000134759. [Q6IA86-7]
ENST00000442325; ENSP00000414851; ENSG00000134759. [Q6IA86-6]
ENST00000539560; ENSP00000443555; ENSG00000134759. [Q6IA86-4]
ENST00000542824; ENSP00000443800; ENSG00000134759. [Q6IA86-2]
GeneIDi55250.
KEGGihsa:55250.
UCSCiuc002kzk.4. human. [Q6IA86-1]

Organism-specific databases

CTDi55250.
DisGeNETi55250.
GeneCardsiELP2.
HGNCiHGNC:18248. ELP2.
HPAiCAB020835.
HPA002996.
MIMi616054. gene.
neXtProtiNX_Q6IA86.
OpenTargetsiENSG00000134759.
PharmGKBiPA162385051.
GenAtlasiSearch...

Phylogenomic databases

GeneTreeiENSGT00390000000916.
HOGENOMiHOG000200623.
HOVERGENiHBG087208.
InParanoidiQ6IA86.
KOiK11374.
OMAiLQFRPGK.
OrthoDBiEOG091G02XJ.
PhylomeDBiQ6IA86.
TreeFamiTF105985.

Enzyme and pathway databases

ReactomeiR-HSA-3214847. HATs acetylate histones.
SignaLinkiQ6IA86.

Miscellaneous databases

ChiTaRSiELP2. human.
GeneWikiiELP2.
GenomeRNAii55250.
PROiQ6IA86.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000134759.
CleanExiHS_ELP2.
ExpressionAtlasiQ6IA86. baseline and differential.
GenevisibleiQ6IA86. HS.

Family and domain databases

Gene3Di2.130.10.10. 4 hits.
InterProiIPR015943. WD40/YVTN_repeat-like_dom.
IPR001680. WD40_repeat.
IPR017986. WD40_repeat_dom.
[Graphical view]
PfamiPF00400. WD40. 5 hits.
[Graphical view]
SMARTiSM00320. WD40. 12 hits.
[Graphical view]
SUPFAMiSSF50978. SSF50978. 6 hits.
PROSITEiPS50082. WD_REPEATS_2. 5 hits.
PS50294. WD_REPEATS_REGION. 2 hits.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiELP2_HUMAN
AccessioniPrimary (citable) accession number: Q6IA86
Secondary accession number(s): A8KAI6
, B4DTG0, B4DXP0, E7EP23, E9PCX0, Q53GZ0, Q687Y8, Q8N5C2, Q96GV4, Q96PI7, Q9H9N0, Q9NV81
Entry historyi
Integrated into UniProtKB/Swiss-Prot: December 6, 2005
Last sequence update: December 6, 2005
Last modified: November 2, 2016
This is version 127 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 18
    Human chromosome 18: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.