Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q6H8Q1

- ABLM2_HUMAN

UniProt

Q6H8Q1 - ABLM2_HUMAN

Protein

Actin-binding LIM protein 2

Gene

ABLIM2

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 114 (01 Oct 2014)
      Sequence version 2 (07 Dec 2004)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    May act as scaffold protein. May stimulate ABRA activity and ABRA-dependent SRF transcriptional activity.1 Publication

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Metal bindingi83 – 831Zinc 1
    Metal bindingi86 – 861Zinc 1
    Metal bindingi103 – 1031Zinc 1
    Metal bindingi106 – 1061Zinc 1
    Metal bindingi109 – 1091Zinc 2
    Metal bindingi112 – 1121Zinc 2
    Metal bindingi131 – 1311Zinc 2
    Metal bindingi134 – 1341Zinc 2
    Metal bindingi212 – 2121Zinc 3
    Metal bindingi215 – 2151Zinc 3
    Metal bindingi232 – 2321Zinc 3
    Metal bindingi235 – 2351Zinc 3
    Metal bindingi238 – 2381Zinc 4
    Metal bindingi241 – 2411Zinc 4
    Metal bindingi260 – 2601Zinc 4
    Metal bindingi263 – 2631Zinc 4

    GO - Molecular functioni

    1. zinc ion binding Source: InterPro

    GO - Biological processi

    1. actin cytoskeleton organization Source: InterPro
    2. axon guidance Source: Reactome
    3. positive regulation of transcription from RNA polymerase II promoter Source: Ensembl
    4. transcription, DNA-templated Source: InterPro

    Keywords - Ligandi

    Metal-binding, Zinc

    Enzyme and pathway databases

    ReactomeiREACT_22351. DCC mediated attractive signaling.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Actin-binding LIM protein 2
    Short name:
    abLIM-2
    Alternative name(s):
    Actin-binding LIM protein family member 2
    Gene namesi
    Name:ABLIM2
    Synonyms:KIAA1808
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 4

    Organism-specific databases

    HGNCiHGNC:19195. ABLIM2.

    Subcellular locationi

    Cytoplasm
    Note: In skeletal muscle, sarcomeric or cosarcomeric localization.By similarity

    GO - Cellular componenti

    1. actin cytoskeleton Source: MGI
    2. myofibril Source: Ensembl

    Keywords - Cellular componenti

    Cytoplasm

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA134940437.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 611611Actin-binding LIM protein 2PRO_0000075699Add
    BLAST

    Proteomic databases

    PaxDbiQ6H8Q1.
    PRIDEiQ6H8Q1.

    PTM databases

    PhosphoSiteiQ6H8Q1.

    Expressioni

    Tissue specificityi

    Highly expressed in skeletal muscle.1 Publication

    Gene expression databases

    ArrayExpressiQ6H8Q1.
    BgeeiQ6H8Q1.
    CleanExiHS_ABLIM2.
    GenevestigatoriQ6H8Q1.

    Organism-specific databases

    HPAiHPA035808.

    Interactioni

    Subunit structurei

    Interacts with F-actin and ABRA.1 Publication

    Protein-protein interaction databases

    BioGridi124086. 4 interactions.
    IntActiQ6H8Q1. 3 interactions.
    STRINGi9606.ENSP00000393511.

    Structurei

    Secondary structure

    1
    611
    Legend: HelixTurnBeta strand
    Show more details
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Helixi75 – 773
    Turni84 – 863
    Beta strandi95 – 973
    Beta strandi100 – 1023
    Turni104 – 1063
    Beta strandi110 – 1123
    Beta strandi118 – 1203
    Beta strandi122 – 1254
    Beta strandi128 – 1314
    Helixi132 – 1354
    Beta strandi213 – 2153
    Turni233 – 2353
    Beta strandi239 – 2413
    Beta strandi252 – 2543
    Beta strandi257 – 2593
    Helixi263 – 2664
    Beta strandi268 – 2714
    Helixi551 – 5544
    Helixi556 – 5583
    Turni559 – 5613
    Beta strandi570 – 5723
    Helixi573 – 5764
    Helixi579 – 5868
    Helixi590 – 5956
    Helixi598 – 60710

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    EntryMethodResolution (Å)ChainPositionsPDBsum
    1V6GNMR-A73-140[»]
    1WIGNMR-A212-271[»]
    2L3XNMR-A546-611[»]
    ProteinModelPortaliQ6H8Q1.
    SMRiQ6H8Q1. Positions 23-271, 545-611.
    ModBaseiSearch...
    MobiDBiSearch...

    Miscellaneous databases

    EvolutionaryTraceiQ6H8Q1.

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini22 – 8160LIM zinc-binding 1PROSITE-ProRule annotationAdd
    BLAST
    Domaini81 – 14161LIM zinc-binding 2PROSITE-ProRule annotationAdd
    BLAST
    Domaini151 – 21060LIM zinc-binding 3PROSITE-ProRule annotationAdd
    BLAST
    Domaini210 – 27061LIM zinc-binding 4PROSITE-ProRule annotationAdd
    BLAST
    Domaini543 – 61169HPPROSITE-ProRule annotationAdd
    BLAST

    Sequence similaritiesi

    Contains 1 HP (headpiece) domain.PROSITE-ProRule annotation
    Contains 4 LIM zinc-binding domains.PROSITE-ProRule annotation

    Keywords - Domaini

    LIM domain, Repeat

    Phylogenomic databases

    eggNOGiNOG302299.
    HOGENOMiHOG000285997.
    HOVERGENiHBG031499.
    KOiK07520.
    OMAiFRHHYIP.
    OrthoDBiEOG71CFKF.
    PhylomeDBiQ6H8Q1.
    TreeFamiTF318042.

    Family and domain databases

    Gene3Di1.10.950.10. 1 hit.
    2.10.110.10. 4 hits.
    InterProiIPR028450. ABLIM2.
    IPR003128. Villin_headpiece.
    IPR001781. Znf_LIM.
    [Graphical view]
    PANTHERiPTHR24213:SF6. PTHR24213:SF6. 1 hit.
    PfamiPF00412. LIM. 4 hits.
    PF02209. VHP. 1 hit.
    [Graphical view]
    SMARTiSM00132. LIM. 4 hits.
    SM00153. VHP. 1 hit.
    [Graphical view]
    SUPFAMiSSF47050. SSF47050. 1 hit.
    PROSITEiPS51089. HP. 1 hit.
    PS00478. LIM_DOMAIN_1. 4 hits.
    PS50023. LIM_DOMAIN_2. 4 hits.
    [Graphical view]

    Sequences (9)i

    Sequence statusi: Complete.

    This entry describes 9 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q6H8Q1-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MSAVSQPQAA PSPLEKSPST AILCNTCGNV CKGEVLRVQD KYFHIKCFVC    50
    KACGCDLAEG GFFVRQGEYI CTLDYQRLYG TRCFSCDQFI EGEVVSALGK 100
    TYHPDCFVCA VCRLPFPPGD RVTFNGKECM CQKCSLPVSV GSSAHLSQGL 150
    RSCGGCGTEI KNGQALVALD KHWHLGCFKC KSCGKLLNAE YISKDGLPYC 200
    EADYHAKFGI RCDSCEKYIT GRVLEAGEKH YHPSCALCVR CGQMFAEGEE 250
    MYLQGSSIWH PACRQAARTE DRNKETRTSS ESIISVPASS TSGSPSRVIY 300
    AKLGGEILDY RDLAALPKSK AIYDIDRPDM ISYSPYISHS AGDRQSYGEG 350
    DQDDRSYKQC RTSSPSSTGS VSLGRYTPTS RSPQHYSRPG SESGRSTPSL 400
    SVLSDSKPPP STYQQAPRHF HVPDTGVKDN IYRKPPIYRQ HAARRSDGED 450
    GSLDQDNRKK SSWLMLKGDA DTRTNSPDLD TQSLSHSSGT DRDPLQRMAG 500
    DSFHSRFPYS KSDPLPGHGK NGLDQRNANL APCGADPDAS WGMREYKIYP 550
    YDSLIVTNRI RVKLPKDVDR TRLERHLSPE EFQEVFGMSI EEFDRLALWK 600
    RNDLKKKALL F 611
    Length:611
    Mass (Da):67,812
    Last modified:December 7, 2004 - v2
    Checksum:i225A4E25646B370B
    GO
    Isoform 2 (identifier: Q6H8Q1-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         506-545: RFPYSKSDPLPGHGKNGLDQRNANLAPCGADPDASWGMRE → Q

    Show »
    Length:572
    Mass (Da):63,632
    Checksum:iF2CF3EEE6B1CCADC
    GO
    Isoform 3 (identifier: Q6H8Q1-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         349-349: E → ESPQLLSPTPTE
         390-441: Missing.
         506-545: RFPYSKSDPLPGHGKNGLDQRNANLAPCGADPDASWGMRE → Q

    Show »
    Length:531
    Mass (Da):58,984
    Checksum:i1E6B36B85E5176D8
    GO
    Isoform 4 (identifier: Q6H8Q1-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-243: Missing.
         349-349: E → ESPQLLSPTPTE
         389-422: Missing.
         459-459: K → KQ

    Note: No experimental confirmation available.

    Show »
    Length:346
    Mass (Da):38,966
    Checksum:i00733A9BC0EA7BE5
    GO
    Isoform 5 (identifier: Q6H8Q1-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         459-459: K → KQ
         506-545: RFPYSKSDPLPGHGKNGLDQRNANLAPCGADPDASWGMRE → Q

    Note: No experimental confirmation available.

    Show »
    Length:573
    Mass (Da):63,760
    Checksum:iDFD6CB38CF846982
    GO
    Isoform 6 (identifier: Q6H8Q1-6) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         349-349: E → ESPQLLSPTPTE
         390-441: Missing.
         459-459: K → KQ
         507-510: FPYS → EWFF
         511-611: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:470
    Mass (Da):51,698
    Checksum:iFD93E620E09C0742
    GO
    Isoform 7 (identifier: Q6H8Q1-7) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         390-441: Missing.

    Show »
    Length:559
    Mass (Da):62,013
    Checksum:iA055D0C31DE338FA
    GO
    Isoform 8 (identifier: Q6H8Q1-8) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         390-441: Missing.
         459-459: K → KQ
         506-545: RFPYSKSDPLPGHGKNGLDQRNANLAPCGADPDASWGMRE → Q

    Note: No experimental confirmation available.

    Show »
    Length:521
    Mass (Da):57,960
    Checksum:i1A242FA6173188E3
    GO
    Isoform 9 (identifier: Q6H8Q1-9) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         389-389: P → PAGTVSVGTSSCLSLSQHPSPTSVFRHHYIPYFR
         459-459: K → KQ

    Note: No experimental confirmation available.

    Show »
    Length:645
    Mass (Da):71,542
    Checksum:i50C4FDC1B30AD41E
    GO

    Sequence cautioni

    The sequence AAH67214.1 differs from that shown. Reason: Erroneous initiation.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti240 – 2401R → G in BAC04414. (PubMed:14702039)Curated
    Sequence conflicti312 – 3121D → G in BAC04414. (PubMed:14702039)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti227 – 2271G → R in a pancreatic ductal adenocarcinoma sample; somatic mutation. 1 Publication
    VAR_062665
    Natural varianti274 – 2741K → M in a pancreatic ductal adenocarcinoma sample; somatic mutation. 1 Publication
    VAR_062666

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 243243Missing in isoform 4. 1 PublicationVSP_012112Add
    BLAST
    Alternative sequencei349 – 3491E → ESPQLLSPTPTE in isoform 3, isoform 4 and isoform 6. 2 PublicationsVSP_012113
    Alternative sequencei389 – 42234Missing in isoform 4. 1 PublicationVSP_012114Add
    BLAST
    Alternative sequencei389 – 3891P → PAGTVSVGTSSCLSLSQHPS PTSVFRHHYIPYFR in isoform 9. CuratedVSP_046646
    Alternative sequencei390 – 44152Missing in isoform 3, isoform 6, isoform 7 and isoform 8. 3 PublicationsVSP_012115Add
    BLAST
    Alternative sequencei459 – 4591K → KQ in isoform 4, isoform 5, isoform 6, isoform 8 and isoform 9. 3 PublicationsVSP_012116
    Alternative sequencei506 – 54540RFPYS…WGMRE → Q in isoform 2, isoform 3, isoform 5 and isoform 8. 5 PublicationsVSP_012117Add
    BLAST
    Alternative sequencei507 – 5104FPYS → EWFF in isoform 6. 1 PublicationVSP_012118
    Alternative sequencei511 – 611101Missing in isoform 6. 1 PublicationVSP_012119Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    DQ413177 mRNA. Translation: ABD83330.1.
    AJ748600 mRNA. Translation: CAG38375.1.
    AJ748601 mRNA. Translation: CAG38376.1.
    AK094754 mRNA. Translation: BAC04414.1.
    AK094798 mRNA. Translation: BAC04427.1.
    AC097381 Genomic DNA. No translation available.
    AC104650 Genomic DNA. No translation available.
    AC114807 Genomic DNA. No translation available.
    BC067214 mRNA. Translation: AAH67214.1. Different initiation.
    BC122567 mRNA. Translation: AAI22568.1.
    AB058711 mRNA. Translation: BAB47437.1.
    AL834195 mRNA. Translation: CAD38885.2.
    CCDSiCCDS47011.1. [Q6H8Q1-7]
    CCDS47012.1. [Q6H8Q1-2]
    CCDS47013.1. [Q6H8Q1-1]
    CCDS47014.1. [Q6H8Q1-9]
    CCDS47015.1. [Q6H8Q1-3]
    CCDS47016.1. [Q6H8Q1-6]
    CCDS54719.1. [Q6H8Q1-8]
    CCDS68669.1. [Q6H8Q1-4]
    RefSeqiNP_001123555.1. NM_001130083.1. [Q6H8Q1-9]
    NP_001123556.1. NM_001130084.1. [Q6H8Q1-1]
    NP_001123557.1. NM_001130085.1. [Q6H8Q1-2]
    NP_001123558.1. NM_001130086.1. [Q6H8Q1-7]
    NP_001123559.1. NM_001130087.1. [Q6H8Q1-3]
    NP_001123560.1. NM_001130088.1. [Q6H8Q1-6]
    NP_001273617.1. NM_001286688.1. [Q6H8Q1-4]
    NP_115808.3. NM_032432.4. [Q6H8Q1-8]
    UniGeneiHs.233404.

    Genome annotation databases

    EnsembliENST00000318888; ENSP00000317020; ENSG00000163995. [Q6H8Q1-4]
    ENST00000341937; ENSP00000342813; ENSG00000163995. [Q6H8Q1-1]
    ENST00000361581; ENSP00000355003; ENSG00000163995. [Q6H8Q1-2]
    ENST00000361737; ENSP00000354887; ENSG00000163995. [Q6H8Q1-3]
    ENST00000407564; ENSP00000384658; ENSG00000163995. [Q6H8Q1-8]
    ENST00000428004; ENSP00000389410; ENSG00000163995. [Q6H8Q1-6]
    ENST00000447017; ENSP00000393511; ENSG00000163995. [Q6H8Q1-9]
    ENST00000505872; ENSP00000421283; ENSG00000163995. [Q6H8Q1-7]
    ENST00000514025; ENSP00000423661; ENSG00000163995. [Q6H8Q1-4]
    GeneIDi84448.
    KEGGihsa:84448.
    UCSCiuc003gkl.3. human. [Q6H8Q1-4]
    uc003gkm.4. human. [Q6H8Q1-7]
    uc003gko.3. human. [Q6H8Q1-1]
    uc003gkp.3. human. [Q6H8Q1-3]
    uc003gkq.3. human. [Q6H8Q1-2]
    uc003gkr.3. human. [Q6H8Q1-8]
    uc003gks.3. human. [Q6H8Q1-6]

    Polymorphism databases

    DMDMi56404514.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    DQ413177 mRNA. Translation: ABD83330.1 .
    AJ748600 mRNA. Translation: CAG38375.1 .
    AJ748601 mRNA. Translation: CAG38376.1 .
    AK094754 mRNA. Translation: BAC04414.1 .
    AK094798 mRNA. Translation: BAC04427.1 .
    AC097381 Genomic DNA. No translation available.
    AC104650 Genomic DNA. No translation available.
    AC114807 Genomic DNA. No translation available.
    BC067214 mRNA. Translation: AAH67214.1 . Different initiation.
    BC122567 mRNA. Translation: AAI22568.1 .
    AB058711 mRNA. Translation: BAB47437.1 .
    AL834195 mRNA. Translation: CAD38885.2 .
    CCDSi CCDS47011.1. [Q6H8Q1-7 ]
    CCDS47012.1. [Q6H8Q1-2 ]
    CCDS47013.1. [Q6H8Q1-1 ]
    CCDS47014.1. [Q6H8Q1-9 ]
    CCDS47015.1. [Q6H8Q1-3 ]
    CCDS47016.1. [Q6H8Q1-6 ]
    CCDS54719.1. [Q6H8Q1-8 ]
    CCDS68669.1. [Q6H8Q1-4 ]
    RefSeqi NP_001123555.1. NM_001130083.1. [Q6H8Q1-9 ]
    NP_001123556.1. NM_001130084.1. [Q6H8Q1-1 ]
    NP_001123557.1. NM_001130085.1. [Q6H8Q1-2 ]
    NP_001123558.1. NM_001130086.1. [Q6H8Q1-7 ]
    NP_001123559.1. NM_001130087.1. [Q6H8Q1-3 ]
    NP_001123560.1. NM_001130088.1. [Q6H8Q1-6 ]
    NP_001273617.1. NM_001286688.1. [Q6H8Q1-4 ]
    NP_115808.3. NM_032432.4. [Q6H8Q1-8 ]
    UniGenei Hs.233404.

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    Entry Method Resolution (Å) Chain Positions PDBsum
    1V6G NMR - A 73-140 [» ]
    1WIG NMR - A 212-271 [» ]
    2L3X NMR - A 546-611 [» ]
    ProteinModelPortali Q6H8Q1.
    SMRi Q6H8Q1. Positions 23-271, 545-611.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 124086. 4 interactions.
    IntActi Q6H8Q1. 3 interactions.
    STRINGi 9606.ENSP00000393511.

    PTM databases

    PhosphoSitei Q6H8Q1.

    Polymorphism databases

    DMDMi 56404514.

    Proteomic databases

    PaxDbi Q6H8Q1.
    PRIDEi Q6H8Q1.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000318888 ; ENSP00000317020 ; ENSG00000163995 . [Q6H8Q1-4 ]
    ENST00000341937 ; ENSP00000342813 ; ENSG00000163995 . [Q6H8Q1-1 ]
    ENST00000361581 ; ENSP00000355003 ; ENSG00000163995 . [Q6H8Q1-2 ]
    ENST00000361737 ; ENSP00000354887 ; ENSG00000163995 . [Q6H8Q1-3 ]
    ENST00000407564 ; ENSP00000384658 ; ENSG00000163995 . [Q6H8Q1-8 ]
    ENST00000428004 ; ENSP00000389410 ; ENSG00000163995 . [Q6H8Q1-6 ]
    ENST00000447017 ; ENSP00000393511 ; ENSG00000163995 . [Q6H8Q1-9 ]
    ENST00000505872 ; ENSP00000421283 ; ENSG00000163995 . [Q6H8Q1-7 ]
    ENST00000514025 ; ENSP00000423661 ; ENSG00000163995 . [Q6H8Q1-4 ]
    GeneIDi 84448.
    KEGGi hsa:84448.
    UCSCi uc003gkl.3. human. [Q6H8Q1-4 ]
    uc003gkm.4. human. [Q6H8Q1-7 ]
    uc003gko.3. human. [Q6H8Q1-1 ]
    uc003gkp.3. human. [Q6H8Q1-3 ]
    uc003gkq.3. human. [Q6H8Q1-2 ]
    uc003gkr.3. human. [Q6H8Q1-8 ]
    uc003gks.3. human. [Q6H8Q1-6 ]

    Organism-specific databases

    CTDi 84448.
    GeneCardsi GC04M007967.
    HGNCi HGNC:19195. ABLIM2.
    HPAi HPA035808.
    MIMi 612544. gene.
    neXtProti NX_Q6H8Q1.
    PharmGKBi PA134940437.
    HUGEi Search...
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG302299.
    HOGENOMi HOG000285997.
    HOVERGENi HBG031499.
    KOi K07520.
    OMAi FRHHYIP.
    OrthoDBi EOG71CFKF.
    PhylomeDBi Q6H8Q1.
    TreeFami TF318042.

    Enzyme and pathway databases

    Reactomei REACT_22351. DCC mediated attractive signaling.

    Miscellaneous databases

    EvolutionaryTracei Q6H8Q1.
    GenomeRNAii 84448.
    NextBioi 74223.
    PROi Q6H8Q1.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q6H8Q1.
    Bgeei Q6H8Q1.
    CleanExi HS_ABLIM2.
    Genevestigatori Q6H8Q1.

    Family and domain databases

    Gene3Di 1.10.950.10. 1 hit.
    2.10.110.10. 4 hits.
    InterProi IPR028450. ABLIM2.
    IPR003128. Villin_headpiece.
    IPR001781. Znf_LIM.
    [Graphical view ]
    PANTHERi PTHR24213:SF6. PTHR24213:SF6. 1 hit.
    Pfami PF00412. LIM. 4 hits.
    PF02209. VHP. 1 hit.
    [Graphical view ]
    SMARTi SM00132. LIM. 4 hits.
    SM00153. VHP. 1 hit.
    [Graphical view ]
    SUPFAMi SSF47050. SSF47050. 1 hit.
    PROSITEi PS51089. HP. 1 hit.
    PS00478. LIM_DOMAIN_1. 4 hits.
    PS50023. LIM_DOMAIN_2. 4 hits.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Two novel members of the ABLIM protein family, ABLIM-2 and -3, associate with STARS and directly bind F-actin."
      Barrientos T., Frank D., Kuwahara K., Bezprozvannaya S., Pipes G.C.T., Bassel-Duby R., Richardson J.A., Katus H.A., Olson E.N., Frey N.
      J. Biol. Chem. 282:8393-8403(2007) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 7), FUNCTION, TISSUE SPECIFICITY, INTERACTION WITH ABRA AND F-ACTIN.
      Tissue: Heart.
    2. "Structure and transcriptional activity of the ABLIM2 gene of human, mouse and rat."
      Klimov E.A., Rakhmanaliev E.R., Rudco O.I.
      Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2).
    3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3 AND 4).
      Tissue: Brain.
    4. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
      Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
      , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
      Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 6 AND 8).
      Tissue: PNS.
    6. "Prediction of the coding sequences of unidentified human genes. XX. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
      Nagase T., Nakayama M., Nakajima D., Kikuno R., Ohara O.
      DNA Res. 8:85-95(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 34-611 (ISOFORM 2).
      Tissue: Brain.
    7. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 390-572 (ISOFORM 5).
      Tissue: Amygdala.
    8. "Solution structure of the LIM domain of the human actin binding LIM protein 2."
      RIKEN structural genomics initiative (RSGI)
      Submitted (FEB-2009) to the PDB data bank
      Cited for: STRUCTURE BY NMR OF 73-140 AND 212-271, ZINC-BINDING SITES.
    9. Cited for: VARIANTS [LARGE SCALE ANALYSIS] ARG-227 AND MET-274.

    Entry informationi

    Entry nameiABLM2_HUMAN
    AccessioniPrimary (citable) accession number: Q6H8Q1
    Secondary accession number(s): E9PF39
    , Q08E71, Q19VH0, Q6H8Q0, Q6NX73, Q8N3C5, Q8N9E9, Q8N9G2, Q96JL7
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: December 7, 2004
    Last sequence update: December 7, 2004
    Last modified: October 1, 2014
    This is version 114 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Reference proteome

    Documents

    1. Human chromosome 4
      Human chromosome 4: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    6. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3