Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q6GYQ0 (RGPA1_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 99. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (5) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Ral GTPase-activating protein subunit alpha-1
Alternative name(s):
GAP-related-interacting partner to E12
Short name=GRIPE
GTPase-activating Rap/Ran-GAP domain-like 1
Tuberin-like protein 1
p240
Gene names
Name:RALGAPA1
Synonyms:GARNL1, KIAA0884, TULIP1
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length2036 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Catalytic subunit of the heterodimeric RalGAP1 complex which acts as a GTPase activator for the Ras-like small GTPases RALA and RALB By similarity.

Subunit structure

Component of the heterodimeric RalGAP1 complex with RALGAPB. Heterodimerization is required for activity. Interacts with the HLH region of TCF3/isoform E12 By similarity.

Subcellular location

Cytoplasm By similarity. Nucleus By similarity. Note: Translocated to the nucleus, when associated with TCF3/E12 By similarity.

Tissue specificity

Widely expressed. Ref.1

Sequence similarities

Contains 1 Rap-GAP domain.

Sequence caution

The sequence BAC86772.1 differs from that shown. Reason: Erroneous initiation.

Alternative products

This entry describes 7 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q6GYQ0-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q6GYQ0-2)

The sequence of this isoform differs from the canonical sequence as follows:
     2035-2036: DH → GSYPEILPSETPTATQVDGADLASPMSPRTSKSRMSMKLRRSSGSANKS
Isoform 3 (identifier: Q6GYQ0-3)

The sequence of this isoform differs from the canonical sequence as follows:
     755-755: V → VAMRSRSIGECALPSAYIRSAKSAPVLIHTSKPFLPDIVLTPLSDELS
     1036-1057: EISEFPSECCSVMAGGTLTGWH → GNISKLDIYLFSFRASVSGDHK
     1058-2036: Missing.
Note: No experimental confirmation available.
Isoform 4 (identifier: Q6GYQ0-4)

The sequence of this isoform differs from the canonical sequence as follows:
     1898-2036: LRHLGNDEVH...YHHLPSDADH → MESHCVAQAG...RDGVSPCWPG
Note: No experimental confirmation available.
Isoform 5 (identifier: Q6GYQ0-5)

The sequence of this isoform differs from the canonical sequence as follows:
     2035-2036: DH → VERNAVIVLFLPKPPLENIGHLKAPTQRFYPVKLPQQRR
Note: No experimental confirmation available.
Isoform 6 (identifier: Q6GYQ0-6)

The sequence of this isoform differs from the canonical sequence as follows:
     755-755: V → VAMRSRSIGECALPSAYIRSAKSAPVLIHTSKPFLPDIVLTPLSDELS
Isoform 7 (identifier: Q6GYQ0-7)

The sequence of this isoform differs from the canonical sequence as follows:
     812-825: VNKEDMSQKLPPLN → EAEQNATRGSTEGSVQSCNGLFWKESC
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 20362036Ral GTPase-activating protein subunit alpha-1
PRO_0000056753

Regions

Domain1796 – 2004209Rap-GAP
Region1327 – 2035709Minimal domain that binds to TCF3/E12 By similarity
Coiled coil1716 – 174429 Potential
Compositional bias379 – 3824Poly-Ser

Amino acid modifications

Modified residue7541Phosphothreonine Ref.13 Ref.14
Modified residue7731Phosphoserine Ref.11 Ref.13
Modified residue7781Phosphothreonine Ref.10
Modified residue7971Phosphoserine Ref.12
Modified residue8601Phosphoserine Ref.14
Modified residue8611Phosphoserine Ref.14
Modified residue8641Phosphoserine Ref.14

Natural variations

Alternative sequence7551V → VAMRSRSIGECALPSAYIRS AKSAPVLIHTSKPFLPDIVL TPLSDELS in isoform 3 and isoform 6.
VSP_011324
Alternative sequence812 – 82514VNKED…LPPLN → EAEQNATRGSTEGSVQSCNG LFWKESC in isoform 7.
VSP_054485
Alternative sequence1036 – 105722EISEF…LTGWH → GNISKLDIYLFSFRASVSGD HK in isoform 3.
VSP_011325
Alternative sequence1058 – 2036979Missing in isoform 3.
VSP_011326
Alternative sequence1898 – 2036139LRHLG…SDADH → MESHCVAQAGVQWHDLRSLQ LLPPRFKESSLLSLLSSWDY RCMPPHLSNFCIFSRDGVSP CWPG in isoform 4.
VSP_011327
Alternative sequence2035 – 20362DH → GSYPEILPSETPTATQVDGA DLASPMSPRTSKSRMSMKLR RSSGSANKS in isoform 2.
VSP_011328
Alternative sequence2035 – 20362DH → VERNAVIVLFLPKPPLENIG HLKAPTQRFYPVKLPQQRR in isoform 5.
VSP_011329
Natural variant9311T → A. Ref.2
Corresponds to variant rs2274068 [ dbSNP | Ensembl ].
VAR_019804

Experimental info

Mutagenesis19031N → K: Has no effect on interaction with RALGAPB but causes loss of activity. Ref.2
Sequence conflict7791G → A in BAA74907. Ref.3
Sequence conflict12701K → N in CAD39026. Ref.6

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified July 19, 2004. Version 1.
Checksum: 7ADF5487908C14CB

FASTA2,036229,832
        10         20         30         40         50         60 
MFSKKPHGDV KKSTQKVLDT KKDALTRLKH LRIVIENAES IDLKQFFDQH FSHIYYVFFE 

        70         80         90        100        110        120 
NFVTIEASLK QKGHKSQREE LDAILFIFEK ILQLLPERIH QRWQFHSIGL ILKKLLHTGN 

       130        140        150        160        170        180 
SLKIRREGVR LFLLWLQALQ NNCSKEQLWM FSCLIPGFSA PQSEHGPRTL DNLINPPLNL 

       190        200        210        220        230        240 
QETQVTIEEI TPLVPPQSGD KGQEDLTSYF LEALLKYIVI QVKSLEWKNK ENQERGFSFL 

       250        260        270        280        290        300 
FSHFKKYYLP YIFPNICKEN SLYHPILDIP QMRPKPHYVV IKKDAETNEA IYCTKEPFIK 

       310        320        330        340        350        360 
ARVIVIRWLV SFWLEPKPHT GPHIPGMEGE VLPKNIQRAA ASLVSREESK NDNADKTDRT 

       370        380        390        400        410        420 
TEPEQSHSNT STLTEREPSS SSLCSIDEEH LTDIEIVRRV FSSKRSNVNF VTEIFRQAFL 

       430        440        450        460        470        480 
LPICEAAAMR KVVKVYQEWI QQEEKPLFMQ EPEEIVITSS DLPCIENVTD HDISMEEGEK 

       490        500        510        520        530        540 
REEENGTNTA DHVRNSSWAK NGSYQGALHN ASEEATEQNI RAGTQAVLQV FIINSSNIFL 

       550        560        570        580        590        600 
LEPANEIKNL LDEHTDMCKR ILNIYRYMVV QVSMDKKTWE QMLLVLLRVT ESVLKMPSQA 

       610        620        630        640        650        660 
FLQFQGKKNM TLAGRLAGPL FQTLIVAWIK ANLNVYISRE LWDDLLSVLS SLTYWEELAT 

       670        680        690        700        710        720 
EWSLTMETLT KVLARNLYSL DLSDLPLDKL SEQKQKKHKG KGVGHEFQKV SVDKSFSRGW 

       730        740        750        760        770        780 
SRDQPGQAPM RQRSATTTGS PGTEKARSIV RQKTVDIDDA QILPRSTRVR HFSQSEETGN 

       790        800        810        820        830        840 
EVFGALNEEQ PLPRSSSTSD ILEPFTVERA KVNKEDMSQK LPPLNSDIGG SSANVPDLMD 

       850        860        870        880        890        900 
EFIAERLRSG NASTMTRRGS SPGSLEIPKD LPDILNKQNQ MRPIDDPGVP SEWTSPASAG 

       910        920        930        940        950        960 
SSDLISSDSH SDSFSAFQYD GRKFDNFGFG TDTGVTSSAD VDSGSGHHQS AEEQEVASLT 

       970        980        990       1000       1010       1020 
TLHIDSETSS LNQQAFSAEV ATITGSESAS PVHSPLGSRS QTPSPSTLNI DHMEQKDLQL 

      1030       1040       1050       1060       1070       1080 
DEKLHHSVLQ TPDDLEISEF PSECCSVMAG GTLTGWHADV ATVMWRRMLG ILGDVNSIMD 

      1090       1100       1110       1120       1130       1140 
PEIHAQVFDY LCELWQNLAK IRDNLGISTD NLTSPSPPVL IPPLRILTPW LFKATMLTDK 

      1150       1160       1170       1180       1190       1200 
YKQGKLHAYK LICNTMKRRQ DVSPNRDFLT HFYNIMHCGL LHIDQDIVNT IIKHCSPQFF 

      1210       1220       1230       1240       1250       1260 
SLGLPGATML IMDFIVAAGR VASSAFLNAP RVEAQVLLGS LVCFPNLYCE LPSLHPNIPD 

      1270       1280       1290       1300       1310       1320 
VAVSQFTDVK ELIIKTVLSS ARDEPSGPAR CVALCSLGIW ICEELVHESH HPQIKEALNV 

      1330       1340       1350       1360       1370       1380 
ICVSLKFTNK TVAHVACNML HMLVHYVPRL QIYQPDSPLK IIQILIATIT HLLPSTEASS 

      1390       1400       1410       1420       1430       1440 
YEMDKRLVVS LLLCLLDWIM ALPLKTLLQP FHATGAESDK TEKSVLNCIY KVLHGCVYGA 

      1450       1460       1470       1480       1490       1500 
QCFSNPRYFP MSLSDLASVD YDPFMHLESL KEPEPLHSPD SERSSKLQPV TEVKTQMQHG 

      1510       1520       1530       1540       1550       1560 
LISIAARTVI THLVNHLGHY PMSGGPAMLT SQVCENHDNH YSESTELSPE LFESPNIQFF 

      1570       1580       1590       1600       1610       1620 
VLNNTTLVSC IQIRSEENMP GGGLSAGLAS ANSNVRIIVR DLSGKYSWDS AILYGPPPVS 

      1630       1640       1650       1660       1670       1680 
GLSEPTSFML SLSHQEKPEE PPTSNECLED ITVKDGLSLQ FKRFRETVPT WDTIRDEEDV 

      1690       1700       1710       1720       1730       1740 
LDELLQYLGV TSPECLQRTG ISLNIPAPQP VCISEKQEND VINAILKQHT EEKEFVEKHF 

      1750       1760       1770       1780       1790       1800 
NDLNMKAVEQ DEPIPQKPQS AFYYCRLLLS ILGMNSWDKR RSFHLLKKNE KLLRELRNLD 

      1810       1820       1830       1840       1850       1860 
SRQCRETHKI AVFYVAEGQE DKHSILTNTG GSQAYEDFVA GLGWEVNLTN HCGFMGGLQK 

      1870       1880       1890       1900       1910       1920 
NKSTGLTTPY FATSTVEVIF HVSTRMPSDS DDSLTKKLRH LGNDEVHIVW SEHTRDYRRG 

      1930       1940       1950       1960       1970       1980 
IIPTEFGDVL IVIYPMKNHM FSIQIMKKPE VPFFGPLFDG AIVNGKVLPI MVRATAINAS 

      1990       2000       2010       2020       2030 
RALKSLIPLY QNFYEERARY LQTIVQHHLE PTTFEDFAAQ VFSPAPYHHL PSDADH 

« Hide

Isoform 2 [UniParc].

Checksum: 0396D985F73CACD8
Show »

FASTA2,083234,731
Isoform 3 [UniParc].

Checksum: C473679777FB18DE
Show »

FASTA1,104124,733
Isoform 4 [UniParc].

Checksum: 914BB0FC44C23584
Show »

FASTA1,961221,099
Isoform 5 [UniParc].

Checksum: 693F3F3BC1FB7162
Show »

FASTA2,073234,126
Isoform 6 [UniParc].

Checksum: 43E1FEB75F774B33
Show »

FASTA2,083234,854
Isoform 7 [UniParc].

Checksum: 3556F0AB7752E829
Show »

FASTA2,049231,138

References

« Hide 'large scale' references
[1]"Cloning, genomic structure and expression profile of TULIP1 (GARNL1), a brain-expressed candidate gene for 14q13-linked neurological phenotypes and its murine homolog."
Schwarzbraun T., Vincent J.B., Schumacher A., Geschwind D.H., Oliveira J., Windpassinger C., Ofner L., Ledinegg M.K., Kroisel P.M., Wagner K., Petek E.
Genomics 84:577-586(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), TISSUE SPECIFICITY.
[2]"Tuberous sclerosis tumor suppressor complex-like complexes act as GTPase-activating proteins for Ral GTPases."
Shirakawa R., Fukai S., Kawato M., Higashi T., Kondo H., Ikeda T., Nakayama E., Okawa K., Nureki O., Kimura T., Kita T., Horiuchi H.
J. Biol. Chem. 284:21580-21588(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 6), VARIANT ALA-931, MUTAGENESIS OF ASN-1903.
[3]"Prediction of the coding sequences of unidentified human genes. XII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
Nagase T., Ishikawa K., Suyama M., Kikuno R., Hirosawa M., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O.
DNA Res. 5:355-364(1998) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
Tissue: Brain.
[4]"The DNA sequence and analysis of human chromosome 14."
Heilig R., Eckenberg R., Petit J.-L., Fonknechten N., Da Silva C., Cattolico L., Levy M., Barbe V., De Berardinis V., Ureta-Vidal A., Pelletier E., Vico V., Anthouard V., Rowen L., Madan A., Qin S., Sun H., Du H. expand/collapse author list , Pepin K., Artiguenave F., Robert C., Cruaud C., Bruels T., Jaillon O., Friedlander L., Samson G., Brottier P., Cure S., Segurens B., Aniere F., Samain S., Crespeau H., Abbasi N., Aiach N., Boscus D., Dickhoff R., Dors M., Dubois I., Friedman C., Gouyvenoux M., James R., Madan A., Mairey-Estrada B., Mangenot S., Martins N., Menard M., Oztas S., Ratcliffe A., Shaffer T., Trask B., Vacherie B., Bellemere C., Belser C., Besnard-Gonnet M., Bartol-Mavel D., Boutard M., Briez-Silla S., Combette S., Dufosse-Laurent V., Ferron C., Lechaplais C., Louesse C., Muselet D., Magdelenat G., Pateau E., Petit E., Sirvain-Trukniewicz P., Trybou A., Vega-Czarny N., Bataille E., Bluet E., Bordelais I., Dubois M., Dumont C., Guerin T., Haffray S., Hammadi R., Muanga J., Pellouin V., Robert D., Wunderle E., Gauguet G., Roy A., Sainte-Marthe L., Verdier J., Verdier-Discala C., Hillier L.W., Fulton L., McPherson J., Matsuda F., Wilson R., Scarpelli C., Gyapay G., Wincker P., Saurin W., Quetier F., Waterston R., Hood L., Weissenbach J.
Nature 421:601-607(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[5]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 7), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1147-2036 (ISOFORM 1), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1719-2036 (ISOFORM 5).
Tissue: Brain and Skin.
[6]"The full-ORF clone resource of the German cDNA consortium."
Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I.
BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1167-2036 (ISOFORM 4).
Tissue: Lymph node.
[7]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1361-2036 (ISOFORM 2).
Tissue: Brain.
[8]"Global, in vivo, and site-specific phosphorylation dynamics in signaling networks."
Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M.
Cell 127:635-648(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.
[9]"ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage."
Matsuoka S., Ballif B.A., Smogorzewska A., McDonald E.R. III, Hurov K.E., Luo J., Bakalarski C.E., Zhao Z., Solimini N., Lerenthal Y., Shiloh Y., Gygi S.P., Elledge S.J.
Science 316:1160-1166(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Embryonic kidney.
[10]"Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis."
Cantin G.T., Yi W., Lu B., Park S.K., Xu T., Lee J.-D., Yates J.R. III
J. Proteome Res. 7:1346-1351(2008) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-778, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.
[11]"A quantitative atlas of mitotic phosphorylation."
Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P.
Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-773, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.
[12]"Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-797, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Leukemic T-cell.
[13]"Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-754 AND SER-773, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.
[14]"System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-754; SER-860; SER-861 AND SER-864, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AY596970 mRNA. Translation: AAT49271.1.
AY596971 mRNA. Translation: AAT49272.1.
AB511280 mRNA. Translation: BAH83561.1.
AB020691 mRNA. Translation: BAA74907.1.
AL137818 Genomic DNA. No translation available.
AL160231 Genomic DNA. No translation available.
AL162311 Genomic DNA. No translation available.
BC042013 mRNA. Translation: AAH42013.1.
BC042045 mRNA. Translation: AAH42045.1.
BC150596 mRNA. Translation: AAI50597.1.
AL834362 mRNA. Translation: CAD39026.1.
AK126975 mRNA. Translation: BAC86772.1. Different initiation.
CCDSCCDS32064.1. [Q6GYQ0-2]
CCDS32065.1. [Q6GYQ0-1]
CCDS61440.1. [Q6GYQ0-6]
RefSeqNP_001269972.1. NM_001283043.1. [Q6GYQ0-7]
NP_001269973.1. NM_001283044.1. [Q6GYQ0-6]
NP_055805.1. NM_014990.1. [Q6GYQ0-1]
NP_919277.2. NM_194301.2. [Q6GYQ0-2]
XP_006720166.1. XM_006720103.1. [Q6GYQ0-6]
UniGeneHs.113150.

3D structure databases

ProteinModelPortalQ6GYQ0.
SMRQ6GYQ0. Positions 1791-1956.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid128998. 5 interactions.
IntActQ6GYQ0. 2 interactions.
STRING9606.ENSP00000302647.

PTM databases

PhosphoSiteQ6GYQ0.

Polymorphism databases

DMDM51315850.

Proteomic databases

MaxQBQ6GYQ0.
PaxDbQ6GYQ0.
PRIDEQ6GYQ0.

Protocols and materials databases

DNASU253959.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000258840; ENSP00000258840; ENSG00000174373. [Q6GYQ0-6]
ENST00000307138; ENSP00000302647; ENSG00000174373. [Q6GYQ0-2]
ENST00000382366; ENSP00000371803; ENSG00000174373.
ENST00000389698; ENSP00000374348; ENSG00000174373. [Q6GYQ0-1]
ENST00000553892; ENSP00000451877; ENSG00000174373. [Q6GYQ0-6]
GeneID253959.
KEGGhsa:253959.
UCSCuc001wti.3. human. [Q6GYQ0-1]
uc001wtj.3. human. [Q6GYQ0-2]
uc001wtk.1. human. [Q6GYQ0-3]
uc010tpw.1. human. [Q6GYQ0-6]

Organism-specific databases

CTD253959.
GeneCardsGC14M036008.
H-InvDBHIX0131236.
HGNCHGNC:17770. RALGAPA1.
HPAHPA000851.
MIM608884. gene.
neXtProtNX_Q6GYQ0.
PharmGKBPA165479278.
HUGESearch...
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG250663.
HOVERGENHBG051842.
OMAQVFDYLC.
OrthoDBEOG7N63KR.
PhylomeDBQ6GYQ0.
TreeFamTF324484.

Gene expression databases

ArrayExpressQ6GYQ0.
BgeeQ6GYQ0.
CleanExHS_GARNL1.
GenevestigatorQ6GYQ0.

Family and domain databases

InterProIPR016024. ARM-type_fold.
IPR000331. Rap_GAP_dom.
[Graphical view]
PfamPF02145. Rap_GAP. 1 hit.
[Graphical view]
SUPFAMSSF48371. SSF48371. 1 hit.
PROSITEPS50085. RAPGAP. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSRALGAPA1. human.
GeneWikiGARNL1.
GenomeRNAi253959.
NextBio35482065.
PROQ6GYQ0.
SOURCESearch...

Entry information

Entry nameRGPA1_HUMAN
AccessionPrimary (citable) accession number: Q6GYQ0
Secondary accession number(s): A6NMA4 expand/collapse secondary AC list , B9EK38, C5NU19, O94960, Q6GYP9, Q6ZT23, Q86YF3, Q86YF5, Q8ND69
Entry history
Integrated into UniProtKB/Swiss-Prot: August 16, 2004
Last sequence update: July 19, 2004
Last modified: July 9, 2014
This is version 99 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 14

Human chromosome 14: entries, gene names and cross-references to MIM