Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q6GYP7

- RGPA1_MOUSE

UniProt

Q6GYP7 - RGPA1_MOUSE

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Ral GTPase-activating protein subunit alpha-1

Gene

Ralgapa1

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Catalytic subunit of the heterodimeric RalGAP1 complex which acts as a GTPase activator for the Ras-like small GTPases RALA and RALB (By similarity). May interact with the HLH region of TCF3/isoform E12.By similarity

GO - Molecular functioni

  1. Ral GTPase activator activity Source: UniProtKB

GO - Biological processi

  1. activation of Ral GTPase activity Source: UniProtKB
  2. regulation of transcription, DNA-templated Source: MGI
Complete GO annotation...

Keywords - Molecular functioni

GTPase activation

Names & Taxonomyi

Protein namesi
Recommended name:
Ral GTPase-activating protein subunit alpha-1
Alternative name(s):
GAP-related-interacting partner to E12
Short name:
GRIPE
GTPase-activating RapGAP domain-like 1
Tuberin-like protein 1
p240
Gene namesi
Name:Ralgapa1
Synonyms:Garnl1, Kiaa0884, Tulip1
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589: Chromosome 12

Organism-specific databases

MGIiMGI:1931050. Ralgapa1.

Subcellular locationi

Cytoplasm 1 Publication. Nucleus 1 Publication
Note: Translocated to the nucleus, when associated with TCF3/E12.

GO - Cellular componenti

  1. cytoplasm Source: MGI
  2. nucleus Source: MGI
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 20352035Ral GTPase-activating protein subunit alpha-1PRO_0000056754Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei753 – 7531PhosphothreonineBy similarity
Modified residuei772 – 7721PhosphoserineBy similarity
Modified residuei777 – 7771PhosphothreonineBy similarity
Modified residuei796 – 7961PhosphoserineBy similarity
Modified residuei859 – 8591Phosphoserine1 Publication
Modified residuei860 – 8601Phosphoserine1 Publication
Modified residuei863 – 8631PhosphoserineBy similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ6GYP7.
PaxDbiQ6GYP7.
PRIDEiQ6GYP7.

PTM databases

PhosphoSiteiQ6GYP7.

Expressioni

Tissue specificityi

Expressed during embryogenesis. Expressed in the adult brain, particularly in neurons of the cortex and hippocampus.1 Publication

Developmental stagei

Expression decreased during development, but persists in the adult brain.

Gene expression databases

BgeeiQ6GYP7.
CleanExiMM_GARNL1.
ExpressionAtlasiQ6GYP7. baseline and differential.
GenevestigatoriQ6GYP7.

Interactioni

Subunit structurei

Component of the heterodimeric RalGAP1 complex with RALGAPB. Heterodimerization is required for activity (By similarity). Interacts with the HLH region of TCF3/isoform E12.By similarity1 Publication

Protein-protein interaction databases

BioGridi208171. 1 interaction.
IntActiQ6GYP7. 1 interaction.
MINTiMINT-4096796.

Structurei

3D structure databases

ProteinModelPortaliQ6GYP7.
SMRiQ6GYP7. Positions 1790-1955.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini1795 – 2003209Rap-GAPPROSITE-ProRule annotationAdd
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni1326 – 2035710Minimal domain that binds to TCF3/E12Add
BLAST

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili1713 – 174836Sequence AnalysisAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi379 – 3824Poly-Ser

Sequence similaritiesi

Contains 1 Rap-GAP domain.PROSITE-ProRule annotation

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiNOG250663.
GeneTreeiENSGT00390000017866.
HOVERGENiHBG051842.
InParanoidiQ6GYP7.
OMAiQVFDYLC.
OrthoDBiEOG7N63KR.
PhylomeDBiQ6GYP7.
TreeFamiTF324484.

Family and domain databases

InterProiIPR016024. ARM-type_fold.
IPR000331. Rap_GAP_dom.
[Graphical view]
PfamiPF02145. Rap_GAP. 1 hit.
[Graphical view]
SUPFAMiSSF48371. SSF48371. 1 hit.
PROSITEiPS50085. RAPGAP. 1 hit.
[Graphical view]

Sequences (6)i

Sequence statusi: Complete.

This entry describes 6 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q6GYP7-1) [UniParc]FASTAAdd to Basket

Also known as: 3

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MFSKKPHGDV KKSTQKVLDT KKDALTRLKH LRIVIENAES IDLKQFFDQH
60 70 80 90 100
FSHIYYVFFE NFVTIEASLK QKGHKSQREE LDAILFIFEK ILQLLPERIH
110 120 130 140 150
QRWQFHSIGL ILKKLLHTGN SLKIRREGVR LFLLWLQALQ DNCSKEQLWM
160 170 180 190 200
FSCLIPGFSA PQSEYGPRTL DNLINPPLSL QETQVTIEEV TPLVPPQSGD
210 220 230 240 250
KGQEDLTSYF LEALLKYIVI QVKSLEWKNK ENQERGFSFL FSHFKKFYLP
260 270 280 290 300
YIFPNICKEN SLYHPVLDIP QIRPKPHYVM IKKDAETNET IYCTKEPFIQ
310 320 330 340 350
ARVIVIRWLV SFWLEPKPHS GPNIPGMEGE VLPKNIQRAA ASLVSREESK
360 370 380 390 400
NDTVDKVDKS AEPEQSHSNT STLTEREPSS SSLCSIDEEH LTDIEIVRRV
410 420 430 440 450
FSSKRSNVNF VTEIFRQAFL LPICEAAAMR KVVKVYQEWI QQEEKPLFMQ
460 470 480 490 500
EPEDTAITCS DIPCSETVAD HDSAIEDGEK REEENGTSTS EHVRNSSWTK
510 520 530 540 550
NGSYQEAFHV CEEATEQNIQ AGTQAVLQVF IINSSNIFLL EPANEIKNLL
560 570 580 590 600
DEHTDMCKRI LNIYRYMVVQ VSMDKKTWEQ MLLVLLRVTE SVLKMSSQAF
610 620 630 640 650
LQFQGKKSMT LAGRLAGPLF QTLIVAWIKA NLNVYISREL WDDLLSVLSS
660 670 680 690 700
LTYWEELATE WSLTMETLTK VLARNLYSLD LSDLPLDKLS EQKQKKHKGK
710 720 730 740 750
GVGHEFQKVS VDKSFSRGWS RDQPGQAPMR QRSATTTGSP GTEKARSIVR
760 770 780 790 800
QKTVDIDDAQ ILPRSTRVRH FSQSEDTGNE VFGALHEEQP LPRSSSTSDI
810 820 830 840 850
LEPFTVERAK VNKEDTSPKL PPLNSETGGN SANVPDLMDE FIAERLRSGN
860 870 880 890 900
ASTMTRRGSS PGSLEIPKDL PDILNKQNQM RPVDDPGVPS EWTSPASAGS
910 920 930 940 950
SDLMSSDSHS DSFSAFQCEG RKFDNFGFGT DIGIPSSADV DLGSGHHQST
960 970 980 990 1000
EEQEVASLTT LHLDSETSSL NQQAFSAEVA TVTGSESASP VHSALGSRSQ
1010 1020 1030 1040 1050
TPSPSTLSRA HIEQKDLQLD EKLHHSVLQT PDDLEISEFP SECCSVMAGG
1060 1070 1080 1090 1100
TLTGWHADVA TVMWRRMLGI LGDVNAIMDP EIHAQVFDYL CELWQNLAKI
1110 1120 1130 1140 1150
RDNLGISADN LTSPSPPVLI PPLRILTPWL FKATMLTDKY KQGKLHAYKL
1160 1170 1180 1190 1200
ICNTMKRRQD VSPNRDFLTH FYNIMHCGLL HIDQDIVNTI IKHCSPQFFS
1210 1220 1230 1240 1250
LGLPGATMLI MDFIIAAGRV ASSAFLNAPR VEAQVLLGSL VCFPNLYCEL
1260 1270 1280 1290 1300
PALHPNIPDI AVSQFTDVKE LIIKTVLSSA RDEPSGPARC VALCSLGIWI
1310 1320 1330 1340 1350
CEELVHESHH PQIKEALNVI CVSLKFTNKT VAHVACNMLH MLVHYVPRLQ
1360 1370 1380 1390 1400
IHQPQSPLKI IQILIATITH LLPSTEASSY EMDKRLVVSL LLCLLDWIMA
1410 1420 1430 1440 1450
LPLKTLLQPV HATGAENDKT EKSVLNCIYK VLHGCVYGAQ SFSNPKYFPI
1460 1470 1480 1490 1500
SLSDLASVDY DPFMHLESLK EPEPLHSPDS ERSSKLQPVT EVKTQMQQGL
1510 1520 1530 1540 1550
ISIAARTVIT HLVNHLGHYP MSGGPAMLTS QVCENHDNHY SESTELSPEL
1560 1570 1580 1590 1600
FESPNIQFFV LNNTTLVSCI QIRSEESMPG GGLAAGLVSA NSNVRIIVRD
1610 1620 1630 1640 1650
LSGKYSWDSA ILYGPPIVSG LPEPTSFILS MSDQEKPEEP PTSNECLEDI
1660 1670 1680 1690 1700
AVKDGLSLQL RRFRETVPTW STIREEEDVL DELLQYLGTT SPECLQRTGI
1710 1720 1730 1740 1750
SLNVPAPQPL CISEKQENDV INAILKQYTE EKEFVEKHFN DLNMKASEQD
1760 1770 1780 1790 1800
EPTPQKPQSA FYYCRLLLSI LGMNSWDKRR SFHLLKKNEK LLRELRNLDS
1810 1820 1830 1840 1850
RQCRETHKIA VFYVAEGQED KYSILTNIGG SQAYEDFVAG LGWEVNLTNH
1860 1870 1880 1890 1900
CGFMGGLQKN RSTGLTTPYF ATSTVEVIFH VSTRMPSDSD DSLTKKLRHL
1910 1920 1930 1940 1950
GNDEVHIVWS EHTRDYRRGI IPTEFGDVLI VIYPMKNHMF SIQIMKKPEV
1960 1970 1980 1990 2000
PFFGPLFDGA IVNGKVLPIM VRSTAINASR ALKSLIPLYQ NFYEERARYL
2010 2020 2030
QTIVQHHLEP TTFEDFAAQV FSPAPYHHFP ADADH
Length:2,035
Mass (Da):229,389
Last modified:July 19, 2004 - v1
Checksum:i1F4C3E24022EBB54
GO
Isoform 2 (identifier: Q6GYP7-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     2034-2035: DH → VGSYPEIPPSDAAPAAQVDGADLASPMSPRTSKSR

Show »
Length:2,068
Mass (Da):232,646
Checksum:iCD55170FA5FBCF6B
GO
Isoform 4 (identifier: Q6GYP7-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1298: Missing.
     1299-1304: WICEEL → MMRFVE

Note: No experimental confirmation available.

Show »
Length:737
Mass (Da):83,311
Checksum:i3D72CD7AA1E1F7D4
GO
Isoform 5 (identifier: Q6GYP7-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1035-1037: EIS → GNA
     1038-2035: Missing.

Show »
Length:1,037
Mass (Da):117,170
Checksum:i23D34AB339388DC0
GO
Isoform 6 (identifier: Q6GYP7-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1337: Missing.
     1897-1904: LRHLGNDE → VSAEGKHF
     1905-2035: Missing.

Note: No experimental confirmation available.

Show »
Length:567
Mass (Da):63,656
Checksum:i0B413D16DC68FE68
GO
Isoform 1S (identifier: Q6GYP7-6) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-555: Missing.

Note: May be a partial isoform 1. No experimental confirmation available.

Show »
Length:1,480
Mass (Da):165,341
Checksum:i3628A0BE37D0D0BB
GO

Sequence cautioni

The sequence BAA92774.1 differs from that shown. Reason: Erroneous termination at position 1745. Translated as Lys.Curated
The sequence BAC98046.1 differs from that shown. Reason: Erroneous initiation. Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti420 – 4201L → V in BAC98046. (PubMed:14621295)Curated
Sequence conflicti651 – 6511L → S in AAL47577. (PubMed:12200424)Curated
Sequence conflicti724 – 7241P → L in AAL47577. (PubMed:12200424)Curated
Sequence conflicti775 – 7751E → V in AAL47577. (PubMed:12200424)Curated
Sequence conflicti869 – 8691D → G in AAL47577. (PubMed:12200424)Curated
Sequence conflicti1166 – 11661D → N in AAL47577. (PubMed:12200424)Curated
Sequence conflicti1365 – 13651I → V in BAA92774. (PubMed:16141072)Curated
Sequence conflicti1398 – 13981I → T in BAA92774. (PubMed:16141072)Curated
Sequence conflicti1494 – 14941T → P in BAA92774. (PubMed:16141072)Curated
Sequence conflicti1586 – 15861G → S in BAA92774. (PubMed:16141072)Curated
Sequence conflicti1634 – 16341Q → P in BAA92774. (PubMed:16141072)Curated
Sequence conflicti1638 – 16381E → K in BAA92774. (PubMed:16141072)Curated
Sequence conflicti1674 – 16741R → Q in BAA92774. (PubMed:16141072)Curated
Sequence conflicti1775 – 17806SWDKRR → WAAGIPGTNGG in AAL47577. (PubMed:12200424)Curated
Sequence conflicti1966 – 19683VLP → SSA in AAL47577. (PubMed:12200424)Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 13371337Missing in isoform 6. 1 PublicationVSP_011331Add
BLAST
Alternative sequencei1 – 12981298Missing in isoform 4. 1 PublicationVSP_011332Add
BLAST
Alternative sequencei1 – 555555Missing in isoform 1S. 1 PublicationVSP_011330Add
BLAST
Alternative sequencei1035 – 10373EIS → GNA in isoform 5. 2 PublicationsVSP_011333
Alternative sequencei1038 – 2035998Missing in isoform 5. 2 PublicationsVSP_011334Add
BLAST
Alternative sequencei1299 – 13046WICEEL → MMRFVE in isoform 4. 1 PublicationVSP_011335
Alternative sequencei1897 – 19048LRHLGNDE → VSAEGKHF in isoform 6. 1 PublicationVSP_011336
Alternative sequencei1905 – 2035131Missing in isoform 6. 1 PublicationVSP_011337Add
BLAST
Alternative sequencei2034 – 20352DH → VGSYPEIPPSDAAPAAQVDG ADLASPMSPRTSKSR in isoform 2. 1 PublicationVSP_011338

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY066011 mRNA. Translation: AAL47577.1.
AY596972 mRNA. Translation: AAT49273.1.
AY596973 mRNA. Translation: AAT49274.1.
AY596974 mRNA. Translation: AAT49275.1.
AK129236 mRNA. Translation: BAC98046.1. Different initiation.
AB032400 mRNA. Translation: BAA92774.1. Sequence problems.
AK042116 mRNA. Translation: BAC31171.1.
AK083518 mRNA. Translation: BAC38939.1.
CCDSiCCDS36452.1. [Q6GYP7-1]
RefSeqiNP_001003719.1. NM_001003719.2.
NP_001106185.1. NM_001112714.2. [Q6GYP7-1]
NP_001273192.1. NM_001286263.1.
NP_064378.4. NM_019994.5. [Q6GYP7-1]
UniGeneiMm.292180.
Mm.398098.

Genome annotation databases

EnsembliENSMUST00000085385; ENSMUSP00000082503; ENSMUSG00000021027. [Q6GYP7-1]
ENSMUST00000110687; ENSMUSP00000106315; ENSMUSG00000021027. [Q6GYP7-1]
GeneIDi56784.
KEGGimmu:56784.
UCSCiuc007nou.1. mouse. [Q6GYP7-1]
uc007nov.1. mouse. [Q6GYP7-2]
uc007now.1. mouse. [Q6GYP7-5]
uc007nox.1. mouse. [Q6GYP7-4]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY066011 mRNA. Translation: AAL47577.1 .
AY596972 mRNA. Translation: AAT49273.1 .
AY596973 mRNA. Translation: AAT49274.1 .
AY596974 mRNA. Translation: AAT49275.1 .
AK129236 mRNA. Translation: BAC98046.1 . Different initiation.
AB032400 mRNA. Translation: BAA92774.1 . Sequence problems.
AK042116 mRNA. Translation: BAC31171.1 .
AK083518 mRNA. Translation: BAC38939.1 .
CCDSi CCDS36452.1. [Q6GYP7-1 ]
RefSeqi NP_001003719.1. NM_001003719.2.
NP_001106185.1. NM_001112714.2. [Q6GYP7-1 ]
NP_001273192.1. NM_001286263.1.
NP_064378.4. NM_019994.5. [Q6GYP7-1 ]
UniGenei Mm.292180.
Mm.398098.

3D structure databases

ProteinModelPortali Q6GYP7.
SMRi Q6GYP7. Positions 1790-1955.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 208171. 1 interaction.
IntActi Q6GYP7. 1 interaction.
MINTi MINT-4096796.

PTM databases

PhosphoSitei Q6GYP7.

Proteomic databases

MaxQBi Q6GYP7.
PaxDbi Q6GYP7.
PRIDEi Q6GYP7.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENSMUST00000085385 ; ENSMUSP00000082503 ; ENSMUSG00000021027 . [Q6GYP7-1 ]
ENSMUST00000110687 ; ENSMUSP00000106315 ; ENSMUSG00000021027 . [Q6GYP7-1 ]
GeneIDi 56784.
KEGGi mmu:56784.
UCSCi uc007nou.1. mouse. [Q6GYP7-1 ]
uc007nov.1. mouse. [Q6GYP7-2 ]
uc007now.1. mouse. [Q6GYP7-5 ]
uc007nox.1. mouse. [Q6GYP7-4 ]

Organism-specific databases

CTDi 253959.
MGIi MGI:1931050. Ralgapa1.
Rougei Search...

Phylogenomic databases

eggNOGi NOG250663.
GeneTreei ENSGT00390000017866.
HOVERGENi HBG051842.
InParanoidi Q6GYP7.
OMAi QVFDYLC.
OrthoDBi EOG7N63KR.
PhylomeDBi Q6GYP7.
TreeFami TF324484.

Miscellaneous databases

NextBioi 313310.
PROi Q6GYP7.
SOURCEi Search...

Gene expression databases

Bgeei Q6GYP7.
CleanExi MM_GARNL1.
ExpressionAtlasi Q6GYP7. baseline and differential.
Genevestigatori Q6GYP7.

Family and domain databases

InterProi IPR016024. ARM-type_fold.
IPR000331. Rap_GAP_dom.
[Graphical view ]
Pfami PF02145. Rap_GAP. 1 hit.
[Graphical view ]
SUPFAMi SSF48371. SSF48371. 1 hit.
PROSITEi PS50085. RAPGAP. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Cloning and characterization of GRIPE, a novel interacting partner of the transcription factor E12 in developing mouse forebrain."
    Heng J.I.T., Tan S.-S.
    J. Biol. Chem. 277:43152-43159(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1S), SUBCELLULAR LOCATION, TISSUE SPECIFICITY, INTERACTION WITH TCF3/E12.
    Strain: C57BL/6J.
    Tissue: Forebrain.
  2. "Cloning, genomic structure and expression profile of TULIP1 (GARNL1), a brain-expressed candidate gene for 14q13-linked neurological phenotypes and its murine homolog."
    Schwarzbraun T., Vincent J.B., Schumacher A., Geschwind D.H., Oliveira J., Windpassinger C., Ofner L., Ledinegg M.K., Kroisel P.M., Wagner K., Petek E.
    Genomics 84:577-586(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2).
    Strain: BALB/c.
  3. "Prediction of the coding sequences of mouse homologues of KIAA gene: III. The complete nucleotide sequences of 500 mouse KIAA-homologous cDNAs identified by screening of terminal sequences of cDNA clones randomly sampled from size-fractionated libraries."
    Okazaki N., Kikuno R., Ohara R., Inamoto S., Koseki H., Hiraoka S., Saga Y., Nagase T., Ohara O., Koga H.
    DNA Res. 10:167-180(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 5).
    Tissue: Embryonic tail.
  4. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 4; 5 AND 6).
    Strain: C57BL/6J.
    Tissue: Thymus.
  5. Lubec G., Sunyer B., Chen W.-Q.
    Submitted (JAN-2009) to UniProtKB
    Cited for: PROTEIN SEQUENCE OF 339-350, IDENTIFICATION BY MASS SPECTROMETRY.
    Strain: OF1.
    Tissue: Hippocampus.
  6. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-859 AND SER-860, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Liver.
  7. "The phagosomal proteome in interferon-gamma-activated macrophages."
    Trost M., English L., Lemieux S., Courcelles M., Desjardins M., Thibault P.
    Immunity 30:143-154(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

Entry informationi

Entry nameiRGPA1_MOUSE
AccessioniPrimary (citable) accession number: Q6GYP7
Secondary accession number(s): Q6GYP6
, Q6ZQ28, Q8BNJ5, Q8C9G8, Q8CIW4, Q9JMC4
Entry historyi
Integrated into UniProtKB/Swiss-Prot: August 16, 2004
Last sequence update: July 19, 2004
Last modified: October 29, 2014
This is version 93 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3