Q6H8Q1 (ABLM2_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 100.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Actin-binding LIM protein 2 Short name=abLIM-2 Alternative name(s): Actin-binding LIM protein family member 2 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 611 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | May act as scaffold protein. May stimulate ABRA activity and ABRA-dependent SRF transcriptional activity. Ref.1 |
| Subunit structure | Interacts with F-actin and ABRA. Ref.1 |
| Subcellular location | Cytoplasm. Note: In skeletal muscle, sarcomeric or cosarcomeric localization By similarity. |
| Tissue specificity | Highly expressed in skeletal muscle. Ref.1 |
| Sequence similarities | Contains 1 HP (headpiece) domain. Contains 4 LIM zinc-binding domains. |
| Sequence caution | The sequence AAH67214.1 differs from that shown. Reason: Erroneous initiation. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cytoplasm |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | LIM domain Repeat |
| Ligand | Metal-binding Zinc |
| PTM | Phosphoprotein |
| Technical term | 3D-structure Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | axon guidance Traceable author statement. Source: Reactome cytoskeleton organizationInferred from electronic annotation. Source: InterPro |
| Cellular_component | actin cytoskeleton Inferred from direct assay Ref.1. Source: MGI cytoplasmNon-traceable author statement. Source: UniProtKB intermediate filament cytoskeletonInferred from direct assay. Source: HPA nucleusInferred from direct assay. Source: HPA |
| Molecular_function | zinc ion binding Non-traceable author statement. Source: UniProtKB |
| Complete GO annotation... | |
Alternative products
| This entry describes 8 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q6H8Q1-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q6H8Q1-2) The sequence of this isoform differs from the canonical sequence as follows: 506-545: RFPYSKSDPLPGHGKNGLDQRNANLAPCGADPDASWGMRE → Q | ||||||
| Isoform 3 (identifier: Q6H8Q1-3) The sequence of this isoform differs from the canonical sequence as follows: 349-349: E → ESPQLLSPTPTE 390-441: Missing. 506-545: RFPYSKSDPLPGHGKNGLDQRNANLAPCGADPDASWGMRE → Q | ||||||
| Isoform 4 (identifier: Q6H8Q1-4) The sequence of this isoform differs from the canonical sequence as follows: 1-243: Missing. 349-349: E → ESPQLLSPTPTE 389-422: Missing. 459-459: K → KQ | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 5 (identifier: Q6H8Q1-5) The sequence of this isoform differs from the canonical sequence as follows: 459-459: K → KQ 506-545: RFPYSKSDPLPGHGKNGLDQRNANLAPCGADPDASWGMRE → Q | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 6 (identifier: Q6H8Q1-6) The sequence of this isoform differs from the canonical sequence as follows: 349-349: E → ESPQLLSPTPTE 390-441: Missing. 459-459: K → KQ 507-510: FPYS → EWFF 511-611: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 7 (identifier: Q6H8Q1-7) The sequence of this isoform differs from the canonical sequence as follows: 390-441: Missing. | ||||||
| Isoform 8 (identifier: Q6H8Q1-8) The sequence of this isoform differs from the canonical sequence as follows: 390-441: Missing. 459-459: K → KQ 506-545: RFPYSKSDPLPGHGKNGLDQRNANLAPCGADPDASWGMRE → Q | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||||||||||||||||||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 611 | 611 | Actin-binding LIM protein 2 | PRO_0000075699 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
Regions | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 22 – 81 | 60 | LIM zinc-binding 1 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 81 – 141 | 61 | LIM zinc-binding 2 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 151 – 210 | 60 | LIM zinc-binding 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 210 – 270 | 61 | LIM zinc-binding 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 543 – 611 | 69 | HP | |||||||||||||||||||||||||||||||||||||||||||||||||||||
Sites | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 83 | 1 | Zinc 1 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 86 | 1 | Zinc 1 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 103 | 1 | Zinc 1 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 106 | 1 | Zinc 1 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 109 | 1 | Zinc 2 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 112 | 1 | Zinc 2 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 131 | 1 | Zinc 2 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 134 | 1 | Zinc 2 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 212 | 1 | Zinc 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 215 | 1 | Zinc 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 232 | 1 | Zinc 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 235 | 1 | Zinc 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 238 | 1 | Zinc 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 241 | 1 | Zinc 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 260 | 1 | Zinc 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 263 | 1 | Zinc 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
Amino acid modifications | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 289 | 1 | Phosphoserine By similarity | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 294 | 1 | Phosphoserine By similarity | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 296 | 1 | Phosphoserine By similarity | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 476 | 1 | Phosphoserine By similarity | |||||||||||||||||||||||||||||||||||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 243 | 243 | Missing in isoform 4. | VSP_012112 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 349 | 1 | E → ESPQLLSPTPTE in isoform 3, isoform 4 and isoform 6. | VSP_012113 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 389 – 422 | 34 | Missing in isoform 4. | VSP_012114 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 390 – 441 | 52 | Missing in isoform 3, isoform 6, isoform 7 and isoform 8. | VSP_012115 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 459 | 1 | K → KQ in isoform 4, isoform 5, isoform 6 and isoform 8. | VSP_012116 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 506 – 545 | 40 | RFPYS…WGMRE → Q in isoform 2, isoform 3, isoform 5 and isoform 8. | VSP_012117 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 507 – 510 | 4 | FPYS → EWFF in isoform 6. | VSP_012118 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 511 – 611 | 101 | Missing in isoform 6. | VSP_012119 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 227 | 1 | G → R in a pancreatic ductal adenocarcinoma sample; somatic mutation. Ref.9 | VAR_062665 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 274 | 1 | K → M in a pancreatic ductal adenocarcinoma sample; somatic mutation. Ref.9 | VAR_062666 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
Experimental info | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 240 | 1 | R → G in BAC04414. Ref.3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 312 | 1 | D → G in BAC04414. Ref.3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 75 – 77 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 84 – 86 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 95 – 97 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 100 – 102 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 104 – 106 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 110 – 112 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 118 – 120 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 122 – 125 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 128 – 131 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 132 – 135 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 213 – 215 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 233 – 235 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 239 – 241 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 252 – 254 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 257 – 259 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 263 – 266 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 268 – 271 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 551 – 554 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 556 – 558 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 559 – 561 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 570 – 572 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 573 – 576 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 579 – 586 | 8 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 590 – 595 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 598 – 607 | 10 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Two novel members of the ABLIM protein family, ABLIM-2 and -3, associate with STARS and directly bind F-actin." Barrientos T., Frank D., Kuwahara K., Bezprozvannaya S., Pipes G.C.T., Bassel-Duby R., Richardson J.A., Katus H.A., Olson E.N., Frey N. J. Biol. Chem. 282:8393-8403(2007) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 7), FUNCTION, TISSUE SPECIFICITY, INTERACTION WITH ABRA AND F-ACTIN. Tissue: Heart. |
| [2] | "Structure and transcriptional activity of the ABLIM2 gene of human, mouse and rat." Klimov E.A., Rakhmanaliev E.R., Rudco O.I. Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2). |
| [3] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3 AND 4). Tissue: Brain. |
| [4] | "Generation and annotation of the DNA sequences of human chromosomes 2 and 4." Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H. Wilson R.K.Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 6 AND 8). Tissue: PNS. |
| [6] | "Prediction of the coding sequences of unidentified human genes. XX. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro." Nagase T., Nakayama M., Nakajima D., Kikuno R., Ohara O. DNA Res. 8:85-95(2001) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 34-611 (ISOFORM 2). Tissue: Brain. |
| [7] | "The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 390-572 (ISOFORM 5). Tissue: Amygdala. |
| [8] | "Solution structure of the LIM domain of the human actin binding LIM protein 2." RIKEN structural genomics initiative (RSGI) Submitted (FEB-2009) to the PDB data bank Cited for: STRUCTURE BY NMR OF 73-140 AND 212-271, ZINC-BINDING SITES. |
| [9] | "Core signaling pathways in human pancreatic cancers revealed by global genomic analyses." Jones S., Zhang X., Parsons D.W., Lin J.C., Leary R.J., Angenendt P., Mankoo P., Carter H., Kamiyama H., Jimeno A., Hong S.M., Fu B., Lin M.T., Calhoun E.S., Kamiyama M., Walter K., Nikolskaya T., Nikolsky Y. Kinzler K.W.Science 321:1801-1806(2008) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS [LARGE SCALE ANALYSIS] ARG-227 AND MET-274. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | DQ413177 mRNA. Translation: ABD83330.1. AJ748600 mRNA. Translation: CAG38375.1. AJ748601 mRNA. Translation: CAG38376.1. AK094754 mRNA. Translation: BAC04414.1. AK094798 mRNA. Translation: BAC04427.1. AC097381 Genomic DNA. No translation available. AC104650 Genomic DNA. No translation available. AC114807 Genomic DNA. No translation available. BC067214 mRNA. Translation: AAH67214.1. Different initiation. BC122567 mRNA. Translation: AAI22568.1. AB058711 mRNA. Translation: BAB47437.1. AL834195 mRNA. Translation: CAD38885.2. | ||||||||||||||||||||||||
| IPI | IPI00167702. IPI00187164. IPI00434484. IPI00479275. IPI00761095. IPI00892702. IPI00902561. IPI00910569. | ||||||||||||||||||||||||
| RefSeq | NP_001123555.1. NM_001130083.1. NP_001123556.1. NM_001130084.1. NP_001123557.1. NM_001130085.1. NP_001123558.1. NM_001130086.1. NP_001123559.1. NM_001130087.1. NP_001123560.1. NM_001130088.1. NP_115808.3. NM_032432.4. | ||||||||||||||||||||||||
| UniGene | Hs.233404. | ||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||
| ProteinModelPortal | Q6H8Q1. | ||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||
| IntAct | Q6H8Q1. 3 interactions. | ||||||||||||||||||||||||
| STRING | 9606.ENSP00000393511. | ||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||
| PhosphoSite | Q6H8Q1. | ||||||||||||||||||||||||
Polymorphism databases | |||||||||||||||||||||||||
| DMDM | 56404514. | ||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||
| PaxDb | Q6H8Q1. | ||||||||||||||||||||||||
| PRIDE | Q6H8Q1. | ||||||||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||
| Ensembl | ENST00000318888; ENSP00000317020; ENSG00000163995. ENST00000341937; ENSP00000342813; ENSG00000163995. ENST00000361581; ENSP00000355003; ENSG00000163995. ENST00000361737; ENSP00000354887; ENSG00000163995. ENST00000407564; ENSP00000384658; ENSG00000163995. ENST00000428004; ENSP00000389410; ENSG00000163995. ENST00000505872; ENSP00000421283; ENSG00000163995. ENST00000514025; ENSP00000423661; ENSG00000163995. | ||||||||||||||||||||||||
| GeneID | 84448. | ||||||||||||||||||||||||
| KEGG | hsa:84448. | ||||||||||||||||||||||||
| UCSC | uc003gkl.3. human. uc003gko.3. human. uc003gkp.3. human. uc003gkq.3. human. uc003gks.3. human. | ||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||
| CTD | 84448. | ||||||||||||||||||||||||
| GeneCards | GC04M007967. | ||||||||||||||||||||||||
| HGNC | HGNC:19195. ABLIM2. | ||||||||||||||||||||||||
| HPA | HPA035808. | ||||||||||||||||||||||||
| MIM | 612544. gene. | ||||||||||||||||||||||||
| neXtProt | NX_Q6H8Q1. | ||||||||||||||||||||||||
| PharmGKB | PA134940437. | ||||||||||||||||||||||||
| HUGE | Search... | ||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||
| eggNOG | NOG302299. | ||||||||||||||||||||||||
| HOGENOM | HOG000285997. | ||||||||||||||||||||||||
| HOVERGEN | HBG031499. | ||||||||||||||||||||||||
| KO | K07520. | ||||||||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||||||||
| Reactome | REACT_111045. Developmental Biology. | ||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||
| ArrayExpress | Q6H8Q1. | ||||||||||||||||||||||||
| Bgee | Q6H8Q1. | ||||||||||||||||||||||||
| CleanEx | HS_ABLIM2. | ||||||||||||||||||||||||
| Genevestigator | Q6H8Q1. | ||||||||||||||||||||||||
| GermOnline | ENSG00000163995. Homo sapiens. | ||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||
| Gene3D | 1.10.950.10. 1 hit. 2.10.110.10. 4 hits. | ||||||||||||||||||||||||
| InterPro | IPR003128. Villin_headpiece. IPR001781. Znf_LIM. [Graphical view] | ||||||||||||||||||||||||
| Pfam | PF00412. LIM. 4 hits. PF02209. VHP. 1 hit. [Graphical view] | ||||||||||||||||||||||||
| SMART | SM00132. LIM. 4 hits. SM00153. VHP. 1 hit. [Graphical view] | ||||||||||||||||||||||||
| SUPFAM | SSF47050. VHP. 1 hit. | ||||||||||||||||||||||||
| PROSITE | PS51089. HP. 1 hit. PS00478. LIM_DOMAIN_1. 4 hits. PS50023. LIM_DOMAIN_2. 4 hits. [Graphical view] | ||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||
Other | |||||||||||||||||||||||||
| EvolutionaryTrace | Q6H8Q1. | ||||||||||||||||||||||||
| GenomeRNAi | 84448. | ||||||||||||||||||||||||
| NextBio | 74223. | ||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||
Entry information
| Entry name | ABLM2_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q6H8Q1 Secondary accession number(s): Q08E71 Q96JL7 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 4 Human chromosome 4: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
