Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q6ECI4

- ZN470_HUMAN

UniProt

Q6ECI4 - ZN470_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Zinc finger protein 470

Gene

ZNF470

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at transcript leveli

Functioni

May be involved in transcriptional regulation.

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri228 – 25023C2H2-type 1PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri256 – 27823C2H2-type 2PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri284 – 30623C2H2-type 3PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri312 – 33423C2H2-type 4PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri340 – 36223C2H2-type 5PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri368 – 39124C2H2-type 6PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri397 – 41923C2H2-type 7PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri425 – 44723C2H2-type 8PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri453 – 47523C2H2-type 9PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri481 – 50323C2H2-type 10PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri509 – 53123C2H2-type 11PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri537 – 55923C2H2-type 12PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri565 – 58723C2H2-type 13PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri593 – 61523C2H2-type 14PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri621 – 64323C2H2-type 15PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri649 – 67123C2H2-type 16PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri677 – 69923C2H2-type 17PROSITE-ProRule annotationAdd
BLAST

GO - Molecular functioni

  1. DNA binding Source: UniProtKB-KW
  2. metal ion binding Source: UniProtKB-KW
  3. sequence-specific DNA binding transcription factor activity Source: RefGenome

GO - Biological processi

  1. regulation of transcription, DNA-templated Source: RefGenome
  2. transcription, DNA-templated Source: UniProtKB-KW
Complete GO annotation...

Keywords - Biological processi

Transcription, Transcription regulation

Keywords - Ligandi

DNA-binding, Metal-binding, Zinc

Enzyme and pathway databases

ReactomeiREACT_12627. Generic Transcription Pathway.

Names & Taxonomyi

Protein namesi
Recommended name:
Zinc finger protein 470
Alternative name(s):
Chondrogenesis zinc finger protein 1
Short name:
CZF-1
Gene namesi
Name:ZNF470
Synonyms:CZF1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 19

Organism-specific databases

HGNCiHGNC:22220. ZNF470.

Subcellular locationi

Nucleus 1 Publication

GO - Cellular componenti

  1. nucleus Source: HPA
Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA145007252.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 717717Zinc finger protein 470PRO_0000280413Add
BLAST

Proteomic databases

PaxDbiQ6ECI4.
PRIDEiQ6ECI4.

PTM databases

PhosphoSiteiQ6ECI4.

Expressioni

Tissue specificityi

Highly expressed in testis. Very low expression in thymus. No expression in other tissues tested. Expressed in a differentiation stage-specific manner in mesenchymal chondrogenic progenitor cells.1 Publication

Gene expression databases

BgeeiQ6ECI4.
CleanExiHS_ZNF470.
ExpressionAtlasiQ6ECI4. baseline and differential.
GenevestigatoriQ6ECI4.

Organism-specific databases

HPAiHPA029000.

Structurei

3D structure databases

ProteinModelPortaliQ6ECI4.
SMRiQ6ECI4. Positions 23-63, 230-702.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini23 – 9472KRABPROSITE-ProRule annotationAdd
BLAST

Motif

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Motifi216 – 2194Nuclear localization signalSequence Analysis
Motifi385 – 3884Nuclear localization signalSequence Analysis

Sequence similaritiesi

Contains 17 C2H2-type zinc fingers.PROSITE-ProRule annotation
Contains 1 KRAB domain.PROSITE-ProRule annotation

Zinc finger

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri228 – 25023C2H2-type 1PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri256 – 27823C2H2-type 2PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri284 – 30623C2H2-type 3PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri312 – 33423C2H2-type 4PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri340 – 36223C2H2-type 5PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri368 – 39124C2H2-type 6PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri397 – 41923C2H2-type 7PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri425 – 44723C2H2-type 8PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri453 – 47523C2H2-type 9PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri481 – 50323C2H2-type 10PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri509 – 53123C2H2-type 11PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri537 – 55923C2H2-type 12PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri565 – 58723C2H2-type 13PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri593 – 61523C2H2-type 14PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri621 – 64323C2H2-type 15PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri649 – 67123C2H2-type 16PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri677 – 69923C2H2-type 17PROSITE-ProRule annotationAdd
BLAST

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

eggNOGiCOG5048.
GeneTreeiENSGT00770000120458.
HOGENOMiHOG000234617.
HOVERGENiHBG018163.
InParanoidiQ6ECI4.
KOiK09228.
OMAiKGEMTRG.
OrthoDBiEOG7KSX7Q.
PhylomeDBiQ6ECI4.
TreeFamiTF341817.

Family and domain databases

Gene3Di3.30.160.60. 17 hits.
InterProiIPR001909. Krueppel-associated_box.
IPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
IPR013087. Znf_C2H2/integrase_DNA-bd.
[Graphical view]
PfamiPF01352. KRAB. 1 hit.
[Graphical view]
SMARTiSM00349. KRAB. 1 hit.
SM00355. ZnF_C2H2. 17 hits.
[Graphical view]
SUPFAMiSSF109640. SSF109640. 1 hit.
PROSITEiPS50805. KRAB. 1 hit.
PS00028. ZINC_FINGER_C2H2_1. 17 hits.
PS50157. ZINC_FINGER_C2H2_2. 17 hits.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q6ECI4-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MKSQEEVEVA GIKLCKAMSL GSVTFTDVAI DFSQDEWEWL NLAQRSLYKK
60 70 80 90 100
VMLENYRNLV SVGLCISKPD VISLLEQEKD PWVIKGGMNR GLCPDLECVW
110 120 130 140 150
VTKSLSLNQD IYEEKLPPAI IMERLKSYDL ECSTLGKNWK CEDLFERELV
160 170 180 190 200
NQKTHFRQET ITHIDTLIEK RDHSNKSGTV FHLNTLSYIK QIFPMEERIF
210 220 230 240 250
NFHTDKKSLK THSVVKKHKQ DRGEKKLLKC NDCEKIFSKI STLTLHQRIH
260 270 280 290 300
TGEKPYECIE CGKAFSQSAH LAQHQRIHTG EKPFECTECG KAFSQNAHLV
310 320 330 340 350
QHQRVHTGEK PYQCKQCNKA FSQLAHLAQH QRVHTGEKPY ECIECGKAFS
360 370 380 390 400
DCSSLAHHRR IHTGKRPYEC IDCGKAFRQN ASLIRHRRYY HTGEKPFDCI
410 420 430 440 450
DCGKAFTDHI GLIQHKRTHT GERPYKCNVC GKAFSHGSSL TVHQRIHTGE
460 470 480 490 500
KPYECNICEK AFSHRGSLTL HQRVHTGEKP YECKECGKAF RQSTHLAHHQ
510 520 530 540 550
RIHTGEKPYE CKECSKTFSQ NAHLAQHQKI HTGEKPYECK ECGKAFSQIA
560 570 580 590 600
HLVQHQRVHT GEKPYECIEC GKAFSDGSYL VQHQRLHSGK RPYECLECGK
610 620 630 640 650
AFRQRASLIC HQRCHTGEKP YECNVCGKAF SHRKSLTLHQ RIHTGEKPYE
660 670 680 690 700
CKECSKAFSQ VAHLTLHKRI HTGERPYECK ECGKAFRQSV HLAHHQRIHT
710
GESSVILSSA LPYHQVL
Length:717
Mass (Da):82,650
Last modified:November 30, 2010 - v3
Checksum:i3CE8F2E9FC5603A3
GO
Isoform 2 (identifier: Q6ECI4-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     63-63: G → GKSIFLLLPPHDSVVFYAIIRISHSFPQHRQFLYVFLHAG
     95-251: Missing.

Note: No experimental confirmation available.

Show »
Length:599
Mass (Da):68,573
Checksum:iDEA044259E409522
GO

Sequence cautioni

The sequence BAC85218.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti542 – 5421C → R in AAS64219. (PubMed:15302581)Curated
Sequence conflicti584 – 5841Q → P in AAS64219. (PubMed:15302581)Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti23 – 231V → L.1 Publication
Corresponds to variant rs10421285 [ dbSNP | Ensembl ].
VAR_031143
Natural varianti254 – 2541K → R.
Corresponds to variant rs3752179 [ dbSNP | Ensembl ].
VAR_031144
Natural varianti418 – 4181T → I.2 Publications
Corresponds to variant rs4801177 [ dbSNP | Ensembl ].
VAR_031145
Natural varianti642 – 6421I → T.
Corresponds to variant rs35077804 [ dbSNP | Ensembl ].
VAR_061950

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei63 – 631G → GKSIFLLLPPHDSVVFYAII RISHSFPQHRQFLYVFLHAG in isoform 2. CuratedVSP_023660
Alternative sequencei95 – 251157Missing in isoform 2. CuratedVSP_023661Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY484591 mRNA. Translation: AAS64219.1.
AC007228 Genomic DNA. Translation: AAD23607.1.
BC136762 mRNA. Translation: AAI36763.1.
AK129686 mRNA. Translation: BAC85218.1. Different initiation.
CCDSiCCDS33122.1. [Q6ECI4-1]
RefSeqiNP_001001668.3. NM_001001668.3. [Q6ECI4-1]
XP_006723273.1. XM_006723210.1. [Q6ECI4-1]
UniGeneiHs.204449.

Genome annotation databases

EnsembliENST00000330619; ENSP00000333223; ENSG00000197016. [Q6ECI4-1]
ENST00000391709; ENSP00000375590; ENSG00000197016. [Q6ECI4-1]
GeneIDi388566.
KEGGihsa:388566.
UCSCiuc002qnl.4. human. [Q6ECI4-1]

Polymorphism databases

DMDMi313104257.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY484591 mRNA. Translation: AAS64219.1 .
AC007228 Genomic DNA. Translation: AAD23607.1 .
BC136762 mRNA. Translation: AAI36763.1 .
AK129686 mRNA. Translation: BAC85218.1 . Different initiation.
CCDSi CCDS33122.1. [Q6ECI4-1 ]
RefSeqi NP_001001668.3. NM_001001668.3. [Q6ECI4-1 ]
XP_006723273.1. XM_006723210.1. [Q6ECI4-1 ]
UniGenei Hs.204449.

3D structure databases

ProteinModelPortali Q6ECI4.
SMRi Q6ECI4. Positions 23-63, 230-702.
ModBasei Search...
MobiDBi Search...

PTM databases

PhosphoSitei Q6ECI4.

Polymorphism databases

DMDMi 313104257.

Proteomic databases

PaxDbi Q6ECI4.
PRIDEi Q6ECI4.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000330619 ; ENSP00000333223 ; ENSG00000197016 . [Q6ECI4-1 ]
ENST00000391709 ; ENSP00000375590 ; ENSG00000197016 . [Q6ECI4-1 ]
GeneIDi 388566.
KEGGi hsa:388566.
UCSCi uc002qnl.4. human. [Q6ECI4-1 ]

Organism-specific databases

CTDi 388566.
GeneCardsi GC19P057078.
HGNCi HGNC:22220. ZNF470.
HPAi HPA029000.
neXtProti NX_Q6ECI4.
PharmGKBi PA145007252.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG5048.
GeneTreei ENSGT00770000120458.
HOGENOMi HOG000234617.
HOVERGENi HBG018163.
InParanoidi Q6ECI4.
KOi K09228.
OMAi KGEMTRG.
OrthoDBi EOG7KSX7Q.
PhylomeDBi Q6ECI4.
TreeFami TF341817.

Enzyme and pathway databases

Reactomei REACT_12627. Generic Transcription Pathway.

Miscellaneous databases

GenomeRNAii 388566.
NextBioi 102168.
PROi Q6ECI4.

Gene expression databases

Bgeei Q6ECI4.
CleanExi HS_ZNF470.
ExpressionAtlasi Q6ECI4. baseline and differential.
Genevestigatori Q6ECI4.

Family and domain databases

Gene3Di 3.30.160.60. 17 hits.
InterProi IPR001909. Krueppel-associated_box.
IPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
IPR013087. Znf_C2H2/integrase_DNA-bd.
[Graphical view ]
Pfami PF01352. KRAB. 1 hit.
[Graphical view ]
SMARTi SM00349. KRAB. 1 hit.
SM00355. ZnF_C2H2. 17 hits.
[Graphical view ]
SUPFAMi SSF109640. SSF109640. 1 hit.
PROSITEi PS50805. KRAB. 1 hit.
PS00028. ZINC_FINGER_C2H2_1. 17 hits.
PS50157. ZINC_FINGER_C2H2_2. 17 hits.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Characterization and chondrocyte differentiation stage-specific expression of KRAB zinc-finger protein gene ZNF470."
    Hering T.M., Kazmi N.H., Huynh T.D., Kollar J., Xu L., Hunyady A.B., Johnstone B.
    Exp. Cell Res. 299:137-147(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), SUBCELLULAR LOCATION, TISSUE SPECIFICITY, VARIANTS LEU-23 AND ILE-418.
    Tissue: Mesenchymal stem cell.
  2. "The DNA sequence and biology of human chromosome 19."
    Grimwood J., Gordon L.A., Olsen A.S., Terry A., Schmutz J., Lamerdin J.E., Hellsten U., Goodstein D., Couronne O., Tran-Gyamfi M., Aerts A., Altherr M., Ashworth L., Bajorek E., Black S., Branscomb E., Caenepeel S., Carrano A.V.
    , Caoile C., Chan Y.M., Christensen M., Cleland C.A., Copeland A., Dalin E., Dehal P., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Garcia C., Georgescu A.M., Glavina T., Gomez M., Gonzales E., Groza M., Hammon N., Hawkins T., Haydu L., Ho I., Huang W., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Larionov V., Leem S.-H., Lopez F., Lou Y., Lowry S., Malfatti S., Martinez D., McCready P.M., Medina C., Morgan J., Nelson K., Nolan M., Ovcharenko I., Pitluck S., Pollard M., Popkie A.P., Predki P., Quan G., Ramirez L., Rash S., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., She X., Smith D., Slezak T., Solovyev V., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wagner M., Wheeler J., Wu K., Xie G., Yang J., Dubchak I., Furey T.S., DeJong P., Dickson M., Gordon D., Eichler E.E., Pennacchio L.A., Richardson P., Stubbs L., Rokhsar D.S., Myers R.M., Rubin E.M., Lucas S.M.
    Nature 428:529-535(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Brain.
  4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 188-717 (ISOFORM 1), VARIANT ILE-418.
    Tissue: Adrenal gland.

Entry informationi

Entry nameiZN470_HUMAN
AccessioniPrimary (citable) accession number: Q6ECI4
Secondary accession number(s): A8MTW0
, B9EGU1, Q6ZPA1, Q9Y2N9
Entry historyi
Integrated into UniProtKB/Swiss-Prot: March 20, 2007
Last sequence update: November 30, 2010
Last modified: November 26, 2014
This is version 94 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 19
    Human chromosome 19: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3