Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Nuclear receptor coactivator 7

Gene

Ncoa7

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Enhances the transcriptional activities of several nuclear receptors. Involved in the coactivation of different nuclear receptors, such as ESR1, THRB, PPARG and RARA (By similarity).By similarity

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionActivator
Biological processTranscription, Transcription regulation

Names & Taxonomyi

Protein namesi
Recommended name:
Nuclear receptor coactivator 7
Gene namesi
Name:Ncoa7
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 10

Organism-specific databases

MGIiMGI:2444847 Ncoa7

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002452301 – 943Nuclear receptor coactivator 7Add BLAST943

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei1N-acetylmethionineBy similarity1
Modified residuei92PhosphoserineCombined sources1
Modified residuei137PhosphothreonineBy similarity1
Modified residuei182PhosphoserineBy similarity1
Modified residuei186PhosphoserineBy similarity1
Modified residuei211PhosphoserineCombined sources1
Modified residuei212PhosphoserineCombined sources1
Modified residuei214PhosphoserineCombined sources1
Modified residuei442PhosphoserineBy similarity1
Modified residuei498PhosphoserineCombined sources1
Modified residuei500PhosphoserineCombined sources1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

PaxDbiQ6DFV7
PeptideAtlasiQ6DFV7
PRIDEiQ6DFV7

PTM databases

iPTMnetiQ6DFV7
PhosphoSitePlusiQ6DFV7

Expressioni

Tissue specificityi

Highly expressed in brain and kidney. Weakly expressed in mammary gland, lung and testis. In brain, expression is found in neurons of cerebral cortex, thalamus, hypothalamus, hippocampus, cerebellum, striatum and choroid plexus.1 Publication

Gene expression databases

BgeeiENSMUSG00000039697
CleanExiMM_NCOA7
ExpressionAtlasiQ6DFV7 baseline and differential
GenevisibleiQ6DFV7 MM

Interactioni

Subunit structurei

Interacts with ESR1, ESR2A, ESR2B, THRB, PPARG and RARA in a ligand-inducible manner. Interacts with the heterodimer AHR-ARNT (By similarity).By similarity

GO - Molecular functioni

Structurei

3D structure databases

ProteinModelPortaliQ6DFV7
SMRiQ6DFV7
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini117 – 160LysMPROSITE-ProRule annotationAdd BLAST44
Domaini807 – 943TLDAdd BLAST137

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili1 – 32Sequence analysisAdd BLAST32

Sequence similaritiesi

Belongs to the OXR1 family.Curated

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiENOG410KCPQ Eukaryota
ENOG4110T63 LUCA
GeneTreeiENSGT00410000025363
HOVERGENiHBG065488
InParanoidiQ6DFV7
OMAiIQVPIED
OrthoDBiEOG091G0L15
PhylomeDBiQ6DFV7
TreeFamiTF313530

Family and domain databases

CDDicd00118 LysM, 1 hit
Gene3Di3.10.350.10, 1 hit
InterProiView protein in InterPro
IPR018392 LysM_dom
IPR036779 LysM_dom_sf
IPR006571 TLDc_dom
PfamiView protein in Pfam
PF01476 LysM, 1 hit
PF07534 TLD, 1 hit
SMARTiView protein in SMART
SM00257 LysM, 1 hit
SM00584 TLDc, 1 hit
PROSITEiView protein in PROSITE
PS51782 LYSM, 1 hit

Sequences (6)i

Sequence statusi: Complete.

This entry describes 6 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q6DFV7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MDTKEEKKEQ KERKQSYFAR LKKKKQAKQN AEIVSAASSK SRSGKDDANS
60 70 80 90 100
DILEQDKFNV TAEGDHSTDD KKKRKSNQLK EIRRTELKRY YSVDDNQNKT
110 120 130 140 150
HDKKEKKMMV QKPQGTMEYT AGSQDTLNSV ALKFNVTPNK LVELNKLFTH
160 170 180 190 200
TIVPGQVLFV PDANISSSTI QLSSSTPGAT VSPSSSDAEY DKLPDADLAR
210 220 230 240 250
KALKPIERVL SSTSEEDEPG VVKFLKMNCR YFTDGKGVVG GVMIVTPNNI
260 270 280 290 300
MFDPHKSDPL VIENGCEEYG LICPMEEVVS IALYSDISHM KIKDALPSDL
310 320 330 340 350
PRDLCPLYRP GEWEDLASEK DINPFSKFKS INKEKRQQNG ERTLALDAKS
360 370 380 390 400
VRSPEESTER TCTRIEPPDN SELWKLKNLQ SSRGTTSESP SVTQLSMRAA
410 420 430 440 450
LEPTAKENCL LKGDEDFVDL EELSSQPESG INKGDATKEC LSYDQKKDGP
460 470 480 490 500
HTVMSAKKGH VQSAQEVMGP ESDTELKGAL DLETAEKQDE APEVDKHSGS
510 520 530 540 550
PENLGESTLN IHEDLDKIKL IEFYLNKNKE GSQLLENVQK SELSDRKSIE
560 570 580 590 600
PGGIDITLSS SLPQAGDSPP EDNKEPGTLW VKGGETLPLK LDPSAEETVI
610 620 630 640 650
NNKEVLDSLG SSLDKMCHSA QMDNKSEIQL WLLKRIQVPI EDILPSKEEK
660 670 680 690 700
SKTPPMFLCI KVGKPMRKSF ASHTATMVQQ YSKRRKQPEY WFAVPRERVD
710 720 730 740 750
HLYTFFVQWS PDVYGKDAKE QGFVVVEKEE LNMIDNFFSE PTTKSWEIIT
760 770 780 790 800
VEEAKRRKST CSYYEEEEEE EEGLPILQPH SALLENMHIE QLARRLPARV
810 820 830 840 850
QGYPWRLAYS TLEHGTSLKT LYRKSASLDS PVLLVIKDMD NQIFGAYATH
860 870 880 890 900
PFKFSDHYYG TGETFLYTFS PNFKVFKWSG ENSYFINGDI SSLELGGGGG
910 920 930 940
RFGLWLDADL YHGRSNSCST FNNDILSKKE DFIVQDLEVW TFE
Length:943
Mass (Da):106,357
Last modified:July 11, 2006 - v2
Checksum:i872D551ACEEE5109
GO
Isoform 2 (identifier: Q6DFV7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     237-271: GVVGGVMIVTPNNIMFDPHKSDPLVIENGCEEYGL → VSATVIAYWSGNLQKLNKKTHCWMGVFYPQLKCMI
     272-943: Missing.

Note: No experimental confirmation available.
Show »
Length:271
Mass (Da):30,630
Checksum:i22636C608F687204
GO
Isoform 3 (identifier: Q6DFV7-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-722: Missing.
     723-747: FVVVEKEELNMIDNFFSEPTTKSWE → MRGRGLPLDIQIFYCARPDQEPFVK

Note: No experimental confirmation available.
Show »
Length:221
Mass (Da):25,450
Checksum:i2BA43AF7D482B98E
GO
Isoform 4 (identifier: Q6DFV7-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-722: Missing.
     723-747: FVVVEKEELNMIDNFFSEPTTKSWE → MRGRGLPLDIQIFYCARPDQEPFVK
     900-943: Missing.

Note: No experimental confirmation available.
Show »
Length:177
Mass (Da):20,300
Checksum:i9EDFA4A2F73C7B37
GO
Isoform 5 (identifier: Q6DFV7-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-722: Missing.
     723-747: FVVVEKEELNMIDNFFSEPTTKSWE → MRGRGLPLDIQIFYCARPDQEPFVK
     875-883: VFKWSGENS → GTIWSVARC
     884-943: Missing.

Note: No experimental confirmation available.
Show »
Length:161
Mass (Da):18,658
Checksum:iC7B65B19EE1B81CF
GO
Isoform 6 (identifier: Q6DFV7-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-722: Missing.
     723-747: FVVVEKEELNMIDNFFSEPTTKSWE → MRGRGLPLDIQIFYCARPDQEPFVK
     875-881: VFKWSGE → PISHLGH
     882-943: Missing.

Note: No experimental confirmation available.
Show »
Length:159
Mass (Da):18,426
Checksum:iC7334C99043E3B9D
GO

Sequence cautioni

The sequence BAC87660 differs from that shown. Reason: Frameshift at position 22.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0196401 – 722Missing in isoform 3, isoform 4, isoform 5 and isoform 6. 2 PublicationsAdd BLAST722
Alternative sequenceiVSP_019641237 – 271GVVGG…EEYGL → VSATVIAYWSGNLQKLNKKT HCWMGVFYPQLKCMI in isoform 2. 1 PublicationAdd BLAST35
Alternative sequenceiVSP_019642272 – 943Missing in isoform 2. 1 PublicationAdd BLAST672
Alternative sequenceiVSP_019643723 – 747FVVVE…TKSWE → MRGRGLPLDIQIFYCARPDQ EPFVK in isoform 3, isoform 4, isoform 5 and isoform 6. 2 PublicationsAdd BLAST25
Alternative sequenceiVSP_019644875 – 883VFKWSGENS → GTIWSVARC in isoform 5. 1 Publication9
Alternative sequenceiVSP_019645875 – 881VFKWSGE → PISHLGH in isoform 6. 1 Publication7
Alternative sequenceiVSP_019646882 – 943Missing in isoform 6. 1 PublicationAdd BLAST62
Alternative sequenceiVSP_019647884 – 943Missing in isoform 5. 1 PublicationAdd BLAST60
Alternative sequenceiVSP_019648900 – 943Missing in isoform 4. 1 PublicationAdd BLAST44

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK128935 mRNA Translation: BAC87660.1 Frameshift.
AK033503 mRNA Translation: BAC28325.1
AK042369 mRNA Translation: BAC31241.1
AK144324 mRNA Translation: BAE25834.1
AK171679 mRNA Translation: BAE42607.1
BC049997 mRNA Translation: AAH49997.1
BC058572 mRNA Translation: AAH58572.1
BC076623 mRNA Translation: AAH76623.1
BC080670 mRNA Translation: AAH80670.1
CCDSiCCDS23765.1 [Q6DFV7-1]
CCDS48530.1 [Q6DFV7-3]
RefSeqiNP_001104737.1, NM_001111267.2 [Q6DFV7-3]
NP_766083.3, NM_172495.5 [Q6DFV7-1]
UniGeneiMm.297903

Genome annotation databases

EnsembliENSMUST00000068567; ENSMUSP00000066741; ENSMUSG00000039697 [Q6DFV7-1]
ENSMUST00000092610; ENSMUSP00000090273; ENSMUSG00000039697 [Q6DFV7-5]
ENSMUST00000213897; ENSMUSP00000148944; ENSMUSG00000039697 [Q6DFV7-6]
ENSMUST00000215725; ENSMUSP00000150800; ENSMUSG00000039697 [Q6DFV7-2]
ENSMUST00000215740; ENSMUSP00000149335; ENSMUSG00000039697 [Q6DFV7-1]
ENSMUST00000216172; ENSMUSP00000150981; ENSMUSG00000039697 [Q6DFV7-3]
ENSMUST00000217644; ENSMUSP00000150671; ENSMUSG00000039697 [Q6DFV7-4]
GeneIDi211329
KEGGimmu:211329
UCSCiuc007etj.2 mouse [Q6DFV7-5]
uc007etk.2 mouse [Q6DFV7-1]
uc007etm.2 mouse [Q6DFV7-4]
uc007eto.2 mouse [Q6DFV7-2]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiNCOA7_MOUSE
AccessioniPrimary (citable) accession number: Q6DFV7
Secondary accession number(s): Q3TAR1
, Q3UNB3, Q66K05, Q6ZQM4, Q8BJ15, Q8BJ39
Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 11, 2006
Last sequence update: July 11, 2006
Last modified: March 28, 2018
This is version 112 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health