Q6HA09 (ASTL_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 29, 2013.
Version 79.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Astacin-like metalloendopeptidase EC=3.4.-.- Alternative name(s): Oocyte astacin Ovastacin Sperm acrosomal SLLP1-binding protein | ||||
| Gene names |
| ||||
| Organism | Mus musculus (Mouse) [Reference proteome] | ||||
| Taxonomic identifier | 10090 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus![]() |
Protein attributes
| Sequence length | 435 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Oocyte-specific oolemmal receptor involved in sperm and egg adhesion and fertilization. Plays a role in the polyspermy inhibition. Probably acts as a protease for the post-fertilization cleavage of ZP2. Cleaves the sperm-binding ZP2 at the surface of the zona pellucida after fertilization and cortical granule exocytosis, rendering the zona pellucida unable to support further sperm binding. Ref.2 Ref.7 |
| Enzyme regulation | Inhibited by wide spectrum metalloproteinase inhibitor batimastat (BB-94). Also inhibited by EDTA By similarity. UniProtKB Q6HA08 |
| Subunit structure | Interacts (via N-terminus domain) with SPACA3; the interaction occurs during fertilization. Ref.2 |
| Subcellular location | Cytoplasm. Cell membrane. Cytoplasmic granule. Cytoplasmic vesicle › secretory vesicle. Note: Secretory granules. Localizes to the peripheral cortical granules of ovulated eggs. Probably exocytosed from cortical granules during post-fertilization. Detected throughout the ooplasm of germinal vesicle stage oocytes in early bilaminar secondary follicles at postnatal (PN) day 3. Detected in the microvillar domain of the oolemma in arrested ovulated secondary oocytes and in the first polar body prior to fertilization. Upon fertilization, detected in the perivitelline space (PVS) and occasionally on the oolemma in 2-cell through morulae stages. Colocalizes with SPACA3 at the microvillar domain of the oolemma and in the perivitelline space (PVS). Ref.2 Ref.7 |
| Tissue specificity | Ovary-specific. Expressed in secondary, antral and Graafian follicle oocytes. Expressed in the egg cells. Not detected in two-cell embryos. Not detected in naked oocytes, oocytes in primordial or unilaminar primary follicles, or in any other ovarian cells at pre-pubertal, pubertal or adult stages (at protein level). Ovary-specific. Ref.2 Ref.7 |
| Developmental stage | Expressed in embryonic stem cells. Highly expressed in unfertilized oocytes. Upon fertilization, expression drops to undetectable levels, although at 1.5 dpc a significant amount of ovastacin RNA could still be detected. Not detected from 1.5 dpc to implantation of the embryo. Ref.1 Ref.6 |
| Induction | Up-regulated by superovulation. Ref.1 |
| Disruption phenotype | Absence of cortical granules exocytosis during post-fertilization. Multiple capacitated sperm binding to eggs and two-cell embryos are not prevented. Post-fertilization cleavage of ZP2 does not occur. Ref.2 Ref.7 |
| Sequence similarities | Belongs to the peptidase M12A family. |
Ontologies
Alternative products
| This entry describes 6 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 Ref.1 (identifier: Q6HA09-1) Also known as: V1; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q6HA09-2) Also known as: V2; The sequence of this isoform differs from the canonical sequence as follows: 1-21: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: Q6HA09-3) Also known as: V6; The sequence of this isoform differs from the canonical sequence as follows: 82-113: SPFRLLSVTNNKWPKGVGGFVEIPFLLSRKYD → GVSHGVSFPN | ||||||
| Isoform 4 (identifier: Q6HA09-4) Also known as: V4; The sequence of this isoform differs from the canonical sequence as follows: 72-105: Missing. | ||||||
| Isoform 5 (identifier: Q6HA09-5) Also known as: V5; The sequence of this isoform differs from the canonical sequence as follows: 1-21: Missing. 82-112: SPFRLLSVTNNKWPKGVGGFVEIPFLLSRKY → GVSHGVSFP | ||||||
| Isoform 6 (identifier: Q6HA09-6) Also known as: V3; The sequence of this isoform differs from the canonical sequence as follows: 1-21: Missing. 72-105: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 23 | 23 | Potential | ||||||
| Chain | 24 – 435 | 412 | Astacin-like metalloendopeptidase | PRO_0000041965 | |||||
Sites | |||||||||
| Active site | 183 | 1 | By similarity UniProtKB P07584 | ||||||
| Metal binding | 182 | 1 | Zinc; catalytic By similarity UniProtKB P07584 | ||||||
| Metal binding | 186 | 1 | Zinc; catalytic By similarity UniProtKB P07584 | ||||||
| Metal binding | 192 | 1 | Zinc; catalytic By similarity UniProtKB P07584 | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 21 | 21 | Missing in isoform 2, isoform 5 and isoform 6. | VSP_051832 | |||||
| Alternative sequence | 72 – 105 | 34 | Missing in isoform 4 and isoform 6. | VSP_043997 | |||||
| Alternative sequence | 82 – 113 | 32 | SPFRL…SRKYD → GVSHGVSFPN in isoform 3. | VSP_043998 | |||||
| Alternative sequence | 82 – 112 | 31 | SPFRL…LSRKY → GVSHGVSFP in isoform 5. | VSP_043999 | |||||
Experimental info | |||||||||
| Sequence conflict | 45 | 1 | E → G in CAD61264. Ref.1 | ||||||
| Sequence conflict | 115 | 1 | L → P in CAD61264. Ref.1 | ||||||
| Sequence conflict | 283 | 1 | R → Q in CAD61264. Ref.1 | ||||||
| Sequence conflict | 300 | 1 | S → R in CAD61264. Ref.1 | ||||||
| Sequence conflict | 309 | 1 | R → H in CAD61264. Ref.1 | ||||||
| Sequence conflict | 368 | 1 | D → A in CAD61264. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Identification and characterization of human and mouse ovastacin, a novel metalloproteinase similar to hatching enzymes from arthropods, birds, amphibians, and fish." Quesada V., Sanchez J., Alvarez J., Lopez-Otin C. J. Biol. Chem. 279:26627-26634(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), INDUCTION, DEVELOPMENTAL STAGE. Strain: C57BL/6J. Tissue: Ovary. |
| [2] | "Oocyte specific oolemmal SAS1B involved in sperm binding through intra-acrosomal SLLP1 during fertilization." Sachdev M., Mandal A., Mulders S., Digilio L.C., Panneerdoss S., Suryavathi V., Pires E., Klotz K.L., Hermens L., Herrero M.B., Flickinger C.J., van Duin M., Herr J.C. Dev. Biol. 363:40-51(2012) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3; 4; 5 AND 6), FUNCTION IN FERTILIZATION, TOPOLOGY, ENZYME ACTIVITY, INTERACTION WITH SPACA3, SUBCELLULAR LOCATION, TISSUE SPECIFICITY, DISRUPTION PHENOTYPE, MASS SPECTROMETRY. Strain: Swiss Webster. Tissue: Ovary. |
| [3] | "The transcriptional landscape of the mammalian genome." Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. Hayashizaki Y.Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Strain: C57BL/6J. Tissue: Egg. |
| [4] | "Lineage-specific biology revealed by a finished genome assembly of the mouse." Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S., She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W., Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T., Zhou S. Ponting C.P.PLoS Biol. 7:E1000112-E1000112(2009) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. Strain: C57BL/6J. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Strain: C57BL/6J. Tissue: Egg. |
| [6] | "Astacin-like metallo-endopeptidase is dynamically expressed in embryonic stem cells and embryonic epithelium during morphogenesis." Acloque H., Lavial F., Pain B. Dev. Dyn. 241:574-582(2012) [PubMed] [Europe PMC] [Abstract] Cited for: DEVELOPMENTAL STAGE. |
| [7] | "Ovastacin, a cortical granule protease, cleaves ZP2 in the zona pellucida to prevent polyspermy." Burkart A.D., Xiong B., Baibakov B., Jimenez-Movilla M., Dean J. J. Cell Biol. 197:37-44(2012) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION IN POLYSPERMY INHIBITION, CLEAVAGE OF ZP2, SUBCELLULAR LOCATION, DISRUPTION PHENOTYPE, TISSUE SPECIFICITY. |
Web resources
| Protein Spotlight Life's boundaries - Issue 141 of September2012 |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AJ537599 mRNA. Translation: CAD61264.2. FJ187790 mRNA. Translation: ACN71160.1. FJ187791 mRNA. Translation: ACN71161.1. FJ187792 mRNA. Translation: ACN71162.1. FJ187793 mRNA. Translation: ACN71163.1. FJ187794 mRNA. Translation: ACN71164.1. FJ187795 mRNA. Translation: ACN71165.1. AK033037 mRNA. Translation: BAC28134.1. AL731836, AL845368 Genomic DNA. Translation: CAM13879.1. AL731836, AL845368 Genomic DNA. Translation: CAM13880.1. AL845368, AL731836 Genomic DNA. Translation: CAM17447.1. AL845368, AL731836 Genomic DNA. Translation: CAM17448.1. BC064729 mRNA. Translation: AAH64729.2. |
| IPI | IPI00283246. IPI00621570. |
| RefSeq | NP_766127.1. NM_172539.2. |
| UniGene | Mm.31313. Mm.58214. |
3D structure databases | |
| ProteinModelPortal | Q6HA09. |
| SMR | Q6HA09. Positions 40-322. |
| ModBase | Search... |
Protein family/group databases | |
| MEROPS | M12.245. |
PTM databases | |
| PhosphoSite | Q6HA09. |
Proteomic databases | |
| PRIDE | Q6HA09. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENSMUST00000059839; ENSMUSP00000054456; ENSMUSG00000050468. ENSMUST00000089673; ENSMUSP00000087102; ENSMUSG00000050468. ENSMUST00000179618; ENSMUSP00000135987; ENSMUSG00000050468. |
| GeneID | 215095. |
| KEGG | mmu:215095. |
| UCSC | uc008mfg.1. mouse. uc029uen.1. mouse. |
Organism-specific databases | |
| CTD | 431705. |
| MGI | MGI:3046414. Astl. |
Phylogenomic databases | |
| eggNOG | NOG330389. |
| GeneTree | ENSGT00550000074269. |
| HOGENOM | HOG000231483. |
| HOVERGEN | HBG080299. |
| InParanoid | Q6HA09. |
| KO | K08778. |
| OMA | IRFVAYQ. |
| OrthoDB | EOG4QZ7MW. |
Gene expression databases | |
| ArrayExpress | Q6HA09. |
| Bgee | Q6HA09. |
| CleanEx | MM_ASTL. |
| Genevestigator | Q6HA09. |
| GermOnline | ENSMUSG00000050468. Mus musculus. |
Family and domain databases | |
| Gene3D | 3.40.390.10. 1 hit. |
| InterPro | IPR024079. MetalloPept_cat_dom. IPR001506. Peptidase_M12A. IPR006026. Peptidase_Metallo. [Graphical view] |
| Pfam | PF01400. Astacin. 1 hit. [Graphical view] |
| PRINTS | PR00480. ASTACIN. |
| SMART | SM00235. ZnMc. 1 hit. [Graphical view] |
| PROSITE | PS00142. ZINC_PROTEASE. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 374608. |
| SOURCE | Search... |
Entry information
| Entry name | ASTL_MOUSE | ||||||||
| Accession | Primary (citable) accession number: Q6HA09 Secondary accession number(s): A2AHU0 Q8BMA1 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| Peptidase families Classification of peptidase families and list of entries |
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
