Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Dermokine

Gene

DMKN

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

May act as a soluble regulator of keratinocyte differentiation.Curated

GO - Biological processi

Complete GO annotation...

Names & Taxonomyi

Protein namesi
Recommended name:
Dermokine
Alternative name(s):
Epidermis-specific secreted protein SK30/SK89
Gene namesi
Name:DMKN
ORF Names:UNQ729/PRO1411
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 19

Organism-specific databases

HGNCiHGNC:25063. DMKN.

Subcellular locationi

GO - Cellular componenti

  • extracellular exosome Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Secreted

Pathology & Biotechi

Organism-specific databases

DisGeNETi93099.
OpenTargetsiENSG00000161249.
PharmGKBiPA145149020.

Polymorphism and mutation databases

BioMutaiDMKN.
DMDMi290457677.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 211 PublicationAdd BLAST21
ChainiPRO_000033076422 – 476DermokineAdd BLAST455

Post-translational modificationi

O-glycosylated.1 Publication

Keywords - PTMi

Glycoprotein

Proteomic databases

PaxDbiQ6E0U4.
PeptideAtlasiQ6E0U4.
PRIDEiQ6E0U4.

PTM databases

iPTMnetiQ6E0U4.
PhosphoSitePlusiQ6E0U4.

Expressioni

Tissue specificityi

Expressed in epidermis; in the spinous and granular layers and in placenta. Also found in the epithelia of the small intestine, macrophages of the lung and endothelial cells of the lung. Isoform 15 is expressed in epidermis and placenta. Isoform 1 is expressed in epidermis.2 Publications

Gene expression databases

BgeeiENSG00000161249.
CleanExiHS_DMKN.
ExpressionAtlasiQ6E0U4. baseline and differential.
GenevisibleiQ6E0U4. HS.

Organism-specific databases

HPAiHPA029406.

Interactioni

Subunit structurei

Homooligomer. Seems to be able to homodimerize and homotrimerize.1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
HSPA5P110213EBI-7943171,EBI-354921

Protein-protein interaction databases

BioGridi125000. 6 interactors.
IntActiQ6E0U4. 4 interactors.
MINTiMINT-8382680.
STRINGi9606.ENSP00000342012.

Structurei

Secondary structure

1476
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi254 – 259Combined sources6

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
4F20X-ray2.50Q251-262[»]
ProteinModelPortaliQ6E0U4.
SMRiQ6E0U4.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi17 – 344Gly-richAdd BLAST328

Sequence similaritiesi

Belongs to the dermokine family.Curated

Keywords - Domaini

Signal

Phylogenomic databases

eggNOGiENOG410JC0V. Eukaryota.
ENOG4111ARX. LUCA.
GeneTreeiENSGT00570000079107.
HOGENOMiHOG000168236.
HOVERGENiHBG107816.
InParanoidiQ6E0U4.
OMAiNPNTECT.
OrthoDBiEOG091G0NY5.
PhylomeDBiQ6E0U4.
TreeFamiTF338112.

Family and domain databases

InterProiIPR033541. Dermokine.
[Graphical view]
PANTHERiPTHR36881. PTHR36881. 1 hit.

Sequences (16)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 16 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q6E0U4-1) [UniParc]FASTAAdd to basket
Also known as: Dermokine beta

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MKFQGPLACL LLALCLGSGE AGPLQSGEES TGTNIGEALG HGLGDALSEG
60 70 80 90 100
VGKAIGKEAG GAAGSKVSEA LGQGTREAVG TGVRQVPGFG VADALGNRVG
110 120 130 140 150
EAAHALGNTG HEIGRQAEDV IRHGADAVRG SWQGVPGHNG AWETSGGHGI
160 170 180 190 200
FGSQGGLGGQ GQGNPGGLGT PWVHGYPGNS AGSFGMNPQG APWGQGGNGG
210 220 230 240 250
PPNFGTNTQG AVAQPGYGSV RASNQNEGCT NPPPSGSGGG SSNSGGGSGS
260 270 280 290 300
QSGSSGSGSN GDNNNGSSSG GSSSGSSSGG SSGGSSGGSS GNSGGSRGDS
310 320 330 340 350
GSESSWGSST GSSSGNHGGS GGGNGHKPGC EKPGNEARGS GESGIQNSET
360 370 380 390 400
SPGMFNFDTF WKNFKSKLGF INWDAINKNQ VPPPSTRALL YFSRLWEDFK
410 420 430 440 450
QNTPFLNWKA IIEGADASSL QKRAGRDDQN YNYNQHAYPT AYGGKYSVKT
460 470
PAKGGVSPSS SASRVQPGLL QWVKFW
Length:476
Mass (Da):47,082
Last modified:March 2, 2010 - v3
Checksum:iC412EC42221BEEC8
GO
Isoform 2 (identifier: Q6E0U4-2) [UniParc]FASTAAdd to basket
Also known as: Dermokine beta-2

The sequence of this isoform differs from the canonical sequence as follows:
     247-346: GSGSQSGSSG...ARGSGESGIQ → SSTGSSSGNH...GDAVGGVNTV

Show »
Length:466
Mass (Da):47,082
Checksum:i0695C599941C08C4
GO
Isoform 3 (identifier: Q6E0U4-3) [UniParc]FASTAAdd to basket
Also known as: Dermokine-gamma 1, Dermokine gamma-2

The sequence of this isoform differs from the canonical sequence as follows:
     379-386: NQVPPPST → DQRSSRIP
     387-476: Missing.

Show »
Length:386
Mass (Da):36,989
Checksum:i90226638F70F1D6A
GO
Isoform 4 (identifier: Q6E0U4-4) [UniParc]FASTAAdd to basket
Also known as: Dermokine beta-1

The sequence of this isoform differs from the canonical sequence as follows:
     247-307: Missing.
     346-346: Q → QGQGSSWGSGGGDAVGGVNTV
     429-429: Q → QPGAGWQEVAAVTSK

Show »
Length:449
Mass (Da):45,102
Checksum:i9C8BDA5F10D2788F
GO
Isoform 5 (identifier: Q6E0U4-5) [UniParc]FASTAAdd to basket
Also known as: Dermokine gamma-2

The sequence of this isoform differs from the canonical sequence as follows:
     346-346: Q → QGFRGQGVSSNMR
     379-386: NQVPPPST → DQRSSRIP
     387-476: Missing.

Show »
Length:398
Mass (Da):38,267
Checksum:iD9F7784BF7B2F718
GO
Isoform 6 (identifier: Q6E0U4-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     347-476: NSETSPGMFN...PGLLQWVKFW → GFRGQGVSSN...NKDQRSSRIP

Note: No experimental confirmation available.
Show »
Length:436
Mass (Da):41,944
Checksum:i0C02BEFC2EEE375A
GO
Isoform 7 (identifier: Q6E0U4-7) [UniParc]FASTAAdd to basket
Also known as: Dermokine gamma-1

The sequence of this isoform differs from the canonical sequence as follows:
     330-346: Missing.
     379-386: NQVPPPST → DQRSSRIP
     387-476: Missing.

Show »
Length:369
Mass (Da):35,288
Checksum:iF684C785EC251FB3
GO
Isoform 8 (identifier: Q6E0U4-8) [UniParc]FASTAAdd to basket
Also known as: Dermokine delta

The sequence of this isoform differs from the canonical sequence as follows:
     1-287: Missing.
     288-306: GSSGNSGGSRGDSGSESSW → MLGITSCSDQQAKEGEGLE

Show »
Length:189
Mass (Da):20,419
Checksum:iD812C17E18882C0D
GO
Isoform 9 (identifier: Q6E0U4-9) [UniParc]FASTAAdd to basket
Also known as: Dermokine-delta-4

The sequence of this isoform differs from the canonical sequence as follows:
     1-306: Missing.
     307-346: GSSTGSSSGN...ARGSGESGIQ → MSPPDQGVVE...GDAVGGVNTV

Show »
Length:170
Mass (Da):18,926
Checksum:i1B188C7AD69D62BF
GO
Isoform 10 (identifier: Q6E0U4-10) [UniParc]FASTAAdd to basket
Also known as: Dermokine-delta-1

The sequence of this isoform differs from the canonical sequence as follows:
     1-324: Missing.
     325-346: GHKPGCEKPGNEARGSGESGIQ → MRGQGSSWGSGGGDAVGGVNTV

Show »
Length:152
Mass (Da):16,837
Checksum:iEC6B68B536F8056E
GO
Isoform 11 (identifier: Q6E0U4-11) [UniParc]FASTAAdd to basket
Also known as: Dermokine-delta-3

The sequence of this isoform differs from the canonical sequence as follows:
     1-344: Missing.
     345-346: IQ → MR

Show »
Length:132
Mass (Da):15,106
Checksum:iE58EF713F35C69C3
GO
Isoform 12 (identifier: Q6E0U4-12) [UniParc]FASTAAdd to basket
Also known as: Dermokine-delta-2

The sequence of this isoform differs from the canonical sequence as follows:
     1-344: Missing.
     345-346: IQ → MR
     429-429: Q → QPGAGWQEVAAVTSK

Show »
Length:146
Mass (Da):16,489
Checksum:i39A0105B1329BA2F
GO
Isoform 13 (identifier: Q6E0U4-13) [UniParc]FASTAAdd to basket
Also known as: Dermokine-delta-6

The sequence of this isoform differs from the canonical sequence as follows:
     1-353: Missing.

Show »
Length:123
Mass (Da):14,146
Checksum:i97BF493EF89039CA
GO
Isoform 14 (identifier: Q6E0U4-14) [UniParc]FASTAAdd to basket
Also known as: Dermokine-delta-5

The sequence of this isoform differs from the canonical sequence as follows:
     1-353: Missing.
     429-429: Q → QPGAGWQEVAAVTSK

Show »
Length:137
Mass (Da):15,528
Checksum:i5F40C040AA329563
GO
Isoform 15 (identifier: Q6E0U4-15) [UniParc]FASTAAdd to basket
Also known as: Dermokine-alpha

The sequence of this isoform differs from the canonical sequence as follows:
     1-388: Missing.
     389-413: LLYFSRLWEDFKQNTPFLNWKAIIE → MNMKPATASALLLLLLGLAWTQGSHGW

Show »
Length:90
Mass (Da):9,712
Checksum:i6BF0EECEAE9309DB
GO
Isoform 16 (identifier: Q6E0U4-16) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     247-307: Missing.
     346-346: Q → QGFRGQGVSSNMREISKEGNRLLGGSGDNYRGQGSSWGSGGGDAVGGVNTV

Note: No experimental confirmation available.
Show »
Length:465
Mass (Da):46,944
Checksum:i8D0D334A8EDA8107
GO

Sequence cautioni

The sequence AAX48757 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti111H → R in ABN11271 (PubMed:17380110).Curated1
Sequence conflicti111H → R in ABN11272 (PubMed:17380110).Curated1
Sequence conflicti198N → D in ABN11273 (PubMed:17380110).Curated1
Sequence conflicti214 – 215QP → PA in ABN11273 (PubMed:17380110).Curated2
Sequence conflicti271Missing in ABN11273 (PubMed:17380110).Curated1
Sequence conflicti271Missing in ABN11274 (PubMed:17380110).Curated1
Sequence conflicti279G → GSSSG in AAQ88778 (PubMed:12975309).Curated1
Sequence conflicti378K → M in ABN11272 (PubMed:17380110).Curated1
Sequence conflicti419S → L in ABN11272 (PubMed:17380110).Curated1
Sequence conflicti450T → S in ABN11272 (PubMed:17380110).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_04272013A → D in a colorectal cancer sample; somatic mutation. 1 Publication1
Natural variantiVAR_05686569E → D.Corresponds to variant rs12460932dbSNPEnsembl.1
Natural variantiVAR_05965291V → A.5 PublicationsCorresponds to variant rs4806163dbSNPEnsembl.1
Natural variantiVAR_056866139N → S.1 PublicationCorresponds to variant rs7247001dbSNPEnsembl.1
Natural variantiVAR_059653280G → S.1 PublicationCorresponds to variant rs11667007dbSNPEnsembl.1
Natural variantiVAR_042721415A → S.Corresponds to variant rs2293696dbSNPEnsembl.1
Natural variantiVAR_047337427D → A.4 PublicationsCorresponds to variant rs909072dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0330871 – 388Missing in isoform 15. CuratedAdd BLAST388
Alternative sequenceiVSP_0330881 – 353Missing in isoform 13 and isoform 14. 2 PublicationsAdd BLAST353
Alternative sequenceiVSP_0330891 – 344Missing in isoform 11 and isoform 12. 1 PublicationAdd BLAST344
Alternative sequenceiVSP_0330901 – 324Missing in isoform 10. 1 PublicationAdd BLAST324
Alternative sequenceiVSP_0330911 – 306Missing in isoform 9. 1 PublicationAdd BLAST306
Alternative sequenceiVSP_0330921 – 287Missing in isoform 8. 1 PublicationAdd BLAST287
Alternative sequenceiVSP_033093247 – 346GSGSQ…ESGIQ → SSTGSSSGNHGGSGGGNGHK PGCEKPGNEARGSGESGIQG FRGPGSFPXNMREISKEGNR LLGGSGDNYRGQGSSWGSGG GDAVGGVNTV in isoform 2. 1 PublicationAdd BLAST100
Alternative sequenceiVSP_033094247 – 307Missing in isoform 4 and isoform 16. 1 PublicationAdd BLAST61
Alternative sequenceiVSP_033095288 – 306GSSGN…SESSW → MLGITSCSDQQAKEGEGLE in isoform 8. 1 PublicationAdd BLAST19
Alternative sequenceiVSP_033096307 – 346GSSTG…ESGIQ → MSPPDQGVVESRLWRQMLHK GQGSSWGSGGGDAVGGVNTV in isoform 9. 1 PublicationAdd BLAST40
Alternative sequenceiVSP_033097325 – 346GHKPG…ESGIQ → MRGQGSSWGSGGGDAVGGVN TV in isoform 10. 1 PublicationAdd BLAST22
Alternative sequenceiVSP_033098330 – 346Missing in isoform 7. 1 PublicationAdd BLAST17
Alternative sequenceiVSP_033099345 – 346IQ → MR in isoform 11 and isoform 12. 1 Publication2
Alternative sequenceiVSP_047249346Q → QGFRGQGVSSNMREISKEGN RLLGGSGDNYRGQGSSWGSG GGDAVGGVNTV in isoform 16. Curated1
Alternative sequenceiVSP_033100346Q → QGQGSSWGSGGGDAVGGVNT V in isoform 4. 1 Publication1
Alternative sequenceiVSP_033101346Q → QGFRGQGVSSNMR in isoform 5. 1 Publication1
Alternative sequenceiVSP_033102347 – 476NSETS…WVKFW → GFRGQGVSSNMREISKEGNR LLGGSGDNYRGQGSSWGSGG GDAVGGVNTVNSETSPGMFN FDTFWKNFKSKLGFINWDAI NKDQRSSRIP in isoform 6. 1 PublicationAdd BLAST130
Alternative sequenceiVSP_033103379 – 386NQVPPPST → DQRSSRIP in isoform 3, isoform 5 and isoform 7. 2 Publications8
Alternative sequenceiVSP_033104387 – 476Missing in isoform 3, isoform 5 and isoform 7. 2 PublicationsAdd BLAST90
Alternative sequenceiVSP_033105389 – 413LLYFS…KAIIE → MNMKPATASALLLLLLGLAW TQGSHGW in isoform 15. CuratedAdd BLAST25
Alternative sequenceiVSP_033106429Q → QPGAGWQEVAAVTSK in isoform 4, isoform 12 and isoform 14. 3 Publications1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY622964 mRNA. Translation: AAT68268.1.
AY622965 mRNA. Translation: AAT68269.1.
AY789695 mRNA. Translation: AAX48745.1.
AY789696 mRNA. Translation: AAX48746.1.
AY789697 mRNA. Translation: AAX48747.1.
AY789698 mRNA. Translation: AAX48748.1.
AY789699 mRNA. Translation: AAX48749.1.
AY789700 mRNA. Translation: AAX48750.1.
AY789701 mRNA. Translation: AAX48751.1.
AY789702 mRNA. Translation: AAX48752.1.
AY789703 mRNA. Translation: AAX48753.1.
AY789704 mRNA. Translation: AAX48754.1.
AY789705 mRNA. Translation: AAX48755.1.
AY789706 mRNA. Translation: AAX48756.1.
AY789707 mRNA. Translation: AAX48757.1. Different initiation.
EF158319 mRNA. Translation: ABN11271.1.
EF158320 mRNA. Translation: ABN11272.1.
EF158321 mRNA. Translation: ABN11273.1.
EF158322 mRNA. Translation: ABN11274.1.
EF158323 mRNA. Translation: ABN11275.1.
AY358412 mRNA. Translation: AAQ88778.1.
AC138125 Genomic DNA. No translation available.
AD001502 Genomic DNA. No translation available.
BC004493 mRNA. Translation: AAH04493.2.
BC011886 mRNA. Translation: AAH11886.1.
BC035311 mRNA. Translation: AAH35311.1.
CCDSiCCDS12463.1. [Q6E0U4-1]
CCDS42549.1. [Q6E0U4-15]
CCDS46051.1. [Q6E0U4-8]
CCDS46052.1. [Q6E0U4-3]
CCDS46053.1. [Q6E0U4-5]
CCDS46054.2. [Q6E0U4-16]
CCDS54250.1. [Q6E0U4-4]
CCDS54251.1. [Q6E0U4-7]
CCDS54252.1. [Q6E0U4-6]
RefSeqiNP_001119528.2. NM_001126056.2.
NP_001119529.2. NM_001126057.2. [Q6E0U4-5]
NP_001119530.2. NM_001126058.2. [Q6E0U4-3]
NP_001119531.1. NM_001126059.2.
NP_001177276.1. NM_001190347.1.
NP_001177277.1. NM_001190348.1. [Q6E0U4-6]
NP_001177278.1. NM_001190349.1. [Q6E0U4-7]
NP_001295309.1. NM_001308380.1.
NP_201574.3. NM_033317.4.
XP_006723556.1. XM_006723493.2. [Q6E0U4-10]
XP_006723557.1. XM_006723494.2. [Q6E0U4-12]
XP_016882966.1. XM_017027477.1. [Q6E0U4-14]
UniGeneiHs.417795.

Genome annotation databases

EnsembliENST00000339686; ENSP00000342012; ENSG00000161249. [Q6E0U4-1]
ENST00000408915; ENSP00000386225; ENSG00000161249. [Q6E0U4-15]
ENST00000414866; ENSP00000392222; ENSG00000161249. [Q6E0U4-8]
ENST00000418261; ENSP00000414743; ENSG00000161249. [Q6E0U4-3]
ENST00000419602; ENSP00000391036; ENSG00000161249. [Q6E0U4-16]
ENST00000424570; ENSP00000388404; ENSG00000161249. [Q6E0U4-5]
ENST00000429837; ENSP00000405503; ENSG00000161249. [Q6E0U4-4]
ENST00000447113; ENSP00000394908; ENSG00000161249. [Q6E0U4-6]
ENST00000451297; ENSP00000409513; ENSG00000161249. [Q6E0U4-7]
ENST00000472252; ENSP00000473341; ENSG00000161249. [Q6E0U4-13]
ENST00000492341; ENSP00000474419; ENSG00000161249. [Q6E0U4-13]
GeneIDi93099.
KEGGihsa:93099.
UCSCiuc002nzi.5. human. [Q6E0U4-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY622964 mRNA. Translation: AAT68268.1.
AY622965 mRNA. Translation: AAT68269.1.
AY789695 mRNA. Translation: AAX48745.1.
AY789696 mRNA. Translation: AAX48746.1.
AY789697 mRNA. Translation: AAX48747.1.
AY789698 mRNA. Translation: AAX48748.1.
AY789699 mRNA. Translation: AAX48749.1.
AY789700 mRNA. Translation: AAX48750.1.
AY789701 mRNA. Translation: AAX48751.1.
AY789702 mRNA. Translation: AAX48752.1.
AY789703 mRNA. Translation: AAX48753.1.
AY789704 mRNA. Translation: AAX48754.1.
AY789705 mRNA. Translation: AAX48755.1.
AY789706 mRNA. Translation: AAX48756.1.
AY789707 mRNA. Translation: AAX48757.1. Different initiation.
EF158319 mRNA. Translation: ABN11271.1.
EF158320 mRNA. Translation: ABN11272.1.
EF158321 mRNA. Translation: ABN11273.1.
EF158322 mRNA. Translation: ABN11274.1.
EF158323 mRNA. Translation: ABN11275.1.
AY358412 mRNA. Translation: AAQ88778.1.
AC138125 Genomic DNA. No translation available.
AD001502 Genomic DNA. No translation available.
BC004493 mRNA. Translation: AAH04493.2.
BC011886 mRNA. Translation: AAH11886.1.
BC035311 mRNA. Translation: AAH35311.1.
CCDSiCCDS12463.1. [Q6E0U4-1]
CCDS42549.1. [Q6E0U4-15]
CCDS46051.1. [Q6E0U4-8]
CCDS46052.1. [Q6E0U4-3]
CCDS46053.1. [Q6E0U4-5]
CCDS46054.2. [Q6E0U4-16]
CCDS54250.1. [Q6E0U4-4]
CCDS54251.1. [Q6E0U4-7]
CCDS54252.1. [Q6E0U4-6]
RefSeqiNP_001119528.2. NM_001126056.2.
NP_001119529.2. NM_001126057.2. [Q6E0U4-5]
NP_001119530.2. NM_001126058.2. [Q6E0U4-3]
NP_001119531.1. NM_001126059.2.
NP_001177276.1. NM_001190347.1.
NP_001177277.1. NM_001190348.1. [Q6E0U4-6]
NP_001177278.1. NM_001190349.1. [Q6E0U4-7]
NP_001295309.1. NM_001308380.1.
NP_201574.3. NM_033317.4.
XP_006723556.1. XM_006723493.2. [Q6E0U4-10]
XP_006723557.1. XM_006723494.2. [Q6E0U4-12]
XP_016882966.1. XM_017027477.1. [Q6E0U4-14]
UniGeneiHs.417795.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
4F20X-ray2.50Q251-262[»]
ProteinModelPortaliQ6E0U4.
SMRiQ6E0U4.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi125000. 6 interactors.
IntActiQ6E0U4. 4 interactors.
MINTiMINT-8382680.
STRINGi9606.ENSP00000342012.

PTM databases

iPTMnetiQ6E0U4.
PhosphoSitePlusiQ6E0U4.

Polymorphism and mutation databases

BioMutaiDMKN.
DMDMi290457677.

Proteomic databases

PaxDbiQ6E0U4.
PeptideAtlasiQ6E0U4.
PRIDEiQ6E0U4.

Protocols and materials databases

DNASUi93099.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000339686; ENSP00000342012; ENSG00000161249. [Q6E0U4-1]
ENST00000408915; ENSP00000386225; ENSG00000161249. [Q6E0U4-15]
ENST00000414866; ENSP00000392222; ENSG00000161249. [Q6E0U4-8]
ENST00000418261; ENSP00000414743; ENSG00000161249. [Q6E0U4-3]
ENST00000419602; ENSP00000391036; ENSG00000161249. [Q6E0U4-16]
ENST00000424570; ENSP00000388404; ENSG00000161249. [Q6E0U4-5]
ENST00000429837; ENSP00000405503; ENSG00000161249. [Q6E0U4-4]
ENST00000447113; ENSP00000394908; ENSG00000161249. [Q6E0U4-6]
ENST00000451297; ENSP00000409513; ENSG00000161249. [Q6E0U4-7]
ENST00000472252; ENSP00000473341; ENSG00000161249. [Q6E0U4-13]
ENST00000492341; ENSP00000474419; ENSG00000161249. [Q6E0U4-13]
GeneIDi93099.
KEGGihsa:93099.
UCSCiuc002nzi.5. human. [Q6E0U4-1]

Organism-specific databases

CTDi93099.
DisGeNETi93099.
GeneCardsiDMKN.
HGNCiHGNC:25063. DMKN.
HPAiHPA029406.
neXtProtiNX_Q6E0U4.
OpenTargetsiENSG00000161249.
PharmGKBiPA145149020.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410JC0V. Eukaryota.
ENOG4111ARX. LUCA.
GeneTreeiENSGT00570000079107.
HOGENOMiHOG000168236.
HOVERGENiHBG107816.
InParanoidiQ6E0U4.
OMAiNPNTECT.
OrthoDBiEOG091G0NY5.
PhylomeDBiQ6E0U4.
TreeFamiTF338112.

Miscellaneous databases

ChiTaRSiDMKN. human.
GenomeRNAii93099.
PROiQ6E0U4.

Gene expression databases

BgeeiENSG00000161249.
CleanExiHS_DMKN.
ExpressionAtlasiQ6E0U4. baseline and differential.
GenevisibleiQ6E0U4. HS.

Family and domain databases

InterProiIPR033541. Dermokine.
[Graphical view]
PANTHERiPTHR36881. PTHR36881. 1 hit.
ProtoNetiSearch...

Entry informationi

Entry nameiDMKN_HUMAN
AccessioniPrimary (citable) accession number: Q6E0U4
Secondary accession number(s): A3EZ79
, A3EZ80, A3EZ81, A3EZ82, A3EZ83, C9J4P6, C9J5N8, C9JAL3, Q32W58, Q32W62, Q32W63, Q32W64, Q32W65, Q32W66, Q32W67, Q6E0U5, Q6UXC7, Q96EW8, Q9BSY6
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 29, 2008
Last sequence update: March 2, 2010
Last modified: November 30, 2016
This is version 115 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 19
    Human chromosome 19: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.