SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q6GYQ0

- RGPA1_HUMAN

UniProt

Q6GYQ0 - RGPA1_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Ral GTPase-activating protein subunit alpha-1
Gene
RALGAPA1, GARNL1, KIAA0884, TULIP1
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Catalytic subunit of the heterodimeric RalGAP1 complex which acts as a GTPase activator for the Ras-like small GTPases RALA and RALB By similarity.

GO - Molecular functioni

  1. Ral GTPase activator activity Source: UniProtKB
  2. protein heterodimerization activity Source: UniProtKB

GO - Biological processi

  1. activation of Ral GTPase activity Source: UniProtKB
  2. regulation of transcription, DNA-templated Source: Ensembl
Complete GO annotation...

Keywords - Molecular functioni

GTPase activation

Names & Taxonomyi

Protein namesi
Recommended name:
Ral GTPase-activating protein subunit alpha-1
Alternative name(s):
GAP-related-interacting partner to E12
Short name:
GRIPE
GTPase-activating Rap/Ran-GAP domain-like 1
Tuberin-like protein 1
p240
Gene namesi
Synonyms:GARNL1, KIAA0884, TULIP1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 14

Organism-specific databases

HGNCiHGNC:17770. RALGAPA1.

Subcellular locationi

Cytoplasm By similarity. Nucleus By similarity
Note: Translocated to the nucleus, when associated with TCF3/E12 By similarity.

GO - Cellular componenti

  1. cytoplasm Source: UniProtKB
  2. nucleus Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi1903 – 19031N → K: Has no effect on interaction with RALGAPB but causes loss of activity. 1 Publication

Organism-specific databases

PharmGKBiPA165479278.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 20362036Ral GTPase-activating protein subunit alpha-1
PRO_0000056753Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei754 – 7541Phosphothreonine2 Publications
Modified residuei773 – 7731Phosphoserine2 Publications
Modified residuei778 – 7781Phosphothreonine1 Publication
Modified residuei797 – 7971Phosphoserine1 Publication
Modified residuei860 – 8601Phosphoserine1 Publication
Modified residuei861 – 8611Phosphoserine1 Publication
Modified residuei864 – 8641Phosphoserine1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ6GYQ0.
PaxDbiQ6GYQ0.
PRIDEiQ6GYQ0.

PTM databases

PhosphoSiteiQ6GYQ0.

Expressioni

Tissue specificityi

Widely expressed.1 Publication

Gene expression databases

ArrayExpressiQ6GYQ0.
BgeeiQ6GYQ0.
CleanExiHS_GARNL1.
GenevestigatoriQ6GYQ0.

Organism-specific databases

HPAiHPA000851.

Interactioni

Subunit structurei

Component of the heterodimeric RalGAP1 complex with RALGAPB. Heterodimerization is required for activity. Interacts with the HLH region of TCF3/isoform E12 By similarity.

Protein-protein interaction databases

BioGridi128998. 5 interactions.
IntActiQ6GYQ0. 3 interactions.
STRINGi9606.ENSP00000302647.

Structurei

3D structure databases

ProteinModelPortaliQ6GYQ0.
SMRiQ6GYQ0. Positions 1791-1956.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini1796 – 2004209Rap-GAP
Add
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni1327 – 2035709Minimal domain that binds to TCF3/E12 By similarity
Add
BLAST

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili1716 – 174429 Reviewed prediction
Add
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi379 – 3824Poly-Ser

Sequence similaritiesi

Contains 1 Rap-GAP domain.

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiNOG250663.
HOVERGENiHBG051842.
OMAiQVFDYLC.
OrthoDBiEOG7N63KR.
PhylomeDBiQ6GYQ0.
TreeFamiTF324484.

Family and domain databases

InterProiIPR016024. ARM-type_fold.
IPR000331. Rap_GAP_dom.
[Graphical view]
PfamiPF02145. Rap_GAP. 1 hit.
[Graphical view]
SUPFAMiSSF48371. SSF48371. 1 hit.
PROSITEiPS50085. RAPGAP. 1 hit.
[Graphical view]

Sequences (7)i

Sequence statusi: Complete.

This entry describes 7 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q6GYQ0-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MFSKKPHGDV KKSTQKVLDT KKDALTRLKH LRIVIENAES IDLKQFFDQH     50
FSHIYYVFFE NFVTIEASLK QKGHKSQREE LDAILFIFEK ILQLLPERIH 100
QRWQFHSIGL ILKKLLHTGN SLKIRREGVR LFLLWLQALQ NNCSKEQLWM 150
FSCLIPGFSA PQSEHGPRTL DNLINPPLNL QETQVTIEEI TPLVPPQSGD 200
KGQEDLTSYF LEALLKYIVI QVKSLEWKNK ENQERGFSFL FSHFKKYYLP 250
YIFPNICKEN SLYHPILDIP QMRPKPHYVV IKKDAETNEA IYCTKEPFIK 300
ARVIVIRWLV SFWLEPKPHT GPHIPGMEGE VLPKNIQRAA ASLVSREESK 350
NDNADKTDRT TEPEQSHSNT STLTEREPSS SSLCSIDEEH LTDIEIVRRV 400
FSSKRSNVNF VTEIFRQAFL LPICEAAAMR KVVKVYQEWI QQEEKPLFMQ 450
EPEEIVITSS DLPCIENVTD HDISMEEGEK REEENGTNTA DHVRNSSWAK 500
NGSYQGALHN ASEEATEQNI RAGTQAVLQV FIINSSNIFL LEPANEIKNL 550
LDEHTDMCKR ILNIYRYMVV QVSMDKKTWE QMLLVLLRVT ESVLKMPSQA 600
FLQFQGKKNM TLAGRLAGPL FQTLIVAWIK ANLNVYISRE LWDDLLSVLS 650
SLTYWEELAT EWSLTMETLT KVLARNLYSL DLSDLPLDKL SEQKQKKHKG 700
KGVGHEFQKV SVDKSFSRGW SRDQPGQAPM RQRSATTTGS PGTEKARSIV 750
RQKTVDIDDA QILPRSTRVR HFSQSEETGN EVFGALNEEQ PLPRSSSTSD 800
ILEPFTVERA KVNKEDMSQK LPPLNSDIGG SSANVPDLMD EFIAERLRSG 850
NASTMTRRGS SPGSLEIPKD LPDILNKQNQ MRPIDDPGVP SEWTSPASAG 900
SSDLISSDSH SDSFSAFQYD GRKFDNFGFG TDTGVTSSAD VDSGSGHHQS 950
AEEQEVASLT TLHIDSETSS LNQQAFSAEV ATITGSESAS PVHSPLGSRS 1000
QTPSPSTLNI DHMEQKDLQL DEKLHHSVLQ TPDDLEISEF PSECCSVMAG 1050
GTLTGWHADV ATVMWRRMLG ILGDVNSIMD PEIHAQVFDY LCELWQNLAK 1100
IRDNLGISTD NLTSPSPPVL IPPLRILTPW LFKATMLTDK YKQGKLHAYK 1150
LICNTMKRRQ DVSPNRDFLT HFYNIMHCGL LHIDQDIVNT IIKHCSPQFF 1200
SLGLPGATML IMDFIVAAGR VASSAFLNAP RVEAQVLLGS LVCFPNLYCE 1250
LPSLHPNIPD VAVSQFTDVK ELIIKTVLSS ARDEPSGPAR CVALCSLGIW 1300
ICEELVHESH HPQIKEALNV ICVSLKFTNK TVAHVACNML HMLVHYVPRL 1350
QIYQPDSPLK IIQILIATIT HLLPSTEASS YEMDKRLVVS LLLCLLDWIM 1400
ALPLKTLLQP FHATGAESDK TEKSVLNCIY KVLHGCVYGA QCFSNPRYFP 1450
MSLSDLASVD YDPFMHLESL KEPEPLHSPD SERSSKLQPV TEVKTQMQHG 1500
LISIAARTVI THLVNHLGHY PMSGGPAMLT SQVCENHDNH YSESTELSPE 1550
LFESPNIQFF VLNNTTLVSC IQIRSEENMP GGGLSAGLAS ANSNVRIIVR 1600
DLSGKYSWDS AILYGPPPVS GLSEPTSFML SLSHQEKPEE PPTSNECLED 1650
ITVKDGLSLQ FKRFRETVPT WDTIRDEEDV LDELLQYLGV TSPECLQRTG 1700
ISLNIPAPQP VCISEKQEND VINAILKQHT EEKEFVEKHF NDLNMKAVEQ 1750
DEPIPQKPQS AFYYCRLLLS ILGMNSWDKR RSFHLLKKNE KLLRELRNLD 1800
SRQCRETHKI AVFYVAEGQE DKHSILTNTG GSQAYEDFVA GLGWEVNLTN 1850
HCGFMGGLQK NKSTGLTTPY FATSTVEVIF HVSTRMPSDS DDSLTKKLRH 1900
LGNDEVHIVW SEHTRDYRRG IIPTEFGDVL IVIYPMKNHM FSIQIMKKPE 1950
VPFFGPLFDG AIVNGKVLPI MVRATAINAS RALKSLIPLY QNFYEERARY 2000
LQTIVQHHLE PTTFEDFAAQ VFSPAPYHHL PSDADH 2036
Length:2,036
Mass (Da):229,832
Last modified:July 19, 2004 - v1
Checksum:i7ADF5487908C14CB
GO
Isoform 2 (identifier: Q6GYQ0-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     2035-2036: DH → GSYPEILPSETPTATQVDGADLASPMSPRTSKSRMSMKLRRSSGSANKS

Show »
Length:2,083
Mass (Da):234,731
Checksum:i0396D985F73CACD8
GO
Isoform 3 (identifier: Q6GYQ0-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     755-755: V → VAMRSRSIGECALPSAYIRSAKSAPVLIHTSKPFLPDIVLTPLSDELS
     1036-1057: EISEFPSECCSVMAGGTLTGWH → GNISKLDIYLFSFRASVSGDHK
     1058-2036: Missing.

Note: No experimental confirmation available.

Show »
Length:1,104
Mass (Da):124,733
Checksum:iC473679777FB18DE
GO
Isoform 4 (identifier: Q6GYQ0-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1898-2036: LRHLGNDEVH...YHHLPSDADH → MESHCVAQAG...RDGVSPCWPG

Note: No experimental confirmation available.

Show »
Length:1,961
Mass (Da):221,099
Checksum:i914BB0FC44C23584
GO
Isoform 5 (identifier: Q6GYQ0-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     2035-2036: DH → VERNAVIVLFLPKPPLENIGHLKAPTQRFYPVKLPQQRR

Note: No experimental confirmation available.

Show »
Length:2,073
Mass (Da):234,126
Checksum:i693F3F3BC1FB7162
GO
Isoform 6 (identifier: Q6GYQ0-6) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     755-755: V → VAMRSRSIGECALPSAYIRSAKSAPVLIHTSKPFLPDIVLTPLSDELS

Show »
Length:2,083
Mass (Da):234,854
Checksum:i43E1FEB75F774B33
GO
Isoform 7 (identifier: Q6GYQ0-7) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     812-825: VNKEDMSQKLPPLN → EAEQNATRGSTEGSVQSCNGLFWKESC

Note: No experimental confirmation available.

Show »
Length:2,049
Mass (Da):231,138
Checksum:i3556F0AB7752E829
GO

Sequence cautioni

The sequence BAC86772.1 differs from that shown. Reason: Erroneous initiation.

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti931 – 9311T → A.1 Publication
Corresponds to variant rs2274068 [ dbSNP | Ensembl ].
VAR_019804

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei755 – 7551V → VAMRSRSIGECALPSAYIRS AKSAPVLIHTSKPFLPDIVL TPLSDELS in isoform 3 and isoform 6.
VSP_011324
Alternative sequencei812 – 82514VNKED…LPPLN → EAEQNATRGSTEGSVQSCNG LFWKESC in isoform 7.
VSP_054485Add
BLAST
Alternative sequencei1036 – 105722EISEF…LTGWH → GNISKLDIYLFSFRASVSGD HK in isoform 3.
VSP_011325Add
BLAST
Alternative sequencei1058 – 2036979Missing in isoform 3.
VSP_011326Add
BLAST
Alternative sequencei1898 – 2036139LRHLG…SDADH → MESHCVAQAGVQWHDLRSLQ LLPPRFKESSLLSLLSSWDY RCMPPHLSNFCIFSRDGVSP CWPG in isoform 4.
VSP_011327Add
BLAST
Alternative sequencei2035 – 20362DH → GSYPEILPSETPTATQVDGA DLASPMSPRTSKSRMSMKLR RSSGSANKS in isoform 2.
VSP_011328
Alternative sequencei2035 – 20362DH → VERNAVIVLFLPKPPLENIG HLKAPTQRFYPVKLPQQRR in isoform 5.
VSP_011329

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti779 – 7791G → A in BAA74907. 1 Publication
Sequence conflicti1270 – 12701K → N in CAD39026. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AY596970 mRNA. Translation: AAT49271.1.
AY596971 mRNA. Translation: AAT49272.1.
AB511280 mRNA. Translation: BAH83561.1.
AB020691 mRNA. Translation: BAA74907.1.
AL137818 Genomic DNA. No translation available.
AL160231 Genomic DNA. No translation available.
AL162311 Genomic DNA. No translation available.
BC042013 mRNA. Translation: AAH42013.1.
BC042045 mRNA. Translation: AAH42045.1.
BC150596 mRNA. Translation: AAI50597.1.
AL834362 mRNA. Translation: CAD39026.1.
AK126975 mRNA. Translation: BAC86772.1. Different initiation.
CCDSiCCDS32064.1. [Q6GYQ0-2]
CCDS32065.1. [Q6GYQ0-1]
CCDS61439.1. [Q6GYQ0-7]
CCDS61440.1. [Q6GYQ0-6]
RefSeqiNP_001269972.1. NM_001283043.1. [Q6GYQ0-7]
NP_001269973.1. NM_001283044.1. [Q6GYQ0-6]
NP_055805.1. NM_014990.1. [Q6GYQ0-1]
NP_919277.2. NM_194301.2. [Q6GYQ0-2]
XP_006720166.1. XM_006720103.1. [Q6GYQ0-6]
UniGeneiHs.113150.

Genome annotation databases

EnsembliENST00000258840; ENSP00000258840; ENSG00000174373. [Q6GYQ0-6]
ENST00000307138; ENSP00000302647; ENSG00000174373. [Q6GYQ0-2]
ENST00000382366; ENSP00000371803; ENSG00000174373.
ENST00000389698; ENSP00000374348; ENSG00000174373. [Q6GYQ0-1]
ENST00000553892; ENSP00000451877; ENSG00000174373. [Q6GYQ0-6]
GeneIDi253959.
KEGGihsa:253959.
UCSCiuc001wti.3. human. [Q6GYQ0-1]
uc001wtj.3. human. [Q6GYQ0-2]
uc001wtk.1. human. [Q6GYQ0-3]
uc010tpw.1. human. [Q6GYQ0-6]

Polymorphism databases

DMDMi51315850.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AY596970 mRNA. Translation: AAT49271.1 .
AY596971 mRNA. Translation: AAT49272.1 .
AB511280 mRNA. Translation: BAH83561.1 .
AB020691 mRNA. Translation: BAA74907.1 .
AL137818 Genomic DNA. No translation available.
AL160231 Genomic DNA. No translation available.
AL162311 Genomic DNA. No translation available.
BC042013 mRNA. Translation: AAH42013.1 .
BC042045 mRNA. Translation: AAH42045.1 .
BC150596 mRNA. Translation: AAI50597.1 .
AL834362 mRNA. Translation: CAD39026.1 .
AK126975 mRNA. Translation: BAC86772.1 . Different initiation.
CCDSi CCDS32064.1. [Q6GYQ0-2 ]
CCDS32065.1. [Q6GYQ0-1 ]
CCDS61439.1. [Q6GYQ0-7 ]
CCDS61440.1. [Q6GYQ0-6 ]
RefSeqi NP_001269972.1. NM_001283043.1. [Q6GYQ0-7 ]
NP_001269973.1. NM_001283044.1. [Q6GYQ0-6 ]
NP_055805.1. NM_014990.1. [Q6GYQ0-1 ]
NP_919277.2. NM_194301.2. [Q6GYQ0-2 ]
XP_006720166.1. XM_006720103.1. [Q6GYQ0-6 ]
UniGenei Hs.113150.

3D structure databases

ProteinModelPortali Q6GYQ0.
SMRi Q6GYQ0. Positions 1791-1956.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 128998. 5 interactions.
IntActi Q6GYQ0. 3 interactions.
STRINGi 9606.ENSP00000302647.

PTM databases

PhosphoSitei Q6GYQ0.

Polymorphism databases

DMDMi 51315850.

Proteomic databases

MaxQBi Q6GYQ0.
PaxDbi Q6GYQ0.
PRIDEi Q6GYQ0.

Protocols and materials databases

DNASUi 253959.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000258840 ; ENSP00000258840 ; ENSG00000174373 . [Q6GYQ0-6 ]
ENST00000307138 ; ENSP00000302647 ; ENSG00000174373 . [Q6GYQ0-2 ]
ENST00000382366 ; ENSP00000371803 ; ENSG00000174373 .
ENST00000389698 ; ENSP00000374348 ; ENSG00000174373 . [Q6GYQ0-1 ]
ENST00000553892 ; ENSP00000451877 ; ENSG00000174373 . [Q6GYQ0-6 ]
GeneIDi 253959.
KEGGi hsa:253959.
UCSCi uc001wti.3. human. [Q6GYQ0-1 ]
uc001wtj.3. human. [Q6GYQ0-2 ]
uc001wtk.1. human. [Q6GYQ0-3 ]
uc010tpw.1. human. [Q6GYQ0-6 ]

Organism-specific databases

CTDi 253959.
GeneCardsi GC14M036008.
H-InvDB HIX0131236.
HGNCi HGNC:17770. RALGAPA1.
HPAi HPA000851.
MIMi 608884. gene.
neXtProti NX_Q6GYQ0.
PharmGKBi PA165479278.
HUGEi Search...
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG250663.
HOVERGENi HBG051842.
OMAi QVFDYLC.
OrthoDBi EOG7N63KR.
PhylomeDBi Q6GYQ0.
TreeFami TF324484.

Miscellaneous databases

ChiTaRSi RALGAPA1. human.
GeneWikii GARNL1.
GenomeRNAii 253959.
NextBioi 35482065.
PROi Q6GYQ0.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q6GYQ0.
Bgeei Q6GYQ0.
CleanExi HS_GARNL1.
Genevestigatori Q6GYQ0.

Family and domain databases

InterProi IPR016024. ARM-type_fold.
IPR000331. Rap_GAP_dom.
[Graphical view ]
Pfami PF02145. Rap_GAP. 1 hit.
[Graphical view ]
SUPFAMi SSF48371. SSF48371. 1 hit.
PROSITEi PS50085. RAPGAP. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Cloning, genomic structure and expression profile of TULIP1 (GARNL1), a brain-expressed candidate gene for 14q13-linked neurological phenotypes and its murine homolog."
    Schwarzbraun T., Vincent J.B., Schumacher A., Geschwind D.H., Oliveira J., Windpassinger C., Ofner L., Ledinegg M.K., Kroisel P.M., Wagner K., Petek E.
    Genomics 84:577-586(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), TISSUE SPECIFICITY.
  2. "Tuberous sclerosis tumor suppressor complex-like complexes act as GTPase-activating proteins for Ral GTPases."
    Shirakawa R., Fukai S., Kawato M., Higashi T., Kondo H., Ikeda T., Nakayama E., Okawa K., Nureki O., Kimura T., Kita T., Horiuchi H.
    J. Biol. Chem. 284:21580-21588(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 6), VARIANT ALA-931, MUTAGENESIS OF ASN-1903.
  3. "Prediction of the coding sequences of unidentified human genes. XII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
    Nagase T., Ishikawa K., Suyama M., Kikuno R., Hirosawa M., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O.
    DNA Res. 5:355-364(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
    Tissue: Brain.
  4. "The DNA sequence and analysis of human chromosome 14."
    Heilig R., Eckenberg R., Petit J.-L., Fonknechten N., Da Silva C., Cattolico L., Levy M., Barbe V., De Berardinis V., Ureta-Vidal A., Pelletier E., Vico V., Anthouard V., Rowen L., Madan A., Qin S., Sun H., Du H.
    , Pepin K., Artiguenave F., Robert C., Cruaud C., Bruels T., Jaillon O., Friedlander L., Samson G., Brottier P., Cure S., Segurens B., Aniere F., Samain S., Crespeau H., Abbasi N., Aiach N., Boscus D., Dickhoff R., Dors M., Dubois I., Friedman C., Gouyvenoux M., James R., Madan A., Mairey-Estrada B., Mangenot S., Martins N., Menard M., Oztas S., Ratcliffe A., Shaffer T., Trask B., Vacherie B., Bellemere C., Belser C., Besnard-Gonnet M., Bartol-Mavel D., Boutard M., Briez-Silla S., Combette S., Dufosse-Laurent V., Ferron C., Lechaplais C., Louesse C., Muselet D., Magdelenat G., Pateau E., Petit E., Sirvain-Trukniewicz P., Trybou A., Vega-Czarny N., Bataille E., Bluet E., Bordelais I., Dubois M., Dumont C., Guerin T., Haffray S., Hammadi R., Muanga J., Pellouin V., Robert D., Wunderle E., Gauguet G., Roy A., Sainte-Marthe L., Verdier J., Verdier-Discala C., Hillier L.W., Fulton L., McPherson J., Matsuda F., Wilson R., Scarpelli C., Gyapay G., Wincker P., Saurin W., Quetier F., Waterston R., Hood L., Weissenbach J.
    Nature 421:601-607(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 7), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1147-2036 (ISOFORM 1), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1719-2036 (ISOFORM 5).
    Tissue: Brain and Skin.
  6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1167-2036 (ISOFORM 4).
    Tissue: Lymph node.
  7. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1361-2036 (ISOFORM 2).
    Tissue: Brain.
  8. "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks."
    Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M.
    Cell 127:635-648(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  9. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Embryonic kidney.
  10. "Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis."
    Cantin G.T., Yi W., Lu B., Park S.K., Xu T., Lee J.-D., Yates J.R. III
    J. Proteome Res. 7:1346-1351(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-778, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  11. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-773, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  12. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
    Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
    Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-797, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Leukemic T-cell.
  13. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
    Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
    Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-754 AND SER-773, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  14. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
    Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
    Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-754; SER-860; SER-861 AND SER-864, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

Entry informationi

Entry nameiRGPA1_HUMAN
AccessioniPrimary (citable) accession number: Q6GYQ0
Secondary accession number(s): A6NMA4
, B9EK38, C5NU19, O94960, Q6GYP9, Q6ZT23, Q86YF3, Q86YF5, Q8ND69
Entry historyi
Integrated into UniProtKB/Swiss-Prot: August 16, 2004
Last sequence update: July 19, 2004
Last modified: September 3, 2014
This is version 100 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 14
    Human chromosome 14: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi