Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Astacin-like metalloendopeptidase

Gene

Astl

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Oocyte-specific oolemmal receptor involved in sperm and egg adhesion and fertilization. Plays a role in the polyspermy inhibition. Probably acts as a protease for the post-fertilization cleavage of ZP2. Cleaves the sperm-binding ZP2 at the surface of the zona pellucida after fertilization and cortical granule exocytosis, rendering the zona pellucida unable to support further sperm binding.2 Publications

Enzyme regulationi

Inhibited by wide spectrum metalloproteinase inhibitor batimastat (BB-94). Also inhibited by EDTA (By similarity).By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Metal bindingi182Zinc; catalyticPROSITE-ProRule annotation1
Active sitei183PROSITE-ProRule annotationBy similarity1
Metal bindingi186Zinc; catalyticPROSITE-ProRule annotation1
Metal bindingi192Zinc; catalyticPROSITE-ProRule annotation1

GO - Molecular functioni

  • aspartic-type peptidase activity Source: UniProtKB
  • glutamic-type peptidase activity Source: UniProtKB
  • metalloendopeptidase activity Source: UniProtKB
  • peptidase activity Source: UniProtKB
  • zinc ion binding Source: InterPro

GO - Biological processi

  • cell adhesion Source: UniProtKB
  • fertilization Source: UniProtKB
  • negative regulation of binding of sperm to zona pellucida Source: UniProtKB
  • positive regulation of protein processing Source: UniProtKB
  • prevention of polyspermy Source: UniProtKB
  • proteolysis Source: MGI
Complete GO annotation...

Keywords - Molecular functioni

Hydrolase, Metalloprotease, Protease

Keywords - Biological processi

Fertilization

Keywords - Ligandi

Metal-binding, Zinc

Protein family/group databases

MEROPSiM12.245.

Names & Taxonomyi

Protein namesi
Recommended name:
Astacin-like metalloendopeptidase (EC:3.4.-.-)
Alternative name(s):
Oocyte astacin
Ovastacin
Sperm acrosomal SLLP1-binding protein
Gene namesi
Name:AstlImported
Synonyms:Sas1b
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 2

Organism-specific databases

MGIiMGI:3046414. Astl.

Subcellular locationi

GO - Cellular componenti

  • cortical granule Source: UniProtKB
  • cytoplasm Source: UniProtKB
  • plasma membrane Source: UniProtKB
  • transport vesicle Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Cytoplasm, Cytoplasmic vesicle, Membrane

Pathology & Biotechi

Disruption phenotypei

Absence of cortical granules exocytosis during post-fertilization. Multiple capacitated sperm binding to eggs and two-cell embryos are not prevented. Post-fertilization cleavage of ZP2 does not occur.2 Publications

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 23Sequence analysisAdd BLAST23
ChainiPRO_000004196524 – 435Astacin-like metalloendopeptidaseSequence analysisAdd BLAST412

Keywords - PTMi

Zymogen

Proteomic databases

PaxDbiQ6HA09.
PRIDEiQ6HA09.

PTM databases

iPTMnetiQ6HA09.
PhosphoSitePlusiQ6HA09.

Expressioni

Tissue specificityi

Ovary-specific. Expressed in secondary, antral and Graafian follicle oocytes. Expressed in the egg cells. Not detected in two-cell embryos. Not detected in naked oocytes, oocytes in primordial or unilaminar primary follicles, or in any other ovarian cells at pre-pubertal, pubertal or adult stages (at protein level). Ovary-specific.2 Publications

Developmental stagei

Expressed in embryonic stem cells. Highly expressed in unfertilized oocytes. Upon fertilization, expression drops to undetectable levels, although at 1.5 dpc a significant amount of ovastacin RNA could still be detected. Not detected from 1.5 dpc to implantation of the embryo.2 Publications

Inductioni

Up-regulated by superovulation.1 Publication

Gene expression databases

BgeeiENSMUSG00000050468.
CleanExiMM_ASTL.
ExpressionAtlasiQ6HA09. baseline and differential.
GenevisibleiQ6HA09. MM.

Interactioni

Subunit structurei

Interacts (via N-terminal domain) with SPACA3; the interaction occurs during fertilization.1 Publication

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000054456.

Structurei

3D structure databases

ProteinModelPortaliQ6HA09.
SMRiQ6HA09.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the peptidase M12A family.Sequence analysis

Keywords - Domaini

Signal

Phylogenomic databases

eggNOGiKOG3714. Eukaryota.
ENOG410ZPX7. LUCA.
GeneTreeiENSGT00760000119227.
HOGENOMiHOG000231483.
HOVERGENiHBG080299.
InParanoidiQ6HA09.
KOiK08778.
OMAiISIIPMY.
OrthoDBiEOG091G009U.
PhylomeDBiQ6HA09.
TreeFamiTF315280.

Family and domain databases

Gene3Di3.40.390.10. 1 hit.
InterProiIPR024079. MetalloPept_cat_dom.
IPR001506. Peptidase_M12A.
IPR006026. Peptidase_Metallo.
[Graphical view]
PfamiPF01400. Astacin. 1 hit.
[Graphical view]
PRINTSiPR00480. ASTACIN.
SMARTiSM00235. ZnMc. 1 hit.
[Graphical view]
PROSITEiPS00142. ZINC_PROTEASE. 1 hit.
[Graphical view]

Sequences (6)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 6 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 11 Publication (identifier: Q6HA09-1) [UniParc]FASTAAdd to basket
Also known as: V1

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGIMGSLWPW ILTMLSLLGL SMGAPSASRC SGVCSTSVPE GFTPEGSPVF
60 70 80 90 100
QDKDIPAINQ GLISEETPES SFLVEGDIIR PSPFRLLSVT NNKWPKGVGG
110 120 130 140 150
FVEIPFLLSR KYDELSRRVI MDAFAEFERF TCIRFVAYHG QRDFVSILPM
160 170 180 190 200
AGCFSGVGRS GGMQVVSLAP TCLRKGRGIV LHELMHVLGF WHEHSRADRD
210 220 230 240 250
RYIQVNWNEI LPGFEINFIK SRSTNMLVPY DYSSVMHYGR FAFSWRGQPT
260 270 280 290 300
IIPLWTSSVH IGQRWNLSTS DITRVCRLYN CSRSVPDSHG RGFEAQSDGS
310 320 330 340 350
SLTPASISRL QRLLEALSEE SGSSAPSGSR TGGQSIAGLG NSQQGWEHPP
360 370 380 390 400
QSTFSVGALA RPPQMLADAS KSGPGAGADS LSLEQFQLAQ APTVPLALFP
410 420 430
EARDKPAPIQ DAFERLAPLP GGCAPGSHIR EVPRD
Length:435
Mass (Da):47,455
Last modified:September 27, 2005 - v3
Checksum:i8530CC0E5B3B1350
GO
Isoform 2Curated (identifier: Q6HA09-2) [UniParc]FASTAAdd to basket
Also known as: V2

The sequence of this isoform differs from the canonical sequence as follows:
     1-21: Missing.

Note: No experimental confirmation available.Curated
Show »
Length:414
Mass (Da):45,153
Checksum:i2B8809620D02A446
GO
Isoform 3 (identifier: Q6HA09-3) [UniParc]FASTAAdd to basket
Also known as: V6

The sequence of this isoform differs from the canonical sequence as follows:
     82-113: SPFRLLSVTNNKWPKGVGGFVEIPFLLSRKYD → GVSHGVSFPN

Show »
Length:413
Mass (Da):44,789
Checksum:iC1C54E7EF96B07D0
GO
Isoform 4 (identifier: Q6HA09-4) [UniParc]FASTAAdd to basket
Also known as: V4

The sequence of this isoform differs from the canonical sequence as follows:
     72-105: Missing.

Show »
Length:401
Mass (Da):43,690
Checksum:iC7A87D14F4431CF9
GO
Isoform 5 (identifier: Q6HA09-5) [UniParc]FASTAAdd to basket
Also known as: V5

The sequence of this isoform differs from the canonical sequence as follows:
     1-21: Missing.
     82-112: SPFRLLSVTNNKWPKGVGGFVEIPFLLSRKY → GVSHGVSFP

Show »
Length:392
Mass (Da):42,488
Checksum:iA52197139D38C30B
GO
Isoform 6 (identifier: Q6HA09-6) [UniParc]FASTAAdd to basket
Also known as: V3

The sequence of this isoform differs from the canonical sequence as follows:
     1-21: Missing.
     72-105: Missing.

Show »
Length:380
Mass (Da):41,388
Checksum:iB5C5B37A8C5DD84E
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti45E → G in CAD61264 (PubMed:15087446).Curated1
Sequence conflicti115L → P in CAD61264 (PubMed:15087446).Curated1
Sequence conflicti283R → Q in CAD61264 (PubMed:15087446).Curated1
Sequence conflicti300S → R in CAD61264 (PubMed:15087446).Curated1
Sequence conflicti309R → H in CAD61264 (PubMed:15087446).Curated1
Sequence conflicti368D → A in CAD61264 (PubMed:15087446).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0518321 – 21Missing in isoform 2, isoform 5 and isoform 6. 2 PublicationsAdd BLAST21
Alternative sequenceiVSP_04399772 – 105Missing in isoform 4 and isoform 6. 1 PublicationAdd BLAST34
Alternative sequenceiVSP_04399882 – 113SPFRL…SRKYD → GVSHGVSFPN in isoform 3. 1 PublicationAdd BLAST32
Alternative sequenceiVSP_04399982 – 112SPFRL…LSRKY → GVSHGVSFP in isoform 5. 1 PublicationAdd BLAST31

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ537599 mRNA. Translation: CAD61264.2.
FJ187790 mRNA. Translation: ACN71160.1.
FJ187791 mRNA. Translation: ACN71161.1.
FJ187792 mRNA. Translation: ACN71162.1.
FJ187793 mRNA. Translation: ACN71163.1.
FJ187794 mRNA. Translation: ACN71164.1.
FJ187795 mRNA. Translation: ACN71165.1.
AK033037 mRNA. Translation: BAC28134.1.
AL731836, AL845368 Genomic DNA. Translation: CAM13879.1.
AL731836, AL845368 Genomic DNA. Translation: CAM13880.1.
AL845368, AL731836 Genomic DNA. Translation: CAM17447.1.
AL845368, AL731836 Genomic DNA. Translation: CAM17448.1.
BC064729 mRNA. Translation: AAH64729.2.
CCDSiCCDS16700.1. [Q6HA09-2]
CCDS71138.1. [Q6HA09-1]
RefSeqiNP_001277932.1. NM_001291003.1. [Q6HA09-1]
NP_766127.1. NM_172539.3. [Q6HA09-2]
UniGeneiMm.31313.
Mm.58214.

Genome annotation databases

EnsembliENSMUST00000059839; ENSMUSP00000054456; ENSMUSG00000050468. [Q6HA09-2]
ENSMUST00000089673; ENSMUSP00000087102; ENSMUSG00000050468. [Q6HA09-1]
ENSMUST00000179618; ENSMUSP00000135987; ENSMUSG00000050468. [Q6HA09-2]
GeneIDi215095.
KEGGimmu:215095.
UCSCiuc008mfg.2. mouse. [Q6HA09-1]
uc029uen.2. mouse. [Q6HA09-3]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Web resourcesi

Protein Spotlight

Life's boundaries - Issue 141 of September 2012

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ537599 mRNA. Translation: CAD61264.2.
FJ187790 mRNA. Translation: ACN71160.1.
FJ187791 mRNA. Translation: ACN71161.1.
FJ187792 mRNA. Translation: ACN71162.1.
FJ187793 mRNA. Translation: ACN71163.1.
FJ187794 mRNA. Translation: ACN71164.1.
FJ187795 mRNA. Translation: ACN71165.1.
AK033037 mRNA. Translation: BAC28134.1.
AL731836, AL845368 Genomic DNA. Translation: CAM13879.1.
AL731836, AL845368 Genomic DNA. Translation: CAM13880.1.
AL845368, AL731836 Genomic DNA. Translation: CAM17447.1.
AL845368, AL731836 Genomic DNA. Translation: CAM17448.1.
BC064729 mRNA. Translation: AAH64729.2.
CCDSiCCDS16700.1. [Q6HA09-2]
CCDS71138.1. [Q6HA09-1]
RefSeqiNP_001277932.1. NM_001291003.1. [Q6HA09-1]
NP_766127.1. NM_172539.3. [Q6HA09-2]
UniGeneiMm.31313.
Mm.58214.

3D structure databases

ProteinModelPortaliQ6HA09.
SMRiQ6HA09.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000054456.

Protein family/group databases

MEROPSiM12.245.

PTM databases

iPTMnetiQ6HA09.
PhosphoSitePlusiQ6HA09.

Proteomic databases

PaxDbiQ6HA09.
PRIDEiQ6HA09.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000059839; ENSMUSP00000054456; ENSMUSG00000050468. [Q6HA09-2]
ENSMUST00000089673; ENSMUSP00000087102; ENSMUSG00000050468. [Q6HA09-1]
ENSMUST00000179618; ENSMUSP00000135987; ENSMUSG00000050468. [Q6HA09-2]
GeneIDi215095.
KEGGimmu:215095.
UCSCiuc008mfg.2. mouse. [Q6HA09-1]
uc029uen.2. mouse. [Q6HA09-3]

Organism-specific databases

CTDi431705.
MGIiMGI:3046414. Astl.

Phylogenomic databases

eggNOGiKOG3714. Eukaryota.
ENOG410ZPX7. LUCA.
GeneTreeiENSGT00760000119227.
HOGENOMiHOG000231483.
HOVERGENiHBG080299.
InParanoidiQ6HA09.
KOiK08778.
OMAiISIIPMY.
OrthoDBiEOG091G009U.
PhylomeDBiQ6HA09.
TreeFamiTF315280.

Miscellaneous databases

PROiQ6HA09.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000050468.
CleanExiMM_ASTL.
ExpressionAtlasiQ6HA09. baseline and differential.
GenevisibleiQ6HA09. MM.

Family and domain databases

Gene3Di3.40.390.10. 1 hit.
InterProiIPR024079. MetalloPept_cat_dom.
IPR001506. Peptidase_M12A.
IPR006026. Peptidase_Metallo.
[Graphical view]
PfamiPF01400. Astacin. 1 hit.
[Graphical view]
PRINTSiPR00480. ASTACIN.
SMARTiSM00235. ZnMc. 1 hit.
[Graphical view]
PROSITEiPS00142. ZINC_PROTEASE. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiASTL_MOUSE
AccessioniPrimary (citable) accession number: Q6HA09
Secondary accession number(s): A2AHU0
, A2AHU1, G7Z016, G7Z017, G7Z018, G7Z019, Q8BMA1
Entry historyi
Integrated into UniProtKB/Swiss-Prot: September 27, 2005
Last sequence update: September 27, 2005
Last modified: November 2, 2016
This is version 103 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. Peptidase families
    Classification of peptidase families and list of entries
  3. Protein Spotlight
    Protein Spotlight articles and cited UniProtKB/Swiss-Prot entries
  4. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.