Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q6GYP7

- RGPA1_MOUSE

UniProt

Q6GYP7 - RGPA1_MOUSE

Protein

Ral GTPase-activating protein subunit alpha-1

Gene

Ralgapa1

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 92 (01 Oct 2014)
      Sequence version 1 (19 Jul 2004)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Catalytic subunit of the heterodimeric RalGAP1 complex which acts as a GTPase activator for the Ras-like small GTPases RALA and RALB By similarity. May interact with the HLH region of TCF3/isoform E12.By similarity

    GO - Molecular functioni

    1. Ral GTPase activator activity Source: UniProtKB

    GO - Biological processi

    1. activation of Ral GTPase activity Source: UniProtKB
    2. regulation of transcription, DNA-templated Source: MGI

    Keywords - Molecular functioni

    GTPase activation

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Ral GTPase-activating protein subunit alpha-1
    Alternative name(s):
    GAP-related-interacting partner to E12
    Short name:
    GRIPE
    GTPase-activating RapGAP domain-like 1
    Tuberin-like protein 1
    p240
    Gene namesi
    Name:Ralgapa1
    Synonyms:Garnl1, Kiaa0884, Tulip1
    OrganismiMus musculus (Mouse)
    Taxonomic identifieri10090 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
    ProteomesiUP000000589: Chromosome 12

    Organism-specific databases

    MGIiMGI:1931050. Ralgapa1.

    Subcellular locationi

    Cytoplasm 1 Publication. Nucleus 1 Publication
    Note: Translocated to the nucleus, when associated with TCF3/E12.

    GO - Cellular componenti

    1. cytoplasm Source: MGI
    2. mitochondrion Source: Ensembl
    3. nucleus Source: MGI

    Keywords - Cellular componenti

    Cytoplasm, Nucleus

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 20352035Ral GTPase-activating protein subunit alpha-1PRO_0000056754Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei753 – 7531PhosphothreonineBy similarity
    Modified residuei772 – 7721PhosphoserineBy similarity
    Modified residuei777 – 7771PhosphothreonineBy similarity
    Modified residuei796 – 7961PhosphoserineBy similarity
    Modified residuei859 – 8591Phosphoserine1 Publication
    Modified residuei860 – 8601Phosphoserine1 Publication
    Modified residuei863 – 8631PhosphoserineBy similarity

    Keywords - PTMi

    Phosphoprotein

    Proteomic databases

    MaxQBiQ6GYP7.
    PaxDbiQ6GYP7.
    PRIDEiQ6GYP7.

    PTM databases

    PhosphoSiteiQ6GYP7.

    Expressioni

    Tissue specificityi

    Expressed during embryogenesis. Expressed in the adult brain, particularly in neurons of the cortex and hippocampus.1 Publication

    Developmental stagei

    Expression decreased during development, but persists in the adult brain.

    Gene expression databases

    ArrayExpressiQ6GYP7.
    BgeeiQ6GYP7.
    CleanExiMM_GARNL1.
    GenevestigatoriQ6GYP7.

    Interactioni

    Subunit structurei

    Component of the heterodimeric RalGAP1 complex with RALGAPB. Heterodimerization is required for activity By similarity. Interacts with the HLH region of TCF3/isoform E12.By similarity1 Publication

    Protein-protein interaction databases

    BioGridi208171. 1 interaction.
    IntActiQ6GYP7. 1 interaction.
    MINTiMINT-4096796.

    Structurei

    3D structure databases

    ProteinModelPortaliQ6GYP7.
    SMRiQ6GYP7. Positions 1790-1955.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini1795 – 2003209Rap-GAPPROSITE-ProRule annotationAdd
    BLAST

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni1326 – 2035710Minimal domain that binds to TCF3/E12Add
    BLAST

    Coiled coil

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Coiled coili1713 – 174836Sequence AnalysisAdd
    BLAST

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi379 – 3824Poly-Ser

    Sequence similaritiesi

    Contains 1 Rap-GAP domain.PROSITE-ProRule annotation

    Keywords - Domaini

    Coiled coil

    Phylogenomic databases

    eggNOGiNOG250663.
    GeneTreeiENSGT00390000017866.
    HOVERGENiHBG051842.
    OMAiQVFDYLC.
    OrthoDBiEOG7N63KR.
    PhylomeDBiQ6GYP7.
    TreeFamiTF324484.

    Family and domain databases

    InterProiIPR016024. ARM-type_fold.
    IPR000331. Rap_GAP_dom.
    [Graphical view]
    PfamiPF02145. Rap_GAP. 1 hit.
    [Graphical view]
    SUPFAMiSSF48371. SSF48371. 1 hit.
    PROSITEiPS50085. RAPGAP. 1 hit.
    [Graphical view]

    Sequences (6)i

    Sequence statusi: Complete.

    This entry describes 6 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q6GYP7-1) [UniParc]FASTAAdd to Basket

    Also known as: 3

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MFSKKPHGDV KKSTQKVLDT KKDALTRLKH LRIVIENAES IDLKQFFDQH     50
    FSHIYYVFFE NFVTIEASLK QKGHKSQREE LDAILFIFEK ILQLLPERIH 100
    QRWQFHSIGL ILKKLLHTGN SLKIRREGVR LFLLWLQALQ DNCSKEQLWM 150
    FSCLIPGFSA PQSEYGPRTL DNLINPPLSL QETQVTIEEV TPLVPPQSGD 200
    KGQEDLTSYF LEALLKYIVI QVKSLEWKNK ENQERGFSFL FSHFKKFYLP 250
    YIFPNICKEN SLYHPVLDIP QIRPKPHYVM IKKDAETNET IYCTKEPFIQ 300
    ARVIVIRWLV SFWLEPKPHS GPNIPGMEGE VLPKNIQRAA ASLVSREESK 350
    NDTVDKVDKS AEPEQSHSNT STLTEREPSS SSLCSIDEEH LTDIEIVRRV 400
    FSSKRSNVNF VTEIFRQAFL LPICEAAAMR KVVKVYQEWI QQEEKPLFMQ 450
    EPEDTAITCS DIPCSETVAD HDSAIEDGEK REEENGTSTS EHVRNSSWTK 500
    NGSYQEAFHV CEEATEQNIQ AGTQAVLQVF IINSSNIFLL EPANEIKNLL 550
    DEHTDMCKRI LNIYRYMVVQ VSMDKKTWEQ MLLVLLRVTE SVLKMSSQAF 600
    LQFQGKKSMT LAGRLAGPLF QTLIVAWIKA NLNVYISREL WDDLLSVLSS 650
    LTYWEELATE WSLTMETLTK VLARNLYSLD LSDLPLDKLS EQKQKKHKGK 700
    GVGHEFQKVS VDKSFSRGWS RDQPGQAPMR QRSATTTGSP GTEKARSIVR 750
    QKTVDIDDAQ ILPRSTRVRH FSQSEDTGNE VFGALHEEQP LPRSSSTSDI 800
    LEPFTVERAK VNKEDTSPKL PPLNSETGGN SANVPDLMDE FIAERLRSGN 850
    ASTMTRRGSS PGSLEIPKDL PDILNKQNQM RPVDDPGVPS EWTSPASAGS 900
    SDLMSSDSHS DSFSAFQCEG RKFDNFGFGT DIGIPSSADV DLGSGHHQST 950
    EEQEVASLTT LHLDSETSSL NQQAFSAEVA TVTGSESASP VHSALGSRSQ 1000
    TPSPSTLSRA HIEQKDLQLD EKLHHSVLQT PDDLEISEFP SECCSVMAGG 1050
    TLTGWHADVA TVMWRRMLGI LGDVNAIMDP EIHAQVFDYL CELWQNLAKI 1100
    RDNLGISADN LTSPSPPVLI PPLRILTPWL FKATMLTDKY KQGKLHAYKL 1150
    ICNTMKRRQD VSPNRDFLTH FYNIMHCGLL HIDQDIVNTI IKHCSPQFFS 1200
    LGLPGATMLI MDFIIAAGRV ASSAFLNAPR VEAQVLLGSL VCFPNLYCEL 1250
    PALHPNIPDI AVSQFTDVKE LIIKTVLSSA RDEPSGPARC VALCSLGIWI 1300
    CEELVHESHH PQIKEALNVI CVSLKFTNKT VAHVACNMLH MLVHYVPRLQ 1350
    IHQPQSPLKI IQILIATITH LLPSTEASSY EMDKRLVVSL LLCLLDWIMA 1400
    LPLKTLLQPV HATGAENDKT EKSVLNCIYK VLHGCVYGAQ SFSNPKYFPI 1450
    SLSDLASVDY DPFMHLESLK EPEPLHSPDS ERSSKLQPVT EVKTQMQQGL 1500
    ISIAARTVIT HLVNHLGHYP MSGGPAMLTS QVCENHDNHY SESTELSPEL 1550
    FESPNIQFFV LNNTTLVSCI QIRSEESMPG GGLAAGLVSA NSNVRIIVRD 1600
    LSGKYSWDSA ILYGPPIVSG LPEPTSFILS MSDQEKPEEP PTSNECLEDI 1650
    AVKDGLSLQL RRFRETVPTW STIREEEDVL DELLQYLGTT SPECLQRTGI 1700
    SLNVPAPQPL CISEKQENDV INAILKQYTE EKEFVEKHFN DLNMKASEQD 1750
    EPTPQKPQSA FYYCRLLLSI LGMNSWDKRR SFHLLKKNEK LLRELRNLDS 1800
    RQCRETHKIA VFYVAEGQED KYSILTNIGG SQAYEDFVAG LGWEVNLTNH 1850
    CGFMGGLQKN RSTGLTTPYF ATSTVEVIFH VSTRMPSDSD DSLTKKLRHL 1900
    GNDEVHIVWS EHTRDYRRGI IPTEFGDVLI VIYPMKNHMF SIQIMKKPEV 1950
    PFFGPLFDGA IVNGKVLPIM VRSTAINASR ALKSLIPLYQ NFYEERARYL 2000
    QTIVQHHLEP TTFEDFAAQV FSPAPYHHFP ADADH 2035
    Length:2,035
    Mass (Da):229,389
    Last modified:July 19, 2004 - v1
    Checksum:i1F4C3E24022EBB54
    GO
    Isoform 2 (identifier: Q6GYP7-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         2034-2035: DH → VGSYPEIPPSDAAPAAQVDGADLASPMSPRTSKSR

    Show »
    Length:2,068
    Mass (Da):232,646
    Checksum:iCD55170FA5FBCF6B
    GO
    Isoform 4 (identifier: Q6GYP7-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1298: Missing.
         1299-1304: WICEEL → MMRFVE

    Note: No experimental confirmation available.

    Show »
    Length:737
    Mass (Da):83,311
    Checksum:i3D72CD7AA1E1F7D4
    GO
    Isoform 5 (identifier: Q6GYP7-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1035-1037: EIS → GNA
         1038-2035: Missing.

    Show »
    Length:1,037
    Mass (Da):117,170
    Checksum:i23D34AB339388DC0
    GO
    Isoform 6 (identifier: Q6GYP7-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1337: Missing.
         1897-1904: LRHLGNDE → VSAEGKHF
         1905-2035: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:567
    Mass (Da):63,656
    Checksum:i0B413D16DC68FE68
    GO
    Isoform 1S (identifier: Q6GYP7-6) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-555: Missing.

    Note: May be a partial isoform 1. No experimental confirmation available.

    Show »
    Length:1,480
    Mass (Da):165,341
    Checksum:i3628A0BE37D0D0BB
    GO

    Sequence cautioni

    The sequence BAC98046.1 differs from that shown. Reason: Erroneous initiation.
    The sequence BAA92774.1 differs from that shown. Reason: Erroneous termination at position 1745. Translated as Lys.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti420 – 4201L → V in BAC98046. (PubMed:14621295)Curated
    Sequence conflicti651 – 6511L → S in AAL47577. (PubMed:12200424)Curated
    Sequence conflicti724 – 7241P → L in AAL47577. (PubMed:12200424)Curated
    Sequence conflicti775 – 7751E → V in AAL47577. (PubMed:12200424)Curated
    Sequence conflicti869 – 8691D → G in AAL47577. (PubMed:12200424)Curated
    Sequence conflicti1166 – 11661D → N in AAL47577. (PubMed:12200424)Curated
    Sequence conflicti1365 – 13651I → V in BAA92774. (PubMed:16141072)Curated
    Sequence conflicti1398 – 13981I → T in BAA92774. (PubMed:16141072)Curated
    Sequence conflicti1494 – 14941T → P in BAA92774. (PubMed:16141072)Curated
    Sequence conflicti1586 – 15861G → S in BAA92774. (PubMed:16141072)Curated
    Sequence conflicti1634 – 16341Q → P in BAA92774. (PubMed:16141072)Curated
    Sequence conflicti1638 – 16381E → K in BAA92774. (PubMed:16141072)Curated
    Sequence conflicti1674 – 16741R → Q in BAA92774. (PubMed:16141072)Curated
    Sequence conflicti1775 – 17806SWDKRR → WAAGIPGTNGG in AAL47577. (PubMed:12200424)Curated
    Sequence conflicti1966 – 19683VLP → SSA in AAL47577. (PubMed:12200424)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 13371337Missing in isoform 6. 1 PublicationVSP_011331Add
    BLAST
    Alternative sequencei1 – 12981298Missing in isoform 4. 1 PublicationVSP_011332Add
    BLAST
    Alternative sequencei1 – 555555Missing in isoform 1S. 1 PublicationVSP_011330Add
    BLAST
    Alternative sequencei1035 – 10373EIS → GNA in isoform 5. 2 PublicationsVSP_011333
    Alternative sequencei1038 – 2035998Missing in isoform 5. 2 PublicationsVSP_011334Add
    BLAST
    Alternative sequencei1299 – 13046WICEEL → MMRFVE in isoform 4. 1 PublicationVSP_011335
    Alternative sequencei1897 – 19048LRHLGNDE → VSAEGKHF in isoform 6. 1 PublicationVSP_011336
    Alternative sequencei1905 – 2035131Missing in isoform 6. 1 PublicationVSP_011337Add
    BLAST
    Alternative sequencei2034 – 20352DH → VGSYPEIPPSDAAPAAQVDG ADLASPMSPRTSKSR in isoform 2. 1 PublicationVSP_011338

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AY066011 mRNA. Translation: AAL47577.1.
    AY596972 mRNA. Translation: AAT49273.1.
    AY596973 mRNA. Translation: AAT49274.1.
    AY596974 mRNA. Translation: AAT49275.1.
    AK129236 mRNA. Translation: BAC98046.1. Different initiation.
    AB032400 mRNA. Translation: BAA92774.1. Sequence problems.
    AK042116 mRNA. Translation: BAC31171.1.
    AK083518 mRNA. Translation: BAC38939.1.
    CCDSiCCDS36452.1. [Q6GYP7-1]
    RefSeqiNP_001003719.1. NM_001003719.2.
    NP_001106185.1. NM_001112714.2. [Q6GYP7-1]
    NP_001273192.1. NM_001286263.1.
    NP_064378.4. NM_019994.5. [Q6GYP7-1]
    UniGeneiMm.292180.
    Mm.398098.

    Genome annotation databases

    EnsembliENSMUST00000085385; ENSMUSP00000082503; ENSMUSG00000021027. [Q6GYP7-1]
    ENSMUST00000110687; ENSMUSP00000106315; ENSMUSG00000021027. [Q6GYP7-1]
    GeneIDi56784.
    KEGGimmu:56784.
    UCSCiuc007nou.1. mouse. [Q6GYP7-1]
    uc007nov.1. mouse. [Q6GYP7-2]
    uc007now.1. mouse. [Q6GYP7-5]
    uc007nox.1. mouse. [Q6GYP7-4]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AY066011 mRNA. Translation: AAL47577.1 .
    AY596972 mRNA. Translation: AAT49273.1 .
    AY596973 mRNA. Translation: AAT49274.1 .
    AY596974 mRNA. Translation: AAT49275.1 .
    AK129236 mRNA. Translation: BAC98046.1 . Different initiation.
    AB032400 mRNA. Translation: BAA92774.1 . Sequence problems.
    AK042116 mRNA. Translation: BAC31171.1 .
    AK083518 mRNA. Translation: BAC38939.1 .
    CCDSi CCDS36452.1. [Q6GYP7-1 ]
    RefSeqi NP_001003719.1. NM_001003719.2.
    NP_001106185.1. NM_001112714.2. [Q6GYP7-1 ]
    NP_001273192.1. NM_001286263.1.
    NP_064378.4. NM_019994.5. [Q6GYP7-1 ]
    UniGenei Mm.292180.
    Mm.398098.

    3D structure databases

    ProteinModelPortali Q6GYP7.
    SMRi Q6GYP7. Positions 1790-1955.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 208171. 1 interaction.
    IntActi Q6GYP7. 1 interaction.
    MINTi MINT-4096796.

    PTM databases

    PhosphoSitei Q6GYP7.

    Proteomic databases

    MaxQBi Q6GYP7.
    PaxDbi Q6GYP7.
    PRIDEi Q6GYP7.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENSMUST00000085385 ; ENSMUSP00000082503 ; ENSMUSG00000021027 . [Q6GYP7-1 ]
    ENSMUST00000110687 ; ENSMUSP00000106315 ; ENSMUSG00000021027 . [Q6GYP7-1 ]
    GeneIDi 56784.
    KEGGi mmu:56784.
    UCSCi uc007nou.1. mouse. [Q6GYP7-1 ]
    uc007nov.1. mouse. [Q6GYP7-2 ]
    uc007now.1. mouse. [Q6GYP7-5 ]
    uc007nox.1. mouse. [Q6GYP7-4 ]

    Organism-specific databases

    CTDi 253959.
    MGIi MGI:1931050. Ralgapa1.
    Rougei Search...

    Phylogenomic databases

    eggNOGi NOG250663.
    GeneTreei ENSGT00390000017866.
    HOVERGENi HBG051842.
    OMAi QVFDYLC.
    OrthoDBi EOG7N63KR.
    PhylomeDBi Q6GYP7.
    TreeFami TF324484.

    Miscellaneous databases

    NextBioi 313310.
    PROi Q6GYP7.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q6GYP7.
    Bgeei Q6GYP7.
    CleanExi MM_GARNL1.
    Genevestigatori Q6GYP7.

    Family and domain databases

    InterProi IPR016024. ARM-type_fold.
    IPR000331. Rap_GAP_dom.
    [Graphical view ]
    Pfami PF02145. Rap_GAP. 1 hit.
    [Graphical view ]
    SUPFAMi SSF48371. SSF48371. 1 hit.
    PROSITEi PS50085. RAPGAP. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Cloning and characterization of GRIPE, a novel interacting partner of the transcription factor E12 in developing mouse forebrain."
      Heng J.I.T., Tan S.-S.
      J. Biol. Chem. 277:43152-43159(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1S), SUBCELLULAR LOCATION, TISSUE SPECIFICITY, INTERACTION WITH TCF3/E12.
      Strain: C57BL/6J.
      Tissue: Forebrain.
    2. "Cloning, genomic structure and expression profile of TULIP1 (GARNL1), a brain-expressed candidate gene for 14q13-linked neurological phenotypes and its murine homolog."
      Schwarzbraun T., Vincent J.B., Schumacher A., Geschwind D.H., Oliveira J., Windpassinger C., Ofner L., Ledinegg M.K., Kroisel P.M., Wagner K., Petek E.
      Genomics 84:577-586(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2).
      Strain: BALB/c.
    3. "Prediction of the coding sequences of mouse homologues of KIAA gene: III. The complete nucleotide sequences of 500 mouse KIAA-homologous cDNAs identified by screening of terminal sequences of cDNA clones randomly sampled from size-fractionated libraries."
      Okazaki N., Kikuno R., Ohara R., Inamoto S., Koseki H., Hiraoka S., Saga Y., Nagase T., Ohara O., Koga H.
      DNA Res. 10:167-180(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 5).
      Tissue: Embryonic tail.
    4. "The transcriptional landscape of the mammalian genome."
      Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
      , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
      Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 4; 5 AND 6).
      Strain: C57BL/6J.
      Tissue: Thymus.
    5. Lubec G., Sunyer B., Chen W.-Q.
      Submitted (JAN-2009) to UniProtKB
      Cited for: PROTEIN SEQUENCE OF 339-350, IDENTIFICATION BY MASS SPECTROMETRY.
      Strain: OF1.
      Tissue: Hippocampus.
    6. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-859 AND SER-860, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Liver.
    7. "The phagosomal proteome in interferon-gamma-activated macrophages."
      Trost M., English L., Lemieux S., Courcelles M., Desjardins M., Thibault P.
      Immunity 30:143-154(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

    Entry informationi

    Entry nameiRGPA1_MOUSE
    AccessioniPrimary (citable) accession number: Q6GYP7
    Secondary accession number(s): Q6GYP6
    , Q6ZQ28, Q8BNJ5, Q8C9G8, Q8CIW4, Q9JMC4
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: August 16, 2004
    Last sequence update: July 19, 2004
    Last modified: October 1, 2014
    This is version 92 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Direct protein sequencing, Reference proteome

    Documents

    1. MGD cross-references
      Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
    2. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3