Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q6ECI4 (ZN470_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 87. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (4) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Zinc finger protein 470
Alternative name(s):
Chondrogenesis zinc finger protein 1
Short name=CZF-1
Gene names
Name:ZNF470
Synonyms:CZF1
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length717 AA.
Sequence statusComplete.
Protein existenceEvidence at transcript level

General annotation (Comments)

Function

May be involved in transcriptional regulation.

Subcellular location

Nucleus Ref.1.

Tissue specificity

Highly expressed in testis. Very low expression in thymus. No expression in other tissues tested. Expressed in a differentiation stage-specific manner in mesenchymal chondrogenic progenitor cells. Ref.1

Sequence similarities

Belongs to the krueppel C2H2-type zinc-finger protein family.

Contains 17 C2H2-type zinc fingers.

Contains 1 KRAB domain.

Sequence caution

The sequence BAC85218.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q6ECI4-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q6ECI4-2)

The sequence of this isoform differs from the canonical sequence as follows:
     63-63: G → GKSIFLLLPPHDSVVFYAIIRISHSFPQHRQFLYVFLHAG
     95-251: Missing.
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 717717Zinc finger protein 470
PRO_0000280413

Regions

Domain23 – 9472KRAB
Zinc finger228 – 25023C2H2-type 1
Zinc finger256 – 27823C2H2-type 2
Zinc finger284 – 30623C2H2-type 3
Zinc finger312 – 33423C2H2-type 4
Zinc finger340 – 36223C2H2-type 5
Zinc finger368 – 39124C2H2-type 6
Zinc finger397 – 41923C2H2-type 7
Zinc finger425 – 44723C2H2-type 8
Zinc finger453 – 47523C2H2-type 9
Zinc finger481 – 50323C2H2-type 10
Zinc finger509 – 53123C2H2-type 11
Zinc finger537 – 55923C2H2-type 12
Zinc finger565 – 58723C2H2-type 13
Zinc finger593 – 61523C2H2-type 14
Zinc finger621 – 64323C2H2-type 15
Zinc finger649 – 67123C2H2-type 16
Zinc finger677 – 69923C2H2-type 17
Motif216 – 2194Nuclear localization signal Potential
Motif385 – 3884Nuclear localization signal Potential

Natural variations

Alternative sequence631G → GKSIFLLLPPHDSVVFYAII RISHSFPQHRQFLYVFLHAG in isoform 2.
VSP_023660
Alternative sequence95 – 251157Missing in isoform 2.
VSP_023661
Natural variant231V → L. Ref.1
Corresponds to variant rs10421285 [ dbSNP | Ensembl ].
VAR_031143
Natural variant2541K → R.
Corresponds to variant rs3752179 [ dbSNP | Ensembl ].
VAR_031144
Natural variant4181T → I. Ref.1 Ref.4
Corresponds to variant rs4801177 [ dbSNP | Ensembl ].
VAR_031145
Natural variant6421I → T.
Corresponds to variant rs35077804 [ dbSNP | Ensembl ].
VAR_061950

Experimental info

Sequence conflict5421C → R in AAS64219. Ref.1
Sequence conflict5841Q → P in AAS64219. Ref.1

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified November 30, 2010. Version 3.
Checksum: 3CE8F2E9FC5603A3

FASTA71782,650
        10         20         30         40         50         60 
MKSQEEVEVA GIKLCKAMSL GSVTFTDVAI DFSQDEWEWL NLAQRSLYKK VMLENYRNLV 

        70         80         90        100        110        120 
SVGLCISKPD VISLLEQEKD PWVIKGGMNR GLCPDLECVW VTKSLSLNQD IYEEKLPPAI 

       130        140        150        160        170        180 
IMERLKSYDL ECSTLGKNWK CEDLFERELV NQKTHFRQET ITHIDTLIEK RDHSNKSGTV 

       190        200        210        220        230        240 
FHLNTLSYIK QIFPMEERIF NFHTDKKSLK THSVVKKHKQ DRGEKKLLKC NDCEKIFSKI 

       250        260        270        280        290        300 
STLTLHQRIH TGEKPYECIE CGKAFSQSAH LAQHQRIHTG EKPFECTECG KAFSQNAHLV 

       310        320        330        340        350        360 
QHQRVHTGEK PYQCKQCNKA FSQLAHLAQH QRVHTGEKPY ECIECGKAFS DCSSLAHHRR 

       370        380        390        400        410        420 
IHTGKRPYEC IDCGKAFRQN ASLIRHRRYY HTGEKPFDCI DCGKAFTDHI GLIQHKRTHT 

       430        440        450        460        470        480 
GERPYKCNVC GKAFSHGSSL TVHQRIHTGE KPYECNICEK AFSHRGSLTL HQRVHTGEKP 

       490        500        510        520        530        540 
YECKECGKAF RQSTHLAHHQ RIHTGEKPYE CKECSKTFSQ NAHLAQHQKI HTGEKPYECK 

       550        560        570        580        590        600 
ECGKAFSQIA HLVQHQRVHT GEKPYECIEC GKAFSDGSYL VQHQRLHSGK RPYECLECGK 

       610        620        630        640        650        660 
AFRQRASLIC HQRCHTGEKP YECNVCGKAF SHRKSLTLHQ RIHTGEKPYE CKECSKAFSQ 

       670        680        690        700        710 
VAHLTLHKRI HTGERPYECK ECGKAFRQSV HLAHHQRIHT GESSVILSSA LPYHQVL 

« Hide

Isoform 2 [UniParc].

Checksum: DEA044259E409522
Show »

FASTA59968,573

References

« Hide 'large scale' references
[1]"Characterization and chondrocyte differentiation stage-specific expression of KRAB zinc-finger protein gene ZNF470."
Hering T.M., Kazmi N.H., Huynh T.D., Kollar J., Xu L., Hunyady A.B., Johnstone B.
Exp. Cell Res. 299:137-147(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), SUBCELLULAR LOCATION, TISSUE SPECIFICITY, VARIANTS LEU-23 AND ILE-418.
Tissue: Mesenchymal stem cell.
[2]"The DNA sequence and biology of human chromosome 19."
Grimwood J., Gordon L.A., Olsen A.S., Terry A., Schmutz J., Lamerdin J.E., Hellsten U., Goodstein D., Couronne O., Tran-Gyamfi M., Aerts A., Altherr M., Ashworth L., Bajorek E., Black S., Branscomb E., Caenepeel S., Carrano A.V. expand/collapse author list , Caoile C., Chan Y.M., Christensen M., Cleland C.A., Copeland A., Dalin E., Dehal P., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Garcia C., Georgescu A.M., Glavina T., Gomez M., Gonzales E., Groza M., Hammon N., Hawkins T., Haydu L., Ho I., Huang W., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Larionov V., Leem S.-H., Lopez F., Lou Y., Lowry S., Malfatti S., Martinez D., McCready P.M., Medina C., Morgan J., Nelson K., Nolan M., Ovcharenko I., Pitluck S., Pollard M., Popkie A.P., Predki P., Quan G., Ramirez L., Rash S., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., She X., Smith D., Slezak T., Solovyev V., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wagner M., Wheeler J., Wu K., Xie G., Yang J., Dubchak I., Furey T.S., DeJong P., Dickson M., Gordon D., Eichler E.E., Pennacchio L.A., Richardson P., Stubbs L., Rokhsar D.S., Myers R.M., Rubin E.M., Lucas S.M.
Nature 428:529-535(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[3]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Brain.
[4]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 188-717 (ISOFORM 1), VARIANT ILE-418.
Tissue: Adrenal gland.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AY484591 mRNA. Translation: AAS64219.1.
AC007228 Genomic DNA. Translation: AAD23607.1.
BC136762 mRNA. Translation: AAI36763.1.
AK129686 mRNA. Translation: BAC85218.1. Different initiation.
RefSeqNP_001001668.3. NM_001001668.3.
UniGeneHs.204449.

3D structure databases

ProteinModelPortalQ6ECI4.
SMRQ6ECI4. Positions 23-63, 207-702.
ModBaseSearch...
MobiDBSearch...

PTM databases

PhosphoSiteQ6ECI4.

Polymorphism databases

DMDM313104257.

Proteomic databases

PaxDbQ6ECI4.
PRIDEQ6ECI4.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000330619; ENSP00000333223; ENSG00000197016. [Q6ECI4-1]
ENST00000391709; ENSP00000375590; ENSG00000197016. [Q6ECI4-1]
GeneID388566.
KEGGhsa:388566.
UCSCuc002qnl.4. human. [Q6ECI4-1]

Organism-specific databases

CTD388566.
GeneCardsGC19P057078.
HGNCHGNC:22220. ZNF470.
HPAHPA029000.
neXtProtNX_Q6ECI4.
PharmGKBPA145007252.
GenAtlasSearch...

Phylogenomic databases

eggNOGCOG5048.
HOGENOMHOG000234617.
HOVERGENHBG018163.
InParanoidQ6ECI4.
KOK09228.
OMAKGEMTRG.
OrthoDBEOG7KSX7Q.
PhylomeDBQ6ECI4.
TreeFamTF341817.

Enzyme and pathway databases

ReactomeREACT_71. Gene Expression.

Gene expression databases

BgeeQ6ECI4.
CleanExHS_ZNF470.
GenevestigatorQ6ECI4.

Family and domain databases

Gene3D3.30.160.60. 17 hits.
InterProIPR001909. Krueppel-associated_box.
IPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
IPR013087. Znf_C2H2/integrase_DNA-bd.
[Graphical view]
PfamPF01352. KRAB. 1 hit.
[Graphical view]
SMARTSM00349. KRAB. 1 hit.
SM00355. ZnF_C2H2. 17 hits.
[Graphical view]
SUPFAMSSF109640. SSF109640. 1 hit.
PROSITEPS50805. KRAB. 1 hit.
PS00028. ZINC_FINGER_C2H2_1. 17 hits.
PS50157. ZINC_FINGER_C2H2_2. 17 hits.
[Graphical view]
ProtoNetSearch...

Other

GenomeRNAi388566.
NextBio102168.
PROQ6ECI4.

Entry information

Entry nameZN470_HUMAN
AccessionPrimary (citable) accession number: Q6ECI4
Secondary accession number(s): A8MTW0 expand/collapse secondary AC list , B9EGU1, Q6ZPA1, Q9Y2N9
Entry history
Integrated into UniProtKB/Swiss-Prot: March 20, 2007
Last sequence update: November 30, 2010
Last modified: April 16, 2014
This is version 87 of the entry and version 3 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 19

Human chromosome 19: entries, gene names and cross-references to MIM