Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q6HA09

- ASTL_MOUSE

UniProt

Q6HA09 - ASTL_MOUSE

Protein

Astacin-like metalloendopeptidase

Gene

Astl

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 91 (01 Oct 2014)
      Sequence version 3 (27 Sep 2005)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Oocyte-specific oolemmal receptor involved in sperm and egg adhesion and fertilization. Plays a role in the polyspermy inhibition. Probably acts as a protease for the post-fertilization cleavage of ZP2. Cleaves the sperm-binding ZP2 at the surface of the zona pellucida after fertilization and cortical granule exocytosis, rendering the zona pellucida unable to support further sperm binding.2 Publications

    Enzyme regulationi

    Inhibited by wide spectrum metalloproteinase inhibitor batimastat (BB-94). Also inhibited by EDTA By similarity.By similarity

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Metal bindingi182 – 1821Zinc; catalyticPROSITE-ProRule annotation
    Active sitei183 – 1831By similarityPROSITE-ProRule annotation
    Metal bindingi186 – 1861Zinc; catalyticPROSITE-ProRule annotation
    Metal bindingi192 – 1921Zinc; catalyticPROSITE-ProRule annotation

    GO - Molecular functioni

    1. aspartic-type peptidase activity Source: UniProtKB
    2. glutamic-type peptidase activity Source: UniProtKB
    3. metalloendopeptidase activity Source: UniProtKB
    4. peptidase activity Source: UniProtKB
    5. protein binding Source: UniProtKB
    6. zinc ion binding Source: InterPro

    GO - Biological processi

    1. cell adhesion Source: UniProtKB
    2. fertilization Source: UniProtKB
    3. negative regulation of binding of sperm to zona pellucida Source: UniProtKB
    4. positive regulation of protein processing Source: UniProtKB
    5. prevention of polyspermy Source: UniProtKB

    Keywords - Molecular functioni

    Hydrolase, Metalloprotease, Protease

    Keywords - Biological processi

    Fertilization

    Keywords - Ligandi

    Metal-binding, Zinc

    Protein family/group databases

    MEROPSiM12.245.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Astacin-like metalloendopeptidase (EC:3.4.-.-)
    Alternative name(s):
    Oocyte astacin
    Ovastacin
    Sperm acrosomal SLLP1-binding protein
    Gene namesi
    Name:AstlImported
    Synonyms:Sas1b
    OrganismiMus musculus (Mouse)
    Taxonomic identifieri10090 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
    ProteomesiUP000000589: Chromosome 2

    Organism-specific databases

    MGIiMGI:3046414. Astl.

    Subcellular locationi

    Cytoplasm. Cell membrane. Cytoplasmic granule. Cytoplasmic vesiclesecretory vesicle
    Note: Secretory granules. Localizes to the peripheral cortical granules of ovulated eggs. Probably exocytosed from cortical granules during post-fertilization. Detected throughout the ooplasm of germinal vesicle stage oocytes in early bilaminar secondary follicles at postnatal (PN) day 3. Detected in the microvillar domain of the oolemma in arrested ovulated secondary oocytes and in the first polar body prior to fertilization. Upon fertilization, detected in the perivitelline space (PVS) and occasionally on the oolemma in 2-cell through morulae stages. Colocalizes with SPACA3 at the microvillar domain of the oolemma and in the perivitelline space (PVS).

    GO - Cellular componenti

    1. cortical granule Source: UniProtKB
    2. cytoplasm Source: UniProtKB
    3. plasma membrane Source: UniProtKB
    4. transport vesicle Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Cell membrane, Cytoplasm, Cytoplasmic vesicle, Membrane

    Pathology & Biotechi

    Disruption phenotypei

    Absence of cortical granules exocytosis during post-fertilization. Multiple capacitated sperm binding to eggs and two-cell embryos are not prevented. Post-fertilization cleavage of ZP2 does not occur.2 Publications

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Signal peptidei1 – 2323Sequence AnalysisAdd
    BLAST
    Chaini24 – 435412Astacin-like metalloendopeptidaseSequence AnalysisPRO_0000041965Add
    BLAST

    Keywords - PTMi

    Zymogen

    Proteomic databases

    PRIDEiQ6HA09.

    PTM databases

    PhosphoSiteiQ6HA09.

    Expressioni

    Tissue specificityi

    Ovary-specific. Expressed in secondary, antral and Graafian follicle oocytes. Expressed in the egg cells. Not detected in two-cell embryos. Not detected in naked oocytes, oocytes in primordial or unilaminar primary follicles, or in any other ovarian cells at pre-pubertal, pubertal or adult stages (at protein level). Ovary-specific.2 Publications

    Developmental stagei

    Expressed in embryonic stem cells. Highly expressed in unfertilized oocytes. Upon fertilization, expression drops to undetectable levels, although at 1.5 dpc a significant amount of ovastacin RNA could still be detected. Not detected from 1.5 dpc to implantation of the embryo.2 Publications

    Inductioni

    Up-regulated by superovulation.1 Publication

    Gene expression databases

    BgeeiQ6HA09.
    CleanExiMM_ASTL.
    GenevestigatoriQ6HA09.

    Interactioni

    Subunit structurei

    Interacts (via N-terminal domain) with SPACA3; the interaction occurs during fertilization.1 Publication

    Structurei

    3D structure databases

    ProteinModelPortaliQ6HA09.
    SMRiQ6HA09. Positions 40-322.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Sequence similaritiesi

    Belongs to the peptidase M12A family.Sequence Analysis

    Keywords - Domaini

    Signal

    Phylogenomic databases

    eggNOGiNOG330389.
    GeneTreeiENSGT00740000115263.
    HOGENOMiHOG000231483.
    HOVERGENiHBG080299.
    InParanoidiQ6HA09.
    KOiK08778.
    OMAiRWNLSAS.
    OrthoDBiEOG73V6MT.
    PhylomeDBiQ6HA09.
    TreeFamiTF315280.

    Family and domain databases

    Gene3Di3.40.390.10. 1 hit.
    InterProiIPR024079. MetalloPept_cat_dom.
    IPR001506. Peptidase_M12A.
    IPR006026. Peptidase_Metallo.
    [Graphical view]
    PfamiPF01400. Astacin. 1 hit.
    [Graphical view]
    PRINTSiPR00480. ASTACIN.
    SMARTiSM00235. ZnMc. 1 hit.
    [Graphical view]
    PROSITEiPS00142. ZINC_PROTEASE. 1 hit.
    [Graphical view]

    Sequences (6)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 6 isoformsi produced by alternative splicing. Align

    Isoform 11 Publication (identifier: Q6HA09-1) [UniParc]FASTAAdd to Basket

    Also known as: V1

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MGIMGSLWPW ILTMLSLLGL SMGAPSASRC SGVCSTSVPE GFTPEGSPVF    50
    QDKDIPAINQ GLISEETPES SFLVEGDIIR PSPFRLLSVT NNKWPKGVGG 100
    FVEIPFLLSR KYDELSRRVI MDAFAEFERF TCIRFVAYHG QRDFVSILPM 150
    AGCFSGVGRS GGMQVVSLAP TCLRKGRGIV LHELMHVLGF WHEHSRADRD 200
    RYIQVNWNEI LPGFEINFIK SRSTNMLVPY DYSSVMHYGR FAFSWRGQPT 250
    IIPLWTSSVH IGQRWNLSTS DITRVCRLYN CSRSVPDSHG RGFEAQSDGS 300
    SLTPASISRL QRLLEALSEE SGSSAPSGSR TGGQSIAGLG NSQQGWEHPP 350
    QSTFSVGALA RPPQMLADAS KSGPGAGADS LSLEQFQLAQ APTVPLALFP 400
    EARDKPAPIQ DAFERLAPLP GGCAPGSHIR EVPRD 435
    Length:435
    Mass (Da):47,455
    Last modified:September 27, 2005 - v3
    Checksum:i8530CC0E5B3B1350
    GO
    Isoform 2Curated (identifier: Q6HA09-2) [UniParc]FASTAAdd to Basket

    Also known as: V2

    The sequence of this isoform differs from the canonical sequence as follows:
         1-21: Missing.

    Note: No experimental confirmation available.Curated

    Show »
    Length:414
    Mass (Da):45,153
    Checksum:i2B8809620D02A446
    GO
    Isoform 3 (identifier: Q6HA09-3) [UniParc]FASTAAdd to Basket

    Also known as: V6

    The sequence of this isoform differs from the canonical sequence as follows:
         82-113: SPFRLLSVTNNKWPKGVGGFVEIPFLLSRKYD → GVSHGVSFPN

    Show »
    Length:413
    Mass (Da):44,789
    Checksum:iC1C54E7EF96B07D0
    GO
    Isoform 4 (identifier: Q6HA09-4) [UniParc]FASTAAdd to Basket

    Also known as: V4

    The sequence of this isoform differs from the canonical sequence as follows:
         72-105: Missing.

    Show »
    Length:401
    Mass (Da):43,690
    Checksum:iC7A87D14F4431CF9
    GO
    Isoform 5 (identifier: Q6HA09-5) [UniParc]FASTAAdd to Basket

    Also known as: V5

    The sequence of this isoform differs from the canonical sequence as follows:
         1-21: Missing.
         82-112: SPFRLLSVTNNKWPKGVGGFVEIPFLLSRKY → GVSHGVSFP

    Show »
    Length:392
    Mass (Da):42,488
    Checksum:iA52197139D38C30B
    GO
    Isoform 6 (identifier: Q6HA09-6) [UniParc]FASTAAdd to Basket

    Also known as: V3

    The sequence of this isoform differs from the canonical sequence as follows:
         1-21: Missing.
         72-105: Missing.

    Show »
    Length:380
    Mass (Da):41,388
    Checksum:iB5C5B37A8C5DD84E
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti45 – 451E → G in CAD61264. (PubMed:15087446)Curated
    Sequence conflicti115 – 1151L → P in CAD61264. (PubMed:15087446)Curated
    Sequence conflicti283 – 2831R → Q in CAD61264. (PubMed:15087446)Curated
    Sequence conflicti300 – 3001S → R in CAD61264. (PubMed:15087446)Curated
    Sequence conflicti309 – 3091R → H in CAD61264. (PubMed:15087446)Curated
    Sequence conflicti368 – 3681D → A in CAD61264. (PubMed:15087446)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 2121Missing in isoform 2, isoform 5 and isoform 6. 2 PublicationsVSP_051832Add
    BLAST
    Alternative sequencei72 – 10534Missing in isoform 4 and isoform 6. 1 PublicationVSP_043997Add
    BLAST
    Alternative sequencei82 – 11332SPFRL…SRKYD → GVSHGVSFPN in isoform 3. 1 PublicationVSP_043998Add
    BLAST
    Alternative sequencei82 – 11231SPFRL…LSRKY → GVSHGVSFP in isoform 5. 1 PublicationVSP_043999Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AJ537599 mRNA. Translation: CAD61264.2.
    FJ187790 mRNA. Translation: ACN71160.1.
    FJ187791 mRNA. Translation: ACN71161.1.
    FJ187792 mRNA. Translation: ACN71162.1.
    FJ187793 mRNA. Translation: ACN71163.1.
    FJ187794 mRNA. Translation: ACN71164.1.
    FJ187795 mRNA. Translation: ACN71165.1.
    AK033037 mRNA. Translation: BAC28134.1.
    AL731836, AL845368 Genomic DNA. Translation: CAM13879.1.
    AL731836, AL845368 Genomic DNA. Translation: CAM13880.1.
    AL845368, AL731836 Genomic DNA. Translation: CAM17447.1.
    AL845368, AL731836 Genomic DNA. Translation: CAM17448.1.
    BC064729 mRNA. Translation: AAH64729.2.
    CCDSiCCDS16700.1. [Q6HA09-2]
    CCDS71138.1. [Q6HA09-1]
    RefSeqiNP_001277932.1. NM_001291003.1. [Q6HA09-1]
    NP_766127.1. NM_172539.3. [Q6HA09-2]
    UniGeneiMm.31313.
    Mm.58214.

    Genome annotation databases

    EnsembliENSMUST00000059839; ENSMUSP00000054456; ENSMUSG00000050468. [Q6HA09-2]
    ENSMUST00000089673; ENSMUSP00000087102; ENSMUSG00000050468. [Q6HA09-1]
    ENSMUST00000179618; ENSMUSP00000135987; ENSMUSG00000050468. [Q6HA09-2]
    GeneIDi215095.
    KEGGimmu:215095.
    UCSCiuc008mfg.1. mouse. [Q6HA09-1]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Web resourcesi

    Protein Spotlight

    Life's boundaries - Issue 141 of September 2012

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AJ537599 mRNA. Translation: CAD61264.2 .
    FJ187790 mRNA. Translation: ACN71160.1 .
    FJ187791 mRNA. Translation: ACN71161.1 .
    FJ187792 mRNA. Translation: ACN71162.1 .
    FJ187793 mRNA. Translation: ACN71163.1 .
    FJ187794 mRNA. Translation: ACN71164.1 .
    FJ187795 mRNA. Translation: ACN71165.1 .
    AK033037 mRNA. Translation: BAC28134.1 .
    AL731836 , AL845368 Genomic DNA. Translation: CAM13879.1 .
    AL731836 , AL845368 Genomic DNA. Translation: CAM13880.1 .
    AL845368 , AL731836 Genomic DNA. Translation: CAM17447.1 .
    AL845368 , AL731836 Genomic DNA. Translation: CAM17448.1 .
    BC064729 mRNA. Translation: AAH64729.2 .
    CCDSi CCDS16700.1. [Q6HA09-2 ]
    CCDS71138.1. [Q6HA09-1 ]
    RefSeqi NP_001277932.1. NM_001291003.1. [Q6HA09-1 ]
    NP_766127.1. NM_172539.3. [Q6HA09-2 ]
    UniGenei Mm.31313.
    Mm.58214.

    3D structure databases

    ProteinModelPortali Q6HA09.
    SMRi Q6HA09. Positions 40-322.
    ModBasei Search...
    MobiDBi Search...

    Protein family/group databases

    MEROPSi M12.245.

    PTM databases

    PhosphoSitei Q6HA09.

    Proteomic databases

    PRIDEi Q6HA09.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENSMUST00000059839 ; ENSMUSP00000054456 ; ENSMUSG00000050468 . [Q6HA09-2 ]
    ENSMUST00000089673 ; ENSMUSP00000087102 ; ENSMUSG00000050468 . [Q6HA09-1 ]
    ENSMUST00000179618 ; ENSMUSP00000135987 ; ENSMUSG00000050468 . [Q6HA09-2 ]
    GeneIDi 215095.
    KEGGi mmu:215095.
    UCSCi uc008mfg.1. mouse. [Q6HA09-1 ]

    Organism-specific databases

    CTDi 431705.
    MGIi MGI:3046414. Astl.

    Phylogenomic databases

    eggNOGi NOG330389.
    GeneTreei ENSGT00740000115263.
    HOGENOMi HOG000231483.
    HOVERGENi HBG080299.
    InParanoidi Q6HA09.
    KOi K08778.
    OMAi RWNLSAS.
    OrthoDBi EOG73V6MT.
    PhylomeDBi Q6HA09.
    TreeFami TF315280.

    Miscellaneous databases

    NextBioi 374608.
    PROi Q6HA09.
    SOURCEi Search...

    Gene expression databases

    Bgeei Q6HA09.
    CleanExi MM_ASTL.
    Genevestigatori Q6HA09.

    Family and domain databases

    Gene3Di 3.40.390.10. 1 hit.
    InterProi IPR024079. MetalloPept_cat_dom.
    IPR001506. Peptidase_M12A.
    IPR006026. Peptidase_Metallo.
    [Graphical view ]
    Pfami PF01400. Astacin. 1 hit.
    [Graphical view ]
    PRINTSi PR00480. ASTACIN.
    SMARTi SM00235. ZnMc. 1 hit.
    [Graphical view ]
    PROSITEi PS00142. ZINC_PROTEASE. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Identification and characterization of human and mouse ovastacin, a novel metalloproteinase similar to hatching enzymes from arthropods, birds, amphibians, and fish."
      Quesada V., Sanchez J., Alvarez J., Lopez-Otin C.
      J. Biol. Chem. 279:26627-26634(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), INDUCTION, DEVELOPMENTAL STAGE.
      Strain: C57BL/6JImported.
      Tissue: Ovary1 Publication.
    2. "Oocyte specific oolemmal SAS1B involved in sperm binding through intra-acrosomal SLLP1 during fertilization."
      Sachdev M., Mandal A., Mulders S., Digilio L.C., Panneerdoss S., Suryavathi V., Pires E., Klotz K.L., Hermens L., Herrero M.B., Flickinger C.J., van Duin M., Herr J.C.
      Dev. Biol. 363:40-51(2012) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3; 4; 5 AND 6), FUNCTION IN FERTILIZATION, TOPOLOGY, ENZYME ACTIVITY, INTERACTION WITH SPACA3, SUBCELLULAR LOCATION, TISSUE SPECIFICITY, DISRUPTION PHENOTYPE, IDENTIFICATION BY MASS SPECTROMETRY.
      Strain: Swiss Webster.
      Tissue: Ovary.
    3. "The transcriptional landscape of the mammalian genome."
      Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
      , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
      Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Strain: C57BL/6J.
      Tissue: Egg.
    4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
      Strain: C57BL/6J.
    5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Strain: C57BL/6J.
      Tissue: Egg.
    6. "Astacin-like metallo-endopeptidase is dynamically expressed in embryonic stem cells and embryonic epithelium during morphogenesis."
      Acloque H., Lavial F., Pain B.
      Dev. Dyn. 241:574-582(2012) [PubMed] [Europe PMC] [Abstract]
      Cited for: DEVELOPMENTAL STAGE.
    7. "Ovastacin, a cortical granule protease, cleaves ZP2 in the zona pellucida to prevent polyspermy."
      Burkart A.D., Xiong B., Baibakov B., Jimenez-Movilla M., Dean J.
      J. Cell Biol. 197:37-44(2012) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION IN POLYSPERMY INHIBITION, CLEAVAGE OF ZP2, SUBCELLULAR LOCATION, DISRUPTION PHENOTYPE, TISSUE SPECIFICITY.

    Entry informationi

    Entry nameiASTL_MOUSE
    AccessioniPrimary (citable) accession number: Q6HA09
    Secondary accession number(s): A2AHU0
    , A2AHU1, G7Z016, G7Z017, G7Z018, G7Z019, Q8BMA1
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: September 27, 2005
    Last sequence update: September 27, 2005
    Last modified: October 1, 2014
    This is version 91 of the entry and version 3 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. MGD cross-references
      Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
    2. Peptidase families
      Classification of peptidase families and list of entries
    3. Protein Spotlight
      Protein Spotlight articles and cited UniProtKB/Swiss-Prot entries
    4. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3