Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Actin-binding LIM protein 2

Gene

ABLIM2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

May act as scaffold protein. May stimulate ABRA activity and ABRA-dependent SRF transcriptional activity.1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Metal bindingi83Zinc 11
Metal bindingi86Zinc 11
Metal bindingi103Zinc 11
Metal bindingi106Zinc 11
Metal bindingi109Zinc 21
Metal bindingi112Zinc 21
Metal bindingi131Zinc 21
Metal bindingi134Zinc 21
Metal bindingi212Zinc 31
Metal bindingi215Zinc 31
Metal bindingi232Zinc 31
Metal bindingi235Zinc 31
Metal bindingi238Zinc 41
Metal bindingi241Zinc 41
Metal bindingi260Zinc 41
Metal bindingi263Zinc 41

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Ligandi

Metal-binding, Zinc

Enzyme and pathway databases

ReactomeiR-HSA-418885. DCC mediated attractive signaling.

Names & Taxonomyi

Protein namesi
Recommended name:
Actin-binding LIM protein 2
Short name:
abLIM-2
Alternative name(s):
Actin-binding LIM protein family member 2
Gene namesi
Name:ABLIM2
Synonyms:KIAA1808
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 4

Organism-specific databases

HGNCiHGNC:19195. ABLIM2.

Subcellular locationi

  • Cytoplasm

  • Note: In skeletal muscle, sarcomeric or cosarcomeric localization.By similarity

GO - Cellular componenti

  • actin cytoskeleton Source: MGI
  • cytoplasm Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Organism-specific databases

DisGeNETi84448.
OpenTargetsiENSG00000163995.
PharmGKBiPA134940437.

Polymorphism and mutation databases

BioMutaiABLIM2.
DMDMi56404514.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000756991 – 611Actin-binding LIM protein 2Add BLAST611

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei282PhosphoserineBy similarity1
Modified residuei294PhosphoserineBy similarity1
Modified residuei364PhosphoserineCombined sources1
Modified residuei367PhosphoserineBy similarity1
Modified residuei452PhosphoserineBy similarity1
Modified residuei472PhosphothreonineBy similarity1
Modified residuei476PhosphoserineBy similarity1
Modified residuei578PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ6H8Q1.
PeptideAtlasiQ6H8Q1.
PRIDEiQ6H8Q1.

PTM databases

iPTMnetiQ6H8Q1.
PhosphoSitePlusiQ6H8Q1.

Expressioni

Tissue specificityi

Highly expressed in skeletal muscle.1 Publication

Gene expression databases

BgeeiENSG00000163995.
CleanExiHS_ABLIM2.
ExpressionAtlasiQ6H8Q1. baseline and differential.
GenevisibleiQ6H8Q1. HS.

Organism-specific databases

HPAiHPA035808.

Interactioni

Subunit structurei

Interacts with F-actin and ABRA.1 Publication

Protein-protein interaction databases

BioGridi124086. 4 interactors.
IntActiQ6H8Q1. 3 interactors.

Structurei

Secondary structure

1611
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Helixi75 – 77Combined sources3
Turni84 – 86Combined sources3
Beta strandi95 – 97Combined sources3
Beta strandi100 – 102Combined sources3
Turni104 – 106Combined sources3
Beta strandi110 – 112Combined sources3
Beta strandi118 – 120Combined sources3
Beta strandi122 – 125Combined sources4
Beta strandi128 – 131Combined sources4
Helixi132 – 135Combined sources4
Beta strandi213 – 215Combined sources3
Turni233 – 235Combined sources3
Beta strandi239 – 241Combined sources3
Beta strandi252 – 254Combined sources3
Beta strandi257 – 259Combined sources3
Helixi263 – 266Combined sources4
Beta strandi268 – 271Combined sources4
Helixi551 – 554Combined sources4
Helixi556 – 558Combined sources3
Turni559 – 561Combined sources3
Beta strandi570 – 572Combined sources3
Helixi573 – 576Combined sources4
Helixi579 – 586Combined sources8
Helixi590 – 595Combined sources6
Helixi598 – 607Combined sources10

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1V6GNMR-A73-140[»]
1WIGNMR-A212-271[»]
2L3XNMR-A546-611[»]
ProteinModelPortaliQ6H8Q1.
SMRiQ6H8Q1.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ6H8Q1.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini22 – 81LIM zinc-binding 1PROSITE-ProRule annotationAdd BLAST60
Domaini81 – 141LIM zinc-binding 2PROSITE-ProRule annotationAdd BLAST61
Domaini151 – 210LIM zinc-binding 3PROSITE-ProRule annotationAdd BLAST60
Domaini210 – 270LIM zinc-binding 4PROSITE-ProRule annotationAdd BLAST61
Domaini543 – 611HPPROSITE-ProRule annotationAdd BLAST69

Sequence similaritiesi

Contains 1 HP (headpiece) domain.PROSITE-ProRule annotation
Contains 4 LIM zinc-binding domains.PROSITE-ProRule annotation

Keywords - Domaini

LIM domain, Repeat

Phylogenomic databases

GeneTreeiENSGT00760000119039.
HOGENOMiHOG000285997.
HOVERGENiHBG031499.
InParanoidiQ6H8Q1.
KOiK07520.
PhylomeDBiQ6H8Q1.
TreeFamiTF318042.

Family and domain databases

Gene3Di1.10.950.10. 1 hit.
2.10.110.10. 4 hits.
InterProiIPR028450. ABLIM2.
IPR032402. AbLIM_anchor.
IPR003128. Villin_headpiece.
IPR001781. Znf_LIM.
[Graphical view]
PANTHERiPTHR24213:SF6. PTHR24213:SF6. 1 hit.
PfamiPF16182. AbLIM_anchor. 2 hits.
PF00412. LIM. 4 hits.
PF02209. VHP. 1 hit.
[Graphical view]
SMARTiSM00132. LIM. 4 hits.
SM00153. VHP. 1 hit.
[Graphical view]
SUPFAMiSSF47050. SSF47050. 1 hit.
PROSITEiPS51089. HP. 1 hit.
PS00478. LIM_DOMAIN_1. 4 hits.
PS50023. LIM_DOMAIN_2. 4 hits.
[Graphical view]

Sequences (9)i

Sequence statusi: Complete.

This entry describes 9 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q6H8Q1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSAVSQPQAA PSPLEKSPST AILCNTCGNV CKGEVLRVQD KYFHIKCFVC
60 70 80 90 100
KACGCDLAEG GFFVRQGEYI CTLDYQRLYG TRCFSCDQFI EGEVVSALGK
110 120 130 140 150
TYHPDCFVCA VCRLPFPPGD RVTFNGKECM CQKCSLPVSV GSSAHLSQGL
160 170 180 190 200
RSCGGCGTEI KNGQALVALD KHWHLGCFKC KSCGKLLNAE YISKDGLPYC
210 220 230 240 250
EADYHAKFGI RCDSCEKYIT GRVLEAGEKH YHPSCALCVR CGQMFAEGEE
260 270 280 290 300
MYLQGSSIWH PACRQAARTE DRNKETRTSS ESIISVPASS TSGSPSRVIY
310 320 330 340 350
AKLGGEILDY RDLAALPKSK AIYDIDRPDM ISYSPYISHS AGDRQSYGEG
360 370 380 390 400
DQDDRSYKQC RTSSPSSTGS VSLGRYTPTS RSPQHYSRPG SESGRSTPSL
410 420 430 440 450
SVLSDSKPPP STYQQAPRHF HVPDTGVKDN IYRKPPIYRQ HAARRSDGED
460 470 480 490 500
GSLDQDNRKK SSWLMLKGDA DTRTNSPDLD TQSLSHSSGT DRDPLQRMAG
510 520 530 540 550
DSFHSRFPYS KSDPLPGHGK NGLDQRNANL APCGADPDAS WGMREYKIYP
560 570 580 590 600
YDSLIVTNRI RVKLPKDVDR TRLERHLSPE EFQEVFGMSI EEFDRLALWK
610
RNDLKKKALL F
Length:611
Mass (Da):67,812
Last modified:December 7, 2004 - v2
Checksum:i225A4E25646B370B
GO
Isoform 2 (identifier: Q6H8Q1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     506-545: RFPYSKSDPLPGHGKNGLDQRNANLAPCGADPDASWGMRE → Q

Show »
Length:572
Mass (Da):63,632
Checksum:iF2CF3EEE6B1CCADC
GO
Isoform 3 (identifier: Q6H8Q1-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     349-349: E → ESPQLLSPTPTE
     390-441: Missing.
     506-545: RFPYSKSDPLPGHGKNGLDQRNANLAPCGADPDASWGMRE → Q

Show »
Length:531
Mass (Da):58,984
Checksum:i1E6B36B85E5176D8
GO
Isoform 4 (identifier: Q6H8Q1-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-243: Missing.
     349-349: E → ESPQLLSPTPTE
     389-422: Missing.
     459-459: K → KQ

Note: No experimental confirmation available.
Show »
Length:346
Mass (Da):38,966
Checksum:i00733A9BC0EA7BE5
GO
Isoform 5 (identifier: Q6H8Q1-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     459-459: K → KQ
     506-545: RFPYSKSDPLPGHGKNGLDQRNANLAPCGADPDASWGMRE → Q

Note: No experimental confirmation available.
Show »
Length:573
Mass (Da):63,760
Checksum:iDFD6CB38CF846982
GO
Isoform 6 (identifier: Q6H8Q1-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     349-349: E → ESPQLLSPTPTE
     390-441: Missing.
     459-459: K → KQ
     507-510: FPYS → EWFF
     511-611: Missing.

Note: No experimental confirmation available.
Show »
Length:470
Mass (Da):51,698
Checksum:iFD93E620E09C0742
GO
Isoform 7 (identifier: Q6H8Q1-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     390-441: Missing.

Show »
Length:559
Mass (Da):62,013
Checksum:iA055D0C31DE338FA
GO
Isoform 8 (identifier: Q6H8Q1-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     390-441: Missing.
     459-459: K → KQ
     506-545: RFPYSKSDPLPGHGKNGLDQRNANLAPCGADPDASWGMRE → Q

Note: No experimental confirmation available.
Show »
Length:521
Mass (Da):57,960
Checksum:i1A242FA6173188E3
GO
Isoform 9 (identifier: Q6H8Q1-9) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     389-389: P → PAGTVSVGTSSCLSLSQHPSPTSVFRHHYIPYFR
     459-459: K → KQ

Note: No experimental confirmation available.
Show »
Length:645
Mass (Da):71,542
Checksum:i50C4FDC1B30AD41E
GO

Sequence cautioni

The sequence AAH67214 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti240R → G in BAC04414 (PubMed:14702039).Curated1
Sequence conflicti312D → G in BAC04414 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_062665227G → R in a pancreatic ductal adenocarcinoma sample; somatic mutation. 1 PublicationCorresponds to variant rs757430763dbSNPEnsembl.1
Natural variantiVAR_062666274K → M in a pancreatic ductal adenocarcinoma sample; somatic mutation. 1 Publication1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0121121 – 243Missing in isoform 4. 1 PublicationAdd BLAST243
Alternative sequenceiVSP_012113349E → ESPQLLSPTPTE in isoform 3, isoform 4 and isoform 6. 2 Publications1
Alternative sequenceiVSP_012114389 – 422Missing in isoform 4. 1 PublicationAdd BLAST34
Alternative sequenceiVSP_046646389P → PAGTVSVGTSSCLSLSQHPS PTSVFRHHYIPYFR in isoform 9. Curated1
Alternative sequenceiVSP_012115390 – 441Missing in isoform 3, isoform 6, isoform 7 and isoform 8. 3 PublicationsAdd BLAST52
Alternative sequenceiVSP_012116459K → KQ in isoform 4, isoform 5, isoform 6, isoform 8 and isoform 9. 3 Publications1
Alternative sequenceiVSP_012117506 – 545RFPYS…WGMRE → Q in isoform 2, isoform 3, isoform 5 and isoform 8. 5 PublicationsAdd BLAST40
Alternative sequenceiVSP_012118507 – 510FPYS → EWFF in isoform 6. 1 Publication4
Alternative sequenceiVSP_012119511 – 611Missing in isoform 6. 1 PublicationAdd BLAST101

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
DQ413177 mRNA. Translation: ABD83330.1.
AJ748600 mRNA. Translation: CAG38375.1.
AJ748601 mRNA. Translation: CAG38376.1.
AK094754 mRNA. Translation: BAC04414.1.
AK094798 mRNA. Translation: BAC04427.1.
AC097381 Genomic DNA. No translation available.
AC104650 Genomic DNA. No translation available.
AC114807 Genomic DNA. No translation available.
BC067214 mRNA. Translation: AAH67214.1. Different initiation.
BC122567 mRNA. Translation: AAI22568.1.
AB058711 mRNA. Translation: BAB47437.1.
AL834195 mRNA. Translation: CAD38885.2.
CCDSiCCDS47011.1. [Q6H8Q1-7]
CCDS47012.1. [Q6H8Q1-2]
CCDS47013.1. [Q6H8Q1-1]
CCDS47014.1. [Q6H8Q1-9]
CCDS47015.1. [Q6H8Q1-3]
CCDS47016.1. [Q6H8Q1-6]
CCDS54719.1. [Q6H8Q1-8]
CCDS68669.1. [Q6H8Q1-4]
RefSeqiNP_001123555.1. NM_001130083.1. [Q6H8Q1-9]
NP_001123556.1. NM_001130084.1. [Q6H8Q1-1]
NP_001123557.1. NM_001130085.1. [Q6H8Q1-2]
NP_001123558.1. NM_001130086.1. [Q6H8Q1-7]
NP_001123559.1. NM_001130087.1. [Q6H8Q1-3]
NP_001123560.1. NM_001130088.1. [Q6H8Q1-6]
NP_001273617.1. NM_001286688.1. [Q6H8Q1-4]
NP_115808.3. NM_032432.4. [Q6H8Q1-8]
UniGeneiHs.233404.

Genome annotation databases

EnsembliENST00000341937; ENSP00000342813; ENSG00000163995. [Q6H8Q1-1]
ENST00000361581; ENSP00000355003; ENSG00000163995. [Q6H8Q1-2]
ENST00000361737; ENSP00000354887; ENSG00000163995. [Q6H8Q1-3]
ENST00000407564; ENSP00000384658; ENSG00000163995. [Q6H8Q1-8]
ENST00000428004; ENSP00000389410; ENSG00000163995. [Q6H8Q1-6]
ENST00000447017; ENSP00000393511; ENSG00000163995. [Q6H8Q1-9]
ENST00000505872; ENSP00000421283; ENSG00000163995. [Q6H8Q1-7]
ENST00000514025; ENSP00000423661; ENSG00000163995. [Q6H8Q1-4]
GeneIDi84448.
KEGGihsa:84448.
UCSCiuc003gkj.5. human. [Q6H8Q1-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
DQ413177 mRNA. Translation: ABD83330.1.
AJ748600 mRNA. Translation: CAG38375.1.
AJ748601 mRNA. Translation: CAG38376.1.
AK094754 mRNA. Translation: BAC04414.1.
AK094798 mRNA. Translation: BAC04427.1.
AC097381 Genomic DNA. No translation available.
AC104650 Genomic DNA. No translation available.
AC114807 Genomic DNA. No translation available.
BC067214 mRNA. Translation: AAH67214.1. Different initiation.
BC122567 mRNA. Translation: AAI22568.1.
AB058711 mRNA. Translation: BAB47437.1.
AL834195 mRNA. Translation: CAD38885.2.
CCDSiCCDS47011.1. [Q6H8Q1-7]
CCDS47012.1. [Q6H8Q1-2]
CCDS47013.1. [Q6H8Q1-1]
CCDS47014.1. [Q6H8Q1-9]
CCDS47015.1. [Q6H8Q1-3]
CCDS47016.1. [Q6H8Q1-6]
CCDS54719.1. [Q6H8Q1-8]
CCDS68669.1. [Q6H8Q1-4]
RefSeqiNP_001123555.1. NM_001130083.1. [Q6H8Q1-9]
NP_001123556.1. NM_001130084.1. [Q6H8Q1-1]
NP_001123557.1. NM_001130085.1. [Q6H8Q1-2]
NP_001123558.1. NM_001130086.1. [Q6H8Q1-7]
NP_001123559.1. NM_001130087.1. [Q6H8Q1-3]
NP_001123560.1. NM_001130088.1. [Q6H8Q1-6]
NP_001273617.1. NM_001286688.1. [Q6H8Q1-4]
NP_115808.3. NM_032432.4. [Q6H8Q1-8]
UniGeneiHs.233404.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1V6GNMR-A73-140[»]
1WIGNMR-A212-271[»]
2L3XNMR-A546-611[»]
ProteinModelPortaliQ6H8Q1.
SMRiQ6H8Q1.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi124086. 4 interactors.
IntActiQ6H8Q1. 3 interactors.

PTM databases

iPTMnetiQ6H8Q1.
PhosphoSitePlusiQ6H8Q1.

Polymorphism and mutation databases

BioMutaiABLIM2.
DMDMi56404514.

Proteomic databases

MaxQBiQ6H8Q1.
PeptideAtlasiQ6H8Q1.
PRIDEiQ6H8Q1.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000341937; ENSP00000342813; ENSG00000163995. [Q6H8Q1-1]
ENST00000361581; ENSP00000355003; ENSG00000163995. [Q6H8Q1-2]
ENST00000361737; ENSP00000354887; ENSG00000163995. [Q6H8Q1-3]
ENST00000407564; ENSP00000384658; ENSG00000163995. [Q6H8Q1-8]
ENST00000428004; ENSP00000389410; ENSG00000163995. [Q6H8Q1-6]
ENST00000447017; ENSP00000393511; ENSG00000163995. [Q6H8Q1-9]
ENST00000505872; ENSP00000421283; ENSG00000163995. [Q6H8Q1-7]
ENST00000514025; ENSP00000423661; ENSG00000163995. [Q6H8Q1-4]
GeneIDi84448.
KEGGihsa:84448.
UCSCiuc003gkj.5. human. [Q6H8Q1-1]

Organism-specific databases

CTDi84448.
DisGeNETi84448.
GeneCardsiABLIM2.
HGNCiHGNC:19195. ABLIM2.
HPAiHPA035808.
MIMi612544. gene.
neXtProtiNX_Q6H8Q1.
OpenTargetsiENSG00000163995.
PharmGKBiPA134940437.
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

GeneTreeiENSGT00760000119039.
HOGENOMiHOG000285997.
HOVERGENiHBG031499.
InParanoidiQ6H8Q1.
KOiK07520.
PhylomeDBiQ6H8Q1.
TreeFamiTF318042.

Enzyme and pathway databases

ReactomeiR-HSA-418885. DCC mediated attractive signaling.

Miscellaneous databases

ChiTaRSiABLIM2. human.
EvolutionaryTraceiQ6H8Q1.
GenomeRNAii84448.
PROiQ6H8Q1.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000163995.
CleanExiHS_ABLIM2.
ExpressionAtlasiQ6H8Q1. baseline and differential.
GenevisibleiQ6H8Q1. HS.

Family and domain databases

Gene3Di1.10.950.10. 1 hit.
2.10.110.10. 4 hits.
InterProiIPR028450. ABLIM2.
IPR032402. AbLIM_anchor.
IPR003128. Villin_headpiece.
IPR001781. Znf_LIM.
[Graphical view]
PANTHERiPTHR24213:SF6. PTHR24213:SF6. 1 hit.
PfamiPF16182. AbLIM_anchor. 2 hits.
PF00412. LIM. 4 hits.
PF02209. VHP. 1 hit.
[Graphical view]
SMARTiSM00132. LIM. 4 hits.
SM00153. VHP. 1 hit.
[Graphical view]
SUPFAMiSSF47050. SSF47050. 1 hit.
PROSITEiPS51089. HP. 1 hit.
PS00478. LIM_DOMAIN_1. 4 hits.
PS50023. LIM_DOMAIN_2. 4 hits.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiABLM2_HUMAN
AccessioniPrimary (citable) accession number: Q6H8Q1
Secondary accession number(s): E9PF39
, Q08E71, Q19VH0, Q6H8Q0, Q6NX73, Q8N3C5, Q8N9E9, Q8N9G2, Q96JL7
Entry historyi
Integrated into UniProtKB/Swiss-Prot: December 7, 2004
Last sequence update: December 7, 2004
Last modified: November 2, 2016
This is version 131 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 4
    Human chromosome 4: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.