Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q6HA09

- ASTL_MOUSE

UniProt

Q6HA09 - ASTL_MOUSE

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Astacin-like metalloendopeptidase

Gene

Astl

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Oocyte-specific oolemmal receptor involved in sperm and egg adhesion and fertilization. Plays a role in the polyspermy inhibition. Probably acts as a protease for the post-fertilization cleavage of ZP2. Cleaves the sperm-binding ZP2 at the surface of the zona pellucida after fertilization and cortical granule exocytosis, rendering the zona pellucida unable to support further sperm binding.2 Publications

Enzyme regulationi

Inhibited by wide spectrum metalloproteinase inhibitor batimastat (BB-94). Also inhibited by EDTA (By similarity).By similarity

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Metal bindingi182 – 1821Zinc; catalyticPROSITE-ProRule annotation
Active sitei183 – 1831By similarityPROSITE-ProRule annotation
Metal bindingi186 – 1861Zinc; catalyticPROSITE-ProRule annotation
Metal bindingi192 – 1921Zinc; catalyticPROSITE-ProRule annotation

GO - Molecular functioni

  1. aspartic-type peptidase activity Source: UniProtKB
  2. glutamic-type peptidase activity Source: UniProtKB
  3. metalloendopeptidase activity Source: UniProtKB
  4. peptidase activity Source: UniProtKB
  5. zinc ion binding Source: InterPro

GO - Biological processi

  1. cell adhesion Source: UniProtKB
  2. fertilization Source: UniProtKB
  3. negative regulation of binding of sperm to zona pellucida Source: UniProtKB
  4. positive regulation of protein processing Source: UniProtKB
  5. prevention of polyspermy Source: UniProtKB
Complete GO annotation...

Keywords - Molecular functioni

Hydrolase, Metalloprotease, Protease

Keywords - Biological processi

Fertilization

Keywords - Ligandi

Metal-binding, Zinc

Protein family/group databases

MEROPSiM12.245.

Names & Taxonomyi

Protein namesi
Recommended name:
Astacin-like metalloendopeptidase (EC:3.4.-.-)
Alternative name(s):
Oocyte astacin
Ovastacin
Sperm acrosomal SLLP1-binding protein
Gene namesi
Name:AstlImported
Synonyms:Sas1b
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589: Chromosome 2

Organism-specific databases

MGIiMGI:3046414. Astl.

Subcellular locationi

Cytoplasm. Cell membrane. Cytoplasmic granule. Cytoplasmic vesiclesecretory vesicle
Note: Secretory granules. Localizes to the peripheral cortical granules of ovulated eggs. Probably exocytosed from cortical granules during post-fertilization. Detected throughout the ooplasm of germinal vesicle stage oocytes in early bilaminar secondary follicles at postnatal (PN) day 3. Detected in the microvillar domain of the oolemma in arrested ovulated secondary oocytes and in the first polar body prior to fertilization. Upon fertilization, detected in the perivitelline space (PVS) and occasionally on the oolemma in 2-cell through morulae stages. Colocalizes with SPACA3 at the microvillar domain of the oolemma and in the perivitelline space (PVS).

GO - Cellular componenti

  1. cortical granule Source: UniProtKB
  2. cytoplasm Source: UniProtKB
  3. plasma membrane Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Cytoplasm, Cytoplasmic vesicle, Membrane

Pathology & Biotechi

Disruption phenotypei

Absence of cortical granules exocytosis during post-fertilization. Multiple capacitated sperm binding to eggs and two-cell embryos are not prevented. Post-fertilization cleavage of ZP2 does not occur.2 Publications

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 2323Sequence AnalysisAdd
BLAST
Chaini24 – 435412Astacin-like metalloendopeptidaseSequence AnalysisPRO_0000041965Add
BLAST

Keywords - PTMi

Zymogen

Proteomic databases

PRIDEiQ6HA09.

PTM databases

PhosphoSiteiQ6HA09.

Expressioni

Tissue specificityi

Ovary-specific. Expressed in secondary, antral and Graafian follicle oocytes. Expressed in the egg cells. Not detected in two-cell embryos. Not detected in naked oocytes, oocytes in primordial or unilaminar primary follicles, or in any other ovarian cells at pre-pubertal, pubertal or adult stages (at protein level). Ovary-specific.2 Publications

Developmental stagei

Expressed in embryonic stem cells. Highly expressed in unfertilized oocytes. Upon fertilization, expression drops to undetectable levels, although at 1.5 dpc a significant amount of ovastacin RNA could still be detected. Not detected from 1.5 dpc to implantation of the embryo.2 Publications

Inductioni

Up-regulated by superovulation.1 Publication

Gene expression databases

BgeeiQ6HA09.
CleanExiMM_ASTL.
GenevestigatoriQ6HA09.

Interactioni

Subunit structurei

Interacts (via N-terminal domain) with SPACA3; the interaction occurs during fertilization.1 Publication

Structurei

3D structure databases

ProteinModelPortaliQ6HA09.
SMRiQ6HA09. Positions 40-322.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the peptidase M12A family.Sequence Analysis

Keywords - Domaini

Signal

Phylogenomic databases

eggNOGiNOG330389.
GeneTreeiENSGT00760000119227.
HOGENOMiHOG000231483.
HOVERGENiHBG080299.
InParanoidiQ6HA09.
KOiK08778.
OMAiRWNLSAS.
OrthoDBiEOG73V6MT.
PhylomeDBiQ6HA09.
TreeFamiTF315280.

Family and domain databases

Gene3Di3.40.390.10. 1 hit.
InterProiIPR024079. MetalloPept_cat_dom.
IPR001506. Peptidase_M12A.
IPR006026. Peptidase_Metallo.
[Graphical view]
PfamiPF01400. Astacin. 1 hit.
[Graphical view]
PRINTSiPR00480. ASTACIN.
SMARTiSM00235. ZnMc. 1 hit.
[Graphical view]
PROSITEiPS00142. ZINC_PROTEASE. 1 hit.
[Graphical view]

Sequences (6)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 6 isoformsi produced by alternative splicing. Align

Isoform 11 Publication (identifier: Q6HA09-1) [UniParc]FASTAAdd to Basket

Also known as: V1

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGIMGSLWPW ILTMLSLLGL SMGAPSASRC SGVCSTSVPE GFTPEGSPVF
60 70 80 90 100
QDKDIPAINQ GLISEETPES SFLVEGDIIR PSPFRLLSVT NNKWPKGVGG
110 120 130 140 150
FVEIPFLLSR KYDELSRRVI MDAFAEFERF TCIRFVAYHG QRDFVSILPM
160 170 180 190 200
AGCFSGVGRS GGMQVVSLAP TCLRKGRGIV LHELMHVLGF WHEHSRADRD
210 220 230 240 250
RYIQVNWNEI LPGFEINFIK SRSTNMLVPY DYSSVMHYGR FAFSWRGQPT
260 270 280 290 300
IIPLWTSSVH IGQRWNLSTS DITRVCRLYN CSRSVPDSHG RGFEAQSDGS
310 320 330 340 350
SLTPASISRL QRLLEALSEE SGSSAPSGSR TGGQSIAGLG NSQQGWEHPP
360 370 380 390 400
QSTFSVGALA RPPQMLADAS KSGPGAGADS LSLEQFQLAQ APTVPLALFP
410 420 430
EARDKPAPIQ DAFERLAPLP GGCAPGSHIR EVPRD
Length:435
Mass (Da):47,455
Last modified:September 27, 2005 - v3
Checksum:i8530CC0E5B3B1350
GO
Isoform 2Curated (identifier: Q6HA09-2) [UniParc]FASTAAdd to Basket

Also known as: V2

The sequence of this isoform differs from the canonical sequence as follows:
     1-21: Missing.

Note: No experimental confirmation available.Curated

Show »
Length:414
Mass (Da):45,153
Checksum:i2B8809620D02A446
GO
Isoform 3 (identifier: Q6HA09-3) [UniParc]FASTAAdd to Basket

Also known as: V6

The sequence of this isoform differs from the canonical sequence as follows:
     82-113: SPFRLLSVTNNKWPKGVGGFVEIPFLLSRKYD → GVSHGVSFPN

Show »
Length:413
Mass (Da):44,789
Checksum:iC1C54E7EF96B07D0
GO
Isoform 4 (identifier: Q6HA09-4) [UniParc]FASTAAdd to Basket

Also known as: V4

The sequence of this isoform differs from the canonical sequence as follows:
     72-105: Missing.

Show »
Length:401
Mass (Da):43,690
Checksum:iC7A87D14F4431CF9
GO
Isoform 5 (identifier: Q6HA09-5) [UniParc]FASTAAdd to Basket

Also known as: V5

The sequence of this isoform differs from the canonical sequence as follows:
     1-21: Missing.
     82-112: SPFRLLSVTNNKWPKGVGGFVEIPFLLSRKY → GVSHGVSFP

Show »
Length:392
Mass (Da):42,488
Checksum:iA52197139D38C30B
GO
Isoform 6 (identifier: Q6HA09-6) [UniParc]FASTAAdd to Basket

Also known as: V3

The sequence of this isoform differs from the canonical sequence as follows:
     1-21: Missing.
     72-105: Missing.

Show »
Length:380
Mass (Da):41,388
Checksum:iB5C5B37A8C5DD84E
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti45 – 451E → G in CAD61264. (PubMed:15087446)Curated
Sequence conflicti115 – 1151L → P in CAD61264. (PubMed:15087446)Curated
Sequence conflicti283 – 2831R → Q in CAD61264. (PubMed:15087446)Curated
Sequence conflicti300 – 3001S → R in CAD61264. (PubMed:15087446)Curated
Sequence conflicti309 – 3091R → H in CAD61264. (PubMed:15087446)Curated
Sequence conflicti368 – 3681D → A in CAD61264. (PubMed:15087446)Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 2121Missing in isoform 2, isoform 5 and isoform 6. 2 PublicationsVSP_051832Add
BLAST
Alternative sequencei72 – 10534Missing in isoform 4 and isoform 6. 1 PublicationVSP_043997Add
BLAST
Alternative sequencei82 – 11332SPFRL…SRKYD → GVSHGVSFPN in isoform 3. 1 PublicationVSP_043998Add
BLAST
Alternative sequencei82 – 11231SPFRL…LSRKY → GVSHGVSFP in isoform 5. 1 PublicationVSP_043999Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ537599 mRNA. Translation: CAD61264.2.
FJ187790 mRNA. Translation: ACN71160.1.
FJ187791 mRNA. Translation: ACN71161.1.
FJ187792 mRNA. Translation: ACN71162.1.
FJ187793 mRNA. Translation: ACN71163.1.
FJ187794 mRNA. Translation: ACN71164.1.
FJ187795 mRNA. Translation: ACN71165.1.
AK033037 mRNA. Translation: BAC28134.1.
AL731836, AL845368 Genomic DNA. Translation: CAM13879.1.
AL731836, AL845368 Genomic DNA. Translation: CAM13880.1.
AL845368, AL731836 Genomic DNA. Translation: CAM17447.1.
AL845368, AL731836 Genomic DNA. Translation: CAM17448.1.
BC064729 mRNA. Translation: AAH64729.2.
CCDSiCCDS16700.1. [Q6HA09-2]
CCDS71138.1. [Q6HA09-1]
RefSeqiNP_001277932.1. NM_001291003.1. [Q6HA09-1]
NP_766127.1. NM_172539.3. [Q6HA09-2]
UniGeneiMm.31313.
Mm.58214.

Genome annotation databases

EnsembliENSMUST00000059839; ENSMUSP00000054456; ENSMUSG00000050468. [Q6HA09-2]
ENSMUST00000089673; ENSMUSP00000087102; ENSMUSG00000050468. [Q6HA09-1]
ENSMUST00000179618; ENSMUSP00000135987; ENSMUSG00000050468. [Q6HA09-2]
GeneIDi215095.
KEGGimmu:215095.
UCSCiuc008mfg.1. mouse. [Q6HA09-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Web resourcesi

Protein Spotlight

Life's boundaries - Issue 141 of September 2012

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ537599 mRNA. Translation: CAD61264.2 .
FJ187790 mRNA. Translation: ACN71160.1 .
FJ187791 mRNA. Translation: ACN71161.1 .
FJ187792 mRNA. Translation: ACN71162.1 .
FJ187793 mRNA. Translation: ACN71163.1 .
FJ187794 mRNA. Translation: ACN71164.1 .
FJ187795 mRNA. Translation: ACN71165.1 .
AK033037 mRNA. Translation: BAC28134.1 .
AL731836 , AL845368 Genomic DNA. Translation: CAM13879.1 .
AL731836 , AL845368 Genomic DNA. Translation: CAM13880.1 .
AL845368 , AL731836 Genomic DNA. Translation: CAM17447.1 .
AL845368 , AL731836 Genomic DNA. Translation: CAM17448.1 .
BC064729 mRNA. Translation: AAH64729.2 .
CCDSi CCDS16700.1. [Q6HA09-2 ]
CCDS71138.1. [Q6HA09-1 ]
RefSeqi NP_001277932.1. NM_001291003.1. [Q6HA09-1 ]
NP_766127.1. NM_172539.3. [Q6HA09-2 ]
UniGenei Mm.31313.
Mm.58214.

3D structure databases

ProteinModelPortali Q6HA09.
SMRi Q6HA09. Positions 40-322.
ModBasei Search...
MobiDBi Search...

Protein family/group databases

MEROPSi M12.245.

PTM databases

PhosphoSitei Q6HA09.

Proteomic databases

PRIDEi Q6HA09.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENSMUST00000059839 ; ENSMUSP00000054456 ; ENSMUSG00000050468 . [Q6HA09-2 ]
ENSMUST00000089673 ; ENSMUSP00000087102 ; ENSMUSG00000050468 . [Q6HA09-1 ]
ENSMUST00000179618 ; ENSMUSP00000135987 ; ENSMUSG00000050468 . [Q6HA09-2 ]
GeneIDi 215095.
KEGGi mmu:215095.
UCSCi uc008mfg.1. mouse. [Q6HA09-1 ]

Organism-specific databases

CTDi 431705.
MGIi MGI:3046414. Astl.

Phylogenomic databases

eggNOGi NOG330389.
GeneTreei ENSGT00760000119227.
HOGENOMi HOG000231483.
HOVERGENi HBG080299.
InParanoidi Q6HA09.
KOi K08778.
OMAi RWNLSAS.
OrthoDBi EOG73V6MT.
PhylomeDBi Q6HA09.
TreeFami TF315280.

Miscellaneous databases

NextBioi 374608.
PROi Q6HA09.
SOURCEi Search...

Gene expression databases

Bgeei Q6HA09.
CleanExi MM_ASTL.
Genevestigatori Q6HA09.

Family and domain databases

Gene3Di 3.40.390.10. 1 hit.
InterProi IPR024079. MetalloPept_cat_dom.
IPR001506. Peptidase_M12A.
IPR006026. Peptidase_Metallo.
[Graphical view ]
Pfami PF01400. Astacin. 1 hit.
[Graphical view ]
PRINTSi PR00480. ASTACIN.
SMARTi SM00235. ZnMc. 1 hit.
[Graphical view ]
PROSITEi PS00142. ZINC_PROTEASE. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Identification and characterization of human and mouse ovastacin, a novel metalloproteinase similar to hatching enzymes from arthropods, birds, amphibians, and fish."
    Quesada V., Sanchez J., Alvarez J., Lopez-Otin C.
    J. Biol. Chem. 279:26627-26634(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), INDUCTION, DEVELOPMENTAL STAGE.
    Strain: C57BL/6JImported.
    Tissue: Ovary1 Publication.
  2. "Oocyte specific oolemmal SAS1B involved in sperm binding through intra-acrosomal SLLP1 during fertilization."
    Sachdev M., Mandal A., Mulders S., Digilio L.C., Panneerdoss S., Suryavathi V., Pires E., Klotz K.L., Hermens L., Herrero M.B., Flickinger C.J., van Duin M., Herr J.C.
    Dev. Biol. 363:40-51(2012) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3; 4; 5 AND 6), FUNCTION IN FERTILIZATION, TOPOLOGY, ENZYME ACTIVITY, INTERACTION WITH SPACA3, SUBCELLULAR LOCATION, TISSUE SPECIFICITY, DISRUPTION PHENOTYPE, IDENTIFICATION BY MASS SPECTROMETRY.
    Strain: Swiss Webster.
    Tissue: Ovary.
  3. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Strain: C57BL/6J.
    Tissue: Egg.
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    Strain: C57BL/6J.
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Strain: C57BL/6J.
    Tissue: Egg.
  6. "Astacin-like metallo-endopeptidase is dynamically expressed in embryonic stem cells and embryonic epithelium during morphogenesis."
    Acloque H., Lavial F., Pain B.
    Dev. Dyn. 241:574-582(2012) [PubMed] [Europe PMC] [Abstract]
    Cited for: DEVELOPMENTAL STAGE.
  7. "Ovastacin, a cortical granule protease, cleaves ZP2 in the zona pellucida to prevent polyspermy."
    Burkart A.D., Xiong B., Baibakov B., Jimenez-Movilla M., Dean J.
    J. Cell Biol. 197:37-44(2012) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION IN POLYSPERMY INHIBITION, CLEAVAGE OF ZP2, SUBCELLULAR LOCATION, DISRUPTION PHENOTYPE, TISSUE SPECIFICITY.

Entry informationi

Entry nameiASTL_MOUSE
AccessioniPrimary (citable) accession number: Q6HA09
Secondary accession number(s): A2AHU0
, A2AHU1, G7Z016, G7Z017, G7Z018, G7Z019, Q8BMA1
Entry historyi
Integrated into UniProtKB/Swiss-Prot: September 27, 2005
Last sequence update: September 27, 2005
Last modified: October 29, 2014
This is version 92 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. Peptidase families
    Classification of peptidase families and list of entries
  3. Protein Spotlight
    Protein Spotlight articles and cited UniProtKB/Swiss-Prot entries
  4. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3