Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q6H8Q1

- ABLM2_HUMAN

UniProt

Q6H8Q1 - ABLM2_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Actin-binding LIM protein 2

Gene

ABLIM2

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

May act as scaffold protein. May stimulate ABRA activity and ABRA-dependent SRF transcriptional activity.1 Publication

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Metal bindingi83 – 831Zinc 1
Metal bindingi86 – 861Zinc 1
Metal bindingi103 – 1031Zinc 1
Metal bindingi106 – 1061Zinc 1
Metal bindingi109 – 1091Zinc 2
Metal bindingi112 – 1121Zinc 2
Metal bindingi131 – 1311Zinc 2
Metal bindingi134 – 1341Zinc 2
Metal bindingi212 – 2121Zinc 3
Metal bindingi215 – 2151Zinc 3
Metal bindingi232 – 2321Zinc 3
Metal bindingi235 – 2351Zinc 3
Metal bindingi238 – 2381Zinc 4
Metal bindingi241 – 2411Zinc 4
Metal bindingi260 – 2601Zinc 4
Metal bindingi263 – 2631Zinc 4

GO - Molecular functioni

  1. zinc ion binding Source: InterPro

GO - Biological processi

  1. actin cytoskeleton organization Source: InterPro
  2. axon guidance Source: Reactome
  3. positive regulation of transcription from RNA polymerase II promoter Source: Ensembl
  4. transcription, DNA-templated Source: InterPro
Complete GO annotation...

Keywords - Ligandi

Metal-binding, Zinc

Enzyme and pathway databases

ReactomeiREACT_22351. DCC mediated attractive signaling.

Names & Taxonomyi

Protein namesi
Recommended name:
Actin-binding LIM protein 2
Short name:
abLIM-2
Alternative name(s):
Actin-binding LIM protein family member 2
Gene namesi
Name:ABLIM2
Synonyms:KIAA1808
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 4

Organism-specific databases

HGNCiHGNC:19195. ABLIM2.

Subcellular locationi

Cytoplasm
Note: In skeletal muscle, sarcomeric or cosarcomeric localization.By similarity

GO - Cellular componenti

  1. actin cytoskeleton Source: MGI
  2. myofibril Source: Ensembl
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134940437.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 611611Actin-binding LIM protein 2PRO_0000075699Add
BLAST

Proteomic databases

MaxQBiQ6H8Q1.
PaxDbiQ6H8Q1.
PRIDEiQ6H8Q1.

PTM databases

PhosphoSiteiQ6H8Q1.

Expressioni

Tissue specificityi

Highly expressed in skeletal muscle.1 Publication

Gene expression databases

BgeeiQ6H8Q1.
CleanExiHS_ABLIM2.
ExpressionAtlasiQ6H8Q1. baseline and differential.
GenevestigatoriQ6H8Q1.

Organism-specific databases

HPAiHPA035808.

Interactioni

Subunit structurei

Interacts with F-actin and ABRA.1 Publication

Protein-protein interaction databases

BioGridi124086. 5 interactions.
IntActiQ6H8Q1. 3 interactions.
STRINGi9606.ENSP00000393511.

Structurei

Secondary structure

1
611
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Helixi75 – 773Combined sources
Turni84 – 863Combined sources
Beta strandi95 – 973Combined sources
Beta strandi100 – 1023Combined sources
Turni104 – 1063Combined sources
Beta strandi110 – 1123Combined sources
Beta strandi118 – 1203Combined sources
Beta strandi122 – 1254Combined sources
Beta strandi128 – 1314Combined sources
Helixi132 – 1354Combined sources
Beta strandi213 – 2153Combined sources
Turni233 – 2353Combined sources
Beta strandi239 – 2413Combined sources
Beta strandi252 – 2543Combined sources
Beta strandi257 – 2593Combined sources
Helixi263 – 2664Combined sources
Beta strandi268 – 2714Combined sources
Helixi551 – 5544Combined sources
Helixi556 – 5583Combined sources
Turni559 – 5613Combined sources
Beta strandi570 – 5723Combined sources
Helixi573 – 5764Combined sources
Helixi579 – 5868Combined sources
Helixi590 – 5956Combined sources
Helixi598 – 60710Combined sources

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
1V6GNMR-A73-140[»]
1WIGNMR-A212-271[»]
2L3XNMR-A546-611[»]
ProteinModelPortaliQ6H8Q1.
SMRiQ6H8Q1. Positions 23-140, 148-271, 545-611.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ6H8Q1.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini22 – 8160LIM zinc-binding 1PROSITE-ProRule annotationAdd
BLAST
Domaini81 – 14161LIM zinc-binding 2PROSITE-ProRule annotationAdd
BLAST
Domaini151 – 21060LIM zinc-binding 3PROSITE-ProRule annotationAdd
BLAST
Domaini210 – 27061LIM zinc-binding 4PROSITE-ProRule annotationAdd
BLAST
Domaini543 – 61169HPPROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Contains 1 HP (headpiece) domain.PROSITE-ProRule annotation
Contains 4 LIM zinc-binding domains.PROSITE-ProRule annotation

Keywords - Domaini

LIM domain, Repeat

Phylogenomic databases

eggNOGiNOG302299.
GeneTreeiENSGT00760000119039.
HOGENOMiHOG000285997.
HOVERGENiHBG031499.
InParanoidiQ6H8Q1.
KOiK07520.
OMAiFRHHYIP.
OrthoDBiEOG71CFKF.
PhylomeDBiQ6H8Q1.
TreeFamiTF318042.

Family and domain databases

Gene3Di1.10.950.10. 1 hit.
2.10.110.10. 4 hits.
InterProiIPR028450. ABLIM2.
IPR003128. Villin_headpiece.
IPR001781. Znf_LIM.
[Graphical view]
PANTHERiPTHR24213:SF6. PTHR24213:SF6. 1 hit.
PfamiPF00412. LIM. 4 hits.
PF02209. VHP. 1 hit.
[Graphical view]
SMARTiSM00132. LIM. 4 hits.
SM00153. VHP. 1 hit.
[Graphical view]
SUPFAMiSSF47050. SSF47050. 1 hit.
PROSITEiPS51089. HP. 1 hit.
PS00478. LIM_DOMAIN_1. 4 hits.
PS50023. LIM_DOMAIN_2. 4 hits.
[Graphical view]

Sequences (9)i

Sequence statusi: Complete.

This entry describes 9 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q6H8Q1-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSAVSQPQAA PSPLEKSPST AILCNTCGNV CKGEVLRVQD KYFHIKCFVC
60 70 80 90 100
KACGCDLAEG GFFVRQGEYI CTLDYQRLYG TRCFSCDQFI EGEVVSALGK
110 120 130 140 150
TYHPDCFVCA VCRLPFPPGD RVTFNGKECM CQKCSLPVSV GSSAHLSQGL
160 170 180 190 200
RSCGGCGTEI KNGQALVALD KHWHLGCFKC KSCGKLLNAE YISKDGLPYC
210 220 230 240 250
EADYHAKFGI RCDSCEKYIT GRVLEAGEKH YHPSCALCVR CGQMFAEGEE
260 270 280 290 300
MYLQGSSIWH PACRQAARTE DRNKETRTSS ESIISVPASS TSGSPSRVIY
310 320 330 340 350
AKLGGEILDY RDLAALPKSK AIYDIDRPDM ISYSPYISHS AGDRQSYGEG
360 370 380 390 400
DQDDRSYKQC RTSSPSSTGS VSLGRYTPTS RSPQHYSRPG SESGRSTPSL
410 420 430 440 450
SVLSDSKPPP STYQQAPRHF HVPDTGVKDN IYRKPPIYRQ HAARRSDGED
460 470 480 490 500
GSLDQDNRKK SSWLMLKGDA DTRTNSPDLD TQSLSHSSGT DRDPLQRMAG
510 520 530 540 550
DSFHSRFPYS KSDPLPGHGK NGLDQRNANL APCGADPDAS WGMREYKIYP
560 570 580 590 600
YDSLIVTNRI RVKLPKDVDR TRLERHLSPE EFQEVFGMSI EEFDRLALWK
610
RNDLKKKALL F
Length:611
Mass (Da):67,812
Last modified:December 7, 2004 - v2
Checksum:i225A4E25646B370B
GO
Isoform 2 (identifier: Q6H8Q1-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     506-545: RFPYSKSDPLPGHGKNGLDQRNANLAPCGADPDASWGMRE → Q

Show »
Length:572
Mass (Da):63,632
Checksum:iF2CF3EEE6B1CCADC
GO
Isoform 3 (identifier: Q6H8Q1-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     349-349: E → ESPQLLSPTPTE
     390-441: Missing.
     506-545: RFPYSKSDPLPGHGKNGLDQRNANLAPCGADPDASWGMRE → Q

Show »
Length:531
Mass (Da):58,984
Checksum:i1E6B36B85E5176D8
GO
Isoform 4 (identifier: Q6H8Q1-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-243: Missing.
     349-349: E → ESPQLLSPTPTE
     389-422: Missing.
     459-459: K → KQ

Note: No experimental confirmation available.

Show »
Length:346
Mass (Da):38,966
Checksum:i00733A9BC0EA7BE5
GO
Isoform 5 (identifier: Q6H8Q1-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     459-459: K → KQ
     506-545: RFPYSKSDPLPGHGKNGLDQRNANLAPCGADPDASWGMRE → Q

Note: No experimental confirmation available.

Show »
Length:573
Mass (Da):63,760
Checksum:iDFD6CB38CF846982
GO
Isoform 6 (identifier: Q6H8Q1-6) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     349-349: E → ESPQLLSPTPTE
     390-441: Missing.
     459-459: K → KQ
     507-510: FPYS → EWFF
     511-611: Missing.

Note: No experimental confirmation available.

Show »
Length:470
Mass (Da):51,698
Checksum:iFD93E620E09C0742
GO
Isoform 7 (identifier: Q6H8Q1-7) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     390-441: Missing.

Show »
Length:559
Mass (Da):62,013
Checksum:iA055D0C31DE338FA
GO
Isoform 8 (identifier: Q6H8Q1-8) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     390-441: Missing.
     459-459: K → KQ
     506-545: RFPYSKSDPLPGHGKNGLDQRNANLAPCGADPDASWGMRE → Q

Note: No experimental confirmation available.

Show »
Length:521
Mass (Da):57,960
Checksum:i1A242FA6173188E3
GO
Isoform 9 (identifier: Q6H8Q1-9) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     389-389: P → PAGTVSVGTSSCLSLSQHPSPTSVFRHHYIPYFR
     459-459: K → KQ

Note: No experimental confirmation available.

Show »
Length:645
Mass (Da):71,542
Checksum:i50C4FDC1B30AD41E
GO

Sequence cautioni

The sequence AAH67214.1 differs from that shown. Reason: Erroneous initiation. Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti240 – 2401R → G in BAC04414. (PubMed:14702039)Curated
Sequence conflicti312 – 3121D → G in BAC04414. (PubMed:14702039)Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti227 – 2271G → R in a pancreatic ductal adenocarcinoma sample; somatic mutation. 1 Publication
VAR_062665
Natural varianti274 – 2741K → M in a pancreatic ductal adenocarcinoma sample; somatic mutation. 1 Publication
VAR_062666

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 243243Missing in isoform 4. 1 PublicationVSP_012112Add
BLAST
Alternative sequencei349 – 3491E → ESPQLLSPTPTE in isoform 3, isoform 4 and isoform 6. 2 PublicationsVSP_012113
Alternative sequencei389 – 42234Missing in isoform 4. 1 PublicationVSP_012114Add
BLAST
Alternative sequencei389 – 3891P → PAGTVSVGTSSCLSLSQHPS PTSVFRHHYIPYFR in isoform 9. CuratedVSP_046646
Alternative sequencei390 – 44152Missing in isoform 3, isoform 6, isoform 7 and isoform 8. 3 PublicationsVSP_012115Add
BLAST
Alternative sequencei459 – 4591K → KQ in isoform 4, isoform 5, isoform 6, isoform 8 and isoform 9. 3 PublicationsVSP_012116
Alternative sequencei506 – 54540RFPYS…WGMRE → Q in isoform 2, isoform 3, isoform 5 and isoform 8. 5 PublicationsVSP_012117Add
BLAST
Alternative sequencei507 – 5104FPYS → EWFF in isoform 6. 1 PublicationVSP_012118
Alternative sequencei511 – 611101Missing in isoform 6. 1 PublicationVSP_012119Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
DQ413177 mRNA. Translation: ABD83330.1.
AJ748600 mRNA. Translation: CAG38375.1.
AJ748601 mRNA. Translation: CAG38376.1.
AK094754 mRNA. Translation: BAC04414.1.
AK094798 mRNA. Translation: BAC04427.1.
AC097381 Genomic DNA. No translation available.
AC104650 Genomic DNA. No translation available.
AC114807 Genomic DNA. No translation available.
BC067214 mRNA. Translation: AAH67214.1. Different initiation.
BC122567 mRNA. Translation: AAI22568.1.
AB058711 mRNA. Translation: BAB47437.1.
AL834195 mRNA. Translation: CAD38885.2.
CCDSiCCDS47011.1. [Q6H8Q1-7]
CCDS47012.1. [Q6H8Q1-2]
CCDS47013.1. [Q6H8Q1-1]
CCDS47014.1. [Q6H8Q1-9]
CCDS47015.1. [Q6H8Q1-3]
CCDS47016.1. [Q6H8Q1-6]
CCDS54719.1. [Q6H8Q1-8]
CCDS68669.1. [Q6H8Q1-4]
RefSeqiNP_001123555.1. NM_001130083.1. [Q6H8Q1-9]
NP_001123556.1. NM_001130084.1. [Q6H8Q1-1]
NP_001123557.1. NM_001130085.1. [Q6H8Q1-2]
NP_001123558.1. NM_001130086.1. [Q6H8Q1-7]
NP_001123559.1. NM_001130087.1. [Q6H8Q1-3]
NP_001123560.1. NM_001130088.1. [Q6H8Q1-6]
NP_001273617.1. NM_001286688.1. [Q6H8Q1-4]
NP_115808.3. NM_032432.4. [Q6H8Q1-8]
UniGeneiHs.233404.

Genome annotation databases

EnsembliENST00000341937; ENSP00000342813; ENSG00000163995. [Q6H8Q1-1]
ENST00000361581; ENSP00000355003; ENSG00000163995. [Q6H8Q1-2]
ENST00000361737; ENSP00000354887; ENSG00000163995. [Q6H8Q1-3]
ENST00000407564; ENSP00000384658; ENSG00000163995. [Q6H8Q1-8]
ENST00000428004; ENSP00000389410; ENSG00000163995. [Q6H8Q1-6]
ENST00000447017; ENSP00000393511; ENSG00000163995. [Q6H8Q1-9]
ENST00000505872; ENSP00000421283; ENSG00000163995. [Q6H8Q1-7]
ENST00000514025; ENSP00000423661; ENSG00000163995. [Q6H8Q1-4]
GeneIDi84448.
KEGGihsa:84448.
UCSCiuc003gkl.3. human. [Q6H8Q1-4]
uc003gkm.4. human. [Q6H8Q1-7]
uc003gko.3. human. [Q6H8Q1-1]
uc003gkp.3. human. [Q6H8Q1-3]
uc003gkq.3. human. [Q6H8Q1-2]
uc003gkr.3. human. [Q6H8Q1-8]
uc003gks.3. human. [Q6H8Q1-6]

Polymorphism databases

DMDMi56404514.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
DQ413177 mRNA. Translation: ABD83330.1 .
AJ748600 mRNA. Translation: CAG38375.1 .
AJ748601 mRNA. Translation: CAG38376.1 .
AK094754 mRNA. Translation: BAC04414.1 .
AK094798 mRNA. Translation: BAC04427.1 .
AC097381 Genomic DNA. No translation available.
AC104650 Genomic DNA. No translation available.
AC114807 Genomic DNA. No translation available.
BC067214 mRNA. Translation: AAH67214.1 . Different initiation.
BC122567 mRNA. Translation: AAI22568.1 .
AB058711 mRNA. Translation: BAB47437.1 .
AL834195 mRNA. Translation: CAD38885.2 .
CCDSi CCDS47011.1. [Q6H8Q1-7 ]
CCDS47012.1. [Q6H8Q1-2 ]
CCDS47013.1. [Q6H8Q1-1 ]
CCDS47014.1. [Q6H8Q1-9 ]
CCDS47015.1. [Q6H8Q1-3 ]
CCDS47016.1. [Q6H8Q1-6 ]
CCDS54719.1. [Q6H8Q1-8 ]
CCDS68669.1. [Q6H8Q1-4 ]
RefSeqi NP_001123555.1. NM_001130083.1. [Q6H8Q1-9 ]
NP_001123556.1. NM_001130084.1. [Q6H8Q1-1 ]
NP_001123557.1. NM_001130085.1. [Q6H8Q1-2 ]
NP_001123558.1. NM_001130086.1. [Q6H8Q1-7 ]
NP_001123559.1. NM_001130087.1. [Q6H8Q1-3 ]
NP_001123560.1. NM_001130088.1. [Q6H8Q1-6 ]
NP_001273617.1. NM_001286688.1. [Q6H8Q1-4 ]
NP_115808.3. NM_032432.4. [Q6H8Q1-8 ]
UniGenei Hs.233404.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
1V6G NMR - A 73-140 [» ]
1WIG NMR - A 212-271 [» ]
2L3X NMR - A 546-611 [» ]
ProteinModelPortali Q6H8Q1.
SMRi Q6H8Q1. Positions 23-140, 148-271, 545-611.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 124086. 5 interactions.
IntActi Q6H8Q1. 3 interactions.
STRINGi 9606.ENSP00000393511.

PTM databases

PhosphoSitei Q6H8Q1.

Polymorphism databases

DMDMi 56404514.

Proteomic databases

MaxQBi Q6H8Q1.
PaxDbi Q6H8Q1.
PRIDEi Q6H8Q1.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000341937 ; ENSP00000342813 ; ENSG00000163995 . [Q6H8Q1-1 ]
ENST00000361581 ; ENSP00000355003 ; ENSG00000163995 . [Q6H8Q1-2 ]
ENST00000361737 ; ENSP00000354887 ; ENSG00000163995 . [Q6H8Q1-3 ]
ENST00000407564 ; ENSP00000384658 ; ENSG00000163995 . [Q6H8Q1-8 ]
ENST00000428004 ; ENSP00000389410 ; ENSG00000163995 . [Q6H8Q1-6 ]
ENST00000447017 ; ENSP00000393511 ; ENSG00000163995 . [Q6H8Q1-9 ]
ENST00000505872 ; ENSP00000421283 ; ENSG00000163995 . [Q6H8Q1-7 ]
ENST00000514025 ; ENSP00000423661 ; ENSG00000163995 . [Q6H8Q1-4 ]
GeneIDi 84448.
KEGGi hsa:84448.
UCSCi uc003gkl.3. human. [Q6H8Q1-4 ]
uc003gkm.4. human. [Q6H8Q1-7 ]
uc003gko.3. human. [Q6H8Q1-1 ]
uc003gkp.3. human. [Q6H8Q1-3 ]
uc003gkq.3. human. [Q6H8Q1-2 ]
uc003gkr.3. human. [Q6H8Q1-8 ]
uc003gks.3. human. [Q6H8Q1-6 ]

Organism-specific databases

CTDi 84448.
GeneCardsi GC04M007967.
HGNCi HGNC:19195. ABLIM2.
HPAi HPA035808.
MIMi 612544. gene.
neXtProti NX_Q6H8Q1.
PharmGKBi PA134940437.
HUGEi Search...
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG302299.
GeneTreei ENSGT00760000119039.
HOGENOMi HOG000285997.
HOVERGENi HBG031499.
InParanoidi Q6H8Q1.
KOi K07520.
OMAi FRHHYIP.
OrthoDBi EOG71CFKF.
PhylomeDBi Q6H8Q1.
TreeFami TF318042.

Enzyme and pathway databases

Reactomei REACT_22351. DCC mediated attractive signaling.

Miscellaneous databases

ChiTaRSi ABLIM2. human.
EvolutionaryTracei Q6H8Q1.
GenomeRNAii 84448.
NextBioi 74223.
PROi Q6H8Q1.
SOURCEi Search...

Gene expression databases

Bgeei Q6H8Q1.
CleanExi HS_ABLIM2.
ExpressionAtlasi Q6H8Q1. baseline and differential.
Genevestigatori Q6H8Q1.

Family and domain databases

Gene3Di 1.10.950.10. 1 hit.
2.10.110.10. 4 hits.
InterProi IPR028450. ABLIM2.
IPR003128. Villin_headpiece.
IPR001781. Znf_LIM.
[Graphical view ]
PANTHERi PTHR24213:SF6. PTHR24213:SF6. 1 hit.
Pfami PF00412. LIM. 4 hits.
PF02209. VHP. 1 hit.
[Graphical view ]
SMARTi SM00132. LIM. 4 hits.
SM00153. VHP. 1 hit.
[Graphical view ]
SUPFAMi SSF47050. SSF47050. 1 hit.
PROSITEi PS51089. HP. 1 hit.
PS00478. LIM_DOMAIN_1. 4 hits.
PS50023. LIM_DOMAIN_2. 4 hits.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Two novel members of the ABLIM protein family, ABLIM-2 and -3, associate with STARS and directly bind F-actin."
    Barrientos T., Frank D., Kuwahara K., Bezprozvannaya S., Pipes G.C.T., Bassel-Duby R., Richardson J.A., Katus H.A., Olson E.N., Frey N.
    J. Biol. Chem. 282:8393-8403(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 7), FUNCTION, TISSUE SPECIFICITY, INTERACTION WITH ABRA AND F-ACTIN.
    Tissue: Heart.
  2. "Structure and transcriptional activity of the ABLIM2 gene of human, mouse and rat."
    Klimov E.A., Rakhmanaliev E.R., Rudco O.I.
    Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2).
  3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3 AND 4).
    Tissue: Brain.
  4. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
    Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
    , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
    Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 6 AND 8).
    Tissue: PNS.
  6. "Prediction of the coding sequences of unidentified human genes. XX. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
    Nagase T., Nakayama M., Nakajima D., Kikuno R., Ohara O.
    DNA Res. 8:85-95(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 34-611 (ISOFORM 2).
    Tissue: Brain.
  7. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 390-572 (ISOFORM 5).
    Tissue: Amygdala.
  8. "Solution structure of the LIM domain of the human actin binding LIM protein 2."
    RIKEN structural genomics initiative (RSGI)
    Submitted (FEB-2009) to the PDB data bank
    Cited for: STRUCTURE BY NMR OF 73-140 AND 212-271, ZINC-BINDING SITES.
  9. Cited for: VARIANTS [LARGE SCALE ANALYSIS] ARG-227 AND MET-274.

Entry informationi

Entry nameiABLM2_HUMAN
AccessioniPrimary (citable) accession number: Q6H8Q1
Secondary accession number(s): E9PF39
, Q08E71, Q19VH0, Q6H8Q0, Q6NX73, Q8N3C5, Q8N9E9, Q8N9G2, Q96JL7
Entry historyi
Integrated into UniProtKB/Swiss-Prot: December 7, 2004
Last sequence update: December 7, 2004
Last modified: November 26, 2014
This is version 116 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 4
    Human chromosome 4: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3