Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q6ECI4

- ZN470_HUMAN

UniProt

Q6ECI4 - ZN470_HUMAN

Protein

Zinc finger protein 470

Gene

ZNF470

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 92 (01 Oct 2014)
      Sequence version 3 (30 Nov 2010)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    May be involved in transcriptional regulation.

    Regions

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Zinc fingeri228 – 25023C2H2-type 1PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri256 – 27823C2H2-type 2PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri284 – 30623C2H2-type 3PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri312 – 33423C2H2-type 4PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri340 – 36223C2H2-type 5PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri368 – 39124C2H2-type 6PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri397 – 41923C2H2-type 7PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri425 – 44723C2H2-type 8PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri453 – 47523C2H2-type 9PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri481 – 50323C2H2-type 10PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri509 – 53123C2H2-type 11PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri537 – 55923C2H2-type 12PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri565 – 58723C2H2-type 13PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri593 – 61523C2H2-type 14PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri621 – 64323C2H2-type 15PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri649 – 67123C2H2-type 16PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri677 – 69923C2H2-type 17PROSITE-ProRule annotationAdd
    BLAST

    GO - Molecular functioni

    1. DNA binding Source: UniProtKB-KW
    2. metal ion binding Source: UniProtKB-KW
    3. sequence-specific DNA binding transcription factor activity Source: RefGenome

    GO - Biological processi

    1. regulation of transcription, DNA-templated Source: RefGenome
    2. transcription, DNA-templated Source: UniProtKB-KW

    Keywords - Biological processi

    Transcription, Transcription regulation

    Keywords - Ligandi

    DNA-binding, Metal-binding, Zinc

    Enzyme and pathway databases

    ReactomeiREACT_12627. Generic Transcription Pathway.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Zinc finger protein 470
    Alternative name(s):
    Chondrogenesis zinc finger protein 1
    Short name:
    CZF-1
    Gene namesi
    Name:ZNF470
    Synonyms:CZF1
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 19

    Organism-specific databases

    HGNCiHGNC:22220. ZNF470.

    Subcellular locationi

    Nucleus 1 Publication

    GO - Cellular componenti

    1. nucleus Source: HPA

    Keywords - Cellular componenti

    Nucleus

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA145007252.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 717717Zinc finger protein 470PRO_0000280413Add
    BLAST

    Proteomic databases

    PaxDbiQ6ECI4.
    PRIDEiQ6ECI4.

    PTM databases

    PhosphoSiteiQ6ECI4.

    Expressioni

    Tissue specificityi

    Highly expressed in testis. Very low expression in thymus. No expression in other tissues tested. Expressed in a differentiation stage-specific manner in mesenchymal chondrogenic progenitor cells.1 Publication

    Gene expression databases

    BgeeiQ6ECI4.
    CleanExiHS_ZNF470.
    GenevestigatoriQ6ECI4.

    Organism-specific databases

    HPAiHPA029000.

    Structurei

    3D structure databases

    ProteinModelPortaliQ6ECI4.
    SMRiQ6ECI4. Positions 23-63, 199-702.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini23 – 9472KRABPROSITE-ProRule annotationAdd
    BLAST

    Motif

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Motifi216 – 2194Nuclear localization signalSequence Analysis
    Motifi385 – 3884Nuclear localization signalSequence Analysis

    Sequence similaritiesi

    Contains 17 C2H2-type zinc fingers.PROSITE-ProRule annotation
    Contains 1 KRAB domain.PROSITE-ProRule annotation

    Zinc finger

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Zinc fingeri228 – 25023C2H2-type 1PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri256 – 27823C2H2-type 2PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri284 – 30623C2H2-type 3PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri312 – 33423C2H2-type 4PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri340 – 36223C2H2-type 5PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri368 – 39124C2H2-type 6PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri397 – 41923C2H2-type 7PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri425 – 44723C2H2-type 8PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri453 – 47523C2H2-type 9PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri481 – 50323C2H2-type 10PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri509 – 53123C2H2-type 11PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri537 – 55923C2H2-type 12PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri565 – 58723C2H2-type 13PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri593 – 61523C2H2-type 14PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri621 – 64323C2H2-type 15PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri649 – 67123C2H2-type 16PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri677 – 69923C2H2-type 17PROSITE-ProRule annotationAdd
    BLAST

    Keywords - Domaini

    Repeat, Zinc-finger

    Phylogenomic databases

    eggNOGiCOG5048.
    HOGENOMiHOG000234617.
    HOVERGENiHBG018163.
    InParanoidiQ6ECI4.
    KOiK09228.
    OMAiKGEMTRG.
    OrthoDBiEOG7KSX7Q.
    PhylomeDBiQ6ECI4.
    TreeFamiTF341817.

    Family and domain databases

    Gene3Di3.30.160.60. 17 hits.
    InterProiIPR001909. Krueppel-associated_box.
    IPR007087. Znf_C2H2.
    IPR015880. Znf_C2H2-like.
    IPR013087. Znf_C2H2/integrase_DNA-bd.
    [Graphical view]
    PfamiPF01352. KRAB. 1 hit.
    [Graphical view]
    SMARTiSM00349. KRAB. 1 hit.
    SM00355. ZnF_C2H2. 17 hits.
    [Graphical view]
    SUPFAMiSSF109640. SSF109640. 1 hit.
    PROSITEiPS50805. KRAB. 1 hit.
    PS00028. ZINC_FINGER_C2H2_1. 17 hits.
    PS50157. ZINC_FINGER_C2H2_2. 17 hits.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q6ECI4-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MKSQEEVEVA GIKLCKAMSL GSVTFTDVAI DFSQDEWEWL NLAQRSLYKK    50
    VMLENYRNLV SVGLCISKPD VISLLEQEKD PWVIKGGMNR GLCPDLECVW 100
    VTKSLSLNQD IYEEKLPPAI IMERLKSYDL ECSTLGKNWK CEDLFERELV 150
    NQKTHFRQET ITHIDTLIEK RDHSNKSGTV FHLNTLSYIK QIFPMEERIF 200
    NFHTDKKSLK THSVVKKHKQ DRGEKKLLKC NDCEKIFSKI STLTLHQRIH 250
    TGEKPYECIE CGKAFSQSAH LAQHQRIHTG EKPFECTECG KAFSQNAHLV 300
    QHQRVHTGEK PYQCKQCNKA FSQLAHLAQH QRVHTGEKPY ECIECGKAFS 350
    DCSSLAHHRR IHTGKRPYEC IDCGKAFRQN ASLIRHRRYY HTGEKPFDCI 400
    DCGKAFTDHI GLIQHKRTHT GERPYKCNVC GKAFSHGSSL TVHQRIHTGE 450
    KPYECNICEK AFSHRGSLTL HQRVHTGEKP YECKECGKAF RQSTHLAHHQ 500
    RIHTGEKPYE CKECSKTFSQ NAHLAQHQKI HTGEKPYECK ECGKAFSQIA 550
    HLVQHQRVHT GEKPYECIEC GKAFSDGSYL VQHQRLHSGK RPYECLECGK 600
    AFRQRASLIC HQRCHTGEKP YECNVCGKAF SHRKSLTLHQ RIHTGEKPYE 650
    CKECSKAFSQ VAHLTLHKRI HTGERPYECK ECGKAFRQSV HLAHHQRIHT 700
    GESSVILSSA LPYHQVL 717
    Length:717
    Mass (Da):82,650
    Last modified:November 30, 2010 - v3
    Checksum:i3CE8F2E9FC5603A3
    GO
    Isoform 2 (identifier: Q6ECI4-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         63-63: G → GKSIFLLLPPHDSVVFYAIIRISHSFPQHRQFLYVFLHAG
         95-251: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:599
    Mass (Da):68,573
    Checksum:iDEA044259E409522
    GO

    Sequence cautioni

    The sequence BAC85218.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti542 – 5421C → R in AAS64219. (PubMed:15302581)Curated
    Sequence conflicti584 – 5841Q → P in AAS64219. (PubMed:15302581)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti23 – 231V → L.1 Publication
    Corresponds to variant rs10421285 [ dbSNP | Ensembl ].
    VAR_031143
    Natural varianti254 – 2541K → R.
    Corresponds to variant rs3752179 [ dbSNP | Ensembl ].
    VAR_031144
    Natural varianti418 – 4181T → I.2 Publications
    Corresponds to variant rs4801177 [ dbSNP | Ensembl ].
    VAR_031145
    Natural varianti642 – 6421I → T.
    Corresponds to variant rs35077804 [ dbSNP | Ensembl ].
    VAR_061950

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei63 – 631G → GKSIFLLLPPHDSVVFYAII RISHSFPQHRQFLYVFLHAG in isoform 2. CuratedVSP_023660
    Alternative sequencei95 – 251157Missing in isoform 2. CuratedVSP_023661Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AY484591 mRNA. Translation: AAS64219.1.
    AC007228 Genomic DNA. Translation: AAD23607.1.
    BC136762 mRNA. Translation: AAI36763.1.
    AK129686 mRNA. Translation: BAC85218.1. Different initiation.
    CCDSiCCDS33122.1. [Q6ECI4-1]
    RefSeqiNP_001001668.3. NM_001001668.3. [Q6ECI4-1]
    XP_006723273.1. XM_006723210.1. [Q6ECI4-1]
    UniGeneiHs.204449.

    Genome annotation databases

    EnsembliENST00000330619; ENSP00000333223; ENSG00000197016. [Q6ECI4-1]
    ENST00000391709; ENSP00000375590; ENSG00000197016. [Q6ECI4-1]
    GeneIDi388566.
    KEGGihsa:388566.
    UCSCiuc002qnl.4. human. [Q6ECI4-1]

    Polymorphism databases

    DMDMi313104257.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AY484591 mRNA. Translation: AAS64219.1 .
    AC007228 Genomic DNA. Translation: AAD23607.1 .
    BC136762 mRNA. Translation: AAI36763.1 .
    AK129686 mRNA. Translation: BAC85218.1 . Different initiation.
    CCDSi CCDS33122.1. [Q6ECI4-1 ]
    RefSeqi NP_001001668.3. NM_001001668.3. [Q6ECI4-1 ]
    XP_006723273.1. XM_006723210.1. [Q6ECI4-1 ]
    UniGenei Hs.204449.

    3D structure databases

    ProteinModelPortali Q6ECI4.
    SMRi Q6ECI4. Positions 23-63, 199-702.
    ModBasei Search...
    MobiDBi Search...

    PTM databases

    PhosphoSitei Q6ECI4.

    Polymorphism databases

    DMDMi 313104257.

    Proteomic databases

    PaxDbi Q6ECI4.
    PRIDEi Q6ECI4.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000330619 ; ENSP00000333223 ; ENSG00000197016 . [Q6ECI4-1 ]
    ENST00000391709 ; ENSP00000375590 ; ENSG00000197016 . [Q6ECI4-1 ]
    GeneIDi 388566.
    KEGGi hsa:388566.
    UCSCi uc002qnl.4. human. [Q6ECI4-1 ]

    Organism-specific databases

    CTDi 388566.
    GeneCardsi GC19P057078.
    HGNCi HGNC:22220. ZNF470.
    HPAi HPA029000.
    neXtProti NX_Q6ECI4.
    PharmGKBi PA145007252.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG5048.
    HOGENOMi HOG000234617.
    HOVERGENi HBG018163.
    InParanoidi Q6ECI4.
    KOi K09228.
    OMAi KGEMTRG.
    OrthoDBi EOG7KSX7Q.
    PhylomeDBi Q6ECI4.
    TreeFami TF341817.

    Enzyme and pathway databases

    Reactomei REACT_12627. Generic Transcription Pathway.

    Miscellaneous databases

    GenomeRNAii 388566.
    NextBioi 102168.
    PROi Q6ECI4.

    Gene expression databases

    Bgeei Q6ECI4.
    CleanExi HS_ZNF470.
    Genevestigatori Q6ECI4.

    Family and domain databases

    Gene3Di 3.30.160.60. 17 hits.
    InterProi IPR001909. Krueppel-associated_box.
    IPR007087. Znf_C2H2.
    IPR015880. Znf_C2H2-like.
    IPR013087. Znf_C2H2/integrase_DNA-bd.
    [Graphical view ]
    Pfami PF01352. KRAB. 1 hit.
    [Graphical view ]
    SMARTi SM00349. KRAB. 1 hit.
    SM00355. ZnF_C2H2. 17 hits.
    [Graphical view ]
    SUPFAMi SSF109640. SSF109640. 1 hit.
    PROSITEi PS50805. KRAB. 1 hit.
    PS00028. ZINC_FINGER_C2H2_1. 17 hits.
    PS50157. ZINC_FINGER_C2H2_2. 17 hits.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Characterization and chondrocyte differentiation stage-specific expression of KRAB zinc-finger protein gene ZNF470."
      Hering T.M., Kazmi N.H., Huynh T.D., Kollar J., Xu L., Hunyady A.B., Johnstone B.
      Exp. Cell Res. 299:137-147(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), SUBCELLULAR LOCATION, TISSUE SPECIFICITY, VARIANTS LEU-23 AND ILE-418.
      Tissue: Mesenchymal stem cell.
    2. "The DNA sequence and biology of human chromosome 19."
      Grimwood J., Gordon L.A., Olsen A.S., Terry A., Schmutz J., Lamerdin J.E., Hellsten U., Goodstein D., Couronne O., Tran-Gyamfi M., Aerts A., Altherr M., Ashworth L., Bajorek E., Black S., Branscomb E., Caenepeel S., Carrano A.V.
      , Caoile C., Chan Y.M., Christensen M., Cleland C.A., Copeland A., Dalin E., Dehal P., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Garcia C., Georgescu A.M., Glavina T., Gomez M., Gonzales E., Groza M., Hammon N., Hawkins T., Haydu L., Ho I., Huang W., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Larionov V., Leem S.-H., Lopez F., Lou Y., Lowry S., Malfatti S., Martinez D., McCready P.M., Medina C., Morgan J., Nelson K., Nolan M., Ovcharenko I., Pitluck S., Pollard M., Popkie A.P., Predki P., Quan G., Ramirez L., Rash S., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., She X., Smith D., Slezak T., Solovyev V., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wagner M., Wheeler J., Wu K., Xie G., Yang J., Dubchak I., Furey T.S., DeJong P., Dickson M., Gordon D., Eichler E.E., Pennacchio L.A., Richardson P., Stubbs L., Rokhsar D.S., Myers R.M., Rubin E.M., Lucas S.M.
      Nature 428:529-535(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Brain.
    4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 188-717 (ISOFORM 1), VARIANT ILE-418.
      Tissue: Adrenal gland.

    Entry informationi

    Entry nameiZN470_HUMAN
    AccessioniPrimary (citable) accession number: Q6ECI4
    Secondary accession number(s): A8MTW0
    , B9EGU1, Q6ZPA1, Q9Y2N9
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: March 20, 2007
    Last sequence update: November 30, 2010
    Last modified: October 1, 2014
    This is version 92 of the entry and version 3 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 19
      Human chromosome 19: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3