Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q6DFV7 (NCOA7_MOUSE) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 82. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (2) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Nuclear receptor coactivator 7
Gene names
Name:Ncoa7
OrganismMus musculus (Mouse) [Reference proteome]
Taxonomic identifier10090 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus

Protein attributes

Sequence length943 AA.
Sequence statusComplete.
Protein existenceEvidence at transcript level

General annotation (Comments)

Function

Enhances the transcriptional activities of several nuclear receptors. Involved in the coactivation of different nuclear receptors, such as ESR1, THRB, PPARG and RARA By similarity.

Subunit structure

Interacts with ESR1, ESR2A, ESR2B, THRB, PPARG and RARA in a ligand-inducible manner. Interacts with the heterodimer AHR-ARNT By similarity.

Subcellular location

Nucleus By similarity.

Tissue specificity

Highly expressed in brain and kidney. Weakly expressed in mammary gland, lung and testis. In brain, expression is found in neurons of cerebral cortex, thalamus, hypothalamus, hippocampus, cerebellum, striatum and choroid plexus. Ref.4

Sequence similarities

Belongs to the OXR1 family.

Contains 1 LysM repeat.

Contains 1 TLD domain.

Sequence caution

The sequence BAC87660.1 differs from that shown. Reason: Frameshift at position 22.

Alternative products

This entry describes 6 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q6DFV7-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q6DFV7-2)

The sequence of this isoform differs from the canonical sequence as follows:
     237-271: GVVGGVMIVTPNNIMFDPHKSDPLVIENGCEEYGL → VSATVIAYWSGNLQKLNKKTHCWMGVFYPQLKCMI
     272-943: Missing.
Note: No experimental confirmation available.
Isoform 3 (identifier: Q6DFV7-3)

The sequence of this isoform differs from the canonical sequence as follows:
     1-722: Missing.
     723-747: FVVVEKEELNMIDNFFSEPTTKSWE → MRGRGLPLDIQIFYCARPDQEPFVK
Note: No experimental confirmation available.
Isoform 4 (identifier: Q6DFV7-4)

The sequence of this isoform differs from the canonical sequence as follows:
     1-722: Missing.
     723-747: FVVVEKEELNMIDNFFSEPTTKSWE → MRGRGLPLDIQIFYCARPDQEPFVK
     900-943: Missing.
Note: No experimental confirmation available.
Isoform 5 (identifier: Q6DFV7-5)

The sequence of this isoform differs from the canonical sequence as follows:
     1-722: Missing.
     723-747: FVVVEKEELNMIDNFFSEPTTKSWE → MRGRGLPLDIQIFYCARPDQEPFVK
     875-883: VFKWSGENS → GTIWSVARC
     884-943: Missing.
Note: No experimental confirmation available.
Isoform 6 (identifier: Q6DFV7-6)

The sequence of this isoform differs from the canonical sequence as follows:
     1-722: Missing.
     723-747: FVVVEKEELNMIDNFFSEPTTKSWE → MRGRGLPLDIQIFYCARPDQEPFVK
     875-881: VFKWSGE → PISHLGH
     882-943: Missing.
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 943943Nuclear receptor coactivator 7
PRO_0000245230

Regions

Repeat119 – 16143LysM
Domain807 – 943137TLD
Coiled coil1 – 3232 Potential

Amino acid modifications

Modified residue11N-acetylmethionine By similarity
Modified residue1821Phosphoserine By similarity
Modified residue1861Phosphoserine By similarity
Modified residue2111Phosphoserine By similarity
Modified residue2141Phosphoserine By similarity
Modified residue4421Phosphoserine By similarity

Natural variations

Alternative sequence1 – 722722Missing in isoform 3, isoform 4, isoform 5 and isoform 6.
VSP_019640
Alternative sequence237 – 27135GVVGG…EEYGL → VSATVIAYWSGNLQKLNKKT HCWMGVFYPQLKCMI in isoform 2.
VSP_019641
Alternative sequence272 – 943672Missing in isoform 2.
VSP_019642
Alternative sequence723 – 74725FVVVE…TKSWE → MRGRGLPLDIQIFYCARPDQ EPFVK in isoform 3, isoform 4, isoform 5 and isoform 6.
VSP_019643
Alternative sequence875 – 8839VFKWSGENS → GTIWSVARC in isoform 5.
VSP_019644
Alternative sequence875 – 8817VFKWSGE → PISHLGH in isoform 6.
VSP_019645
Alternative sequence882 – 94362Missing in isoform 6.
VSP_019646
Alternative sequence884 – 94360Missing in isoform 5.
VSP_019647
Alternative sequence900 – 94344Missing in isoform 4.
VSP_019648

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified July 11, 2006. Version 2.
Checksum: 872D551ACEEE5109

FASTA943106,357
        10         20         30         40         50         60 
MDTKEEKKEQ KERKQSYFAR LKKKKQAKQN AEIVSAASSK SRSGKDDANS DILEQDKFNV 

        70         80         90        100        110        120 
TAEGDHSTDD KKKRKSNQLK EIRRTELKRY YSVDDNQNKT HDKKEKKMMV QKPQGTMEYT 

       130        140        150        160        170        180 
AGSQDTLNSV ALKFNVTPNK LVELNKLFTH TIVPGQVLFV PDANISSSTI QLSSSTPGAT 

       190        200        210        220        230        240 
VSPSSSDAEY DKLPDADLAR KALKPIERVL SSTSEEDEPG VVKFLKMNCR YFTDGKGVVG 

       250        260        270        280        290        300 
GVMIVTPNNI MFDPHKSDPL VIENGCEEYG LICPMEEVVS IALYSDISHM KIKDALPSDL 

       310        320        330        340        350        360 
PRDLCPLYRP GEWEDLASEK DINPFSKFKS INKEKRQQNG ERTLALDAKS VRSPEESTER 

       370        380        390        400        410        420 
TCTRIEPPDN SELWKLKNLQ SSRGTTSESP SVTQLSMRAA LEPTAKENCL LKGDEDFVDL 

       430        440        450        460        470        480 
EELSSQPESG INKGDATKEC LSYDQKKDGP HTVMSAKKGH VQSAQEVMGP ESDTELKGAL 

       490        500        510        520        530        540 
DLETAEKQDE APEVDKHSGS PENLGESTLN IHEDLDKIKL IEFYLNKNKE GSQLLENVQK 

       550        560        570        580        590        600 
SELSDRKSIE PGGIDITLSS SLPQAGDSPP EDNKEPGTLW VKGGETLPLK LDPSAEETVI 

       610        620        630        640        650        660 
NNKEVLDSLG SSLDKMCHSA QMDNKSEIQL WLLKRIQVPI EDILPSKEEK SKTPPMFLCI 

       670        680        690        700        710        720 
KVGKPMRKSF ASHTATMVQQ YSKRRKQPEY WFAVPRERVD HLYTFFVQWS PDVYGKDAKE 

       730        740        750        760        770        780 
QGFVVVEKEE LNMIDNFFSE PTTKSWEIIT VEEAKRRKST CSYYEEEEEE EEGLPILQPH 

       790        800        810        820        830        840 
SALLENMHIE QLARRLPARV QGYPWRLAYS TLEHGTSLKT LYRKSASLDS PVLLVIKDMD 

       850        860        870        880        890        900 
NQIFGAYATH PFKFSDHYYG TGETFLYTFS PNFKVFKWSG ENSYFINGDI SSLELGGGGG 

       910        920        930        940 
RFGLWLDADL YHGRSNSCST FNNDILSKKE DFIVQDLEVW TFE 

« Hide

Isoform 2 [UniParc].

Checksum: 22636C608F687204
Show »

FASTA27130,630
Isoform 3 [UniParc].

Checksum: 2BA43AF7D482B98E
Show »

FASTA22125,450
Isoform 4 [UniParc].

Checksum: 9EDFA4A2F73C7B37
Show »

FASTA17720,300
Isoform 5 [UniParc].

Checksum: C7B65B19EE1B81CF
Show »

FASTA16118,658
Isoform 6 [UniParc].

Checksum: C7334C99043E3B9D
Show »

FASTA15918,426

References

« Hide 'large scale' references
[1]"NEDO cDNA sequencing project."
Ninomiya K., Wagatsuma M., Kanda K., Kondo H., Yokoi T., Kodaira H., Furuya T., Takahashi M., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Sugiyama T., Irie R. expand/collapse author list , Otsuki T., Sato H., Ota T., Wakamatsu A., Ishii S., Yamamoto J., Isono Y., Kawai-Hio Y., Saito K., Nishikawa T., Kimura K., Yamashita H., Matsuo K., Nakamura Y., Sekine M., Kikuchi H., Murakawa K., Kanehori K., Takahashi-Fujii A., Oshima A., Sugiyama A., Kawakami B., Suzuki Y., Sugano S., Nagahari K., Masuho Y., Nagai K., Isogai T.
Submitted (JUL-2003) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
[2]"The transcriptional landscape of the mammalian genome."
Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. expand/collapse author list , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2; 3; 4 AND 5).
Strain: C57BL/6J.
Tissue: Colon, Lung, Spleen and Thymus.
[3]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3 AND 6), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 19-943.
Strain: C57BL/6.
Tissue: Head, Kidney and Mammary gland.
[4]"ERAP140, a conserved tissue-specific nuclear receptor coactivator."
Shao W., Halachmi S., Brown M.
Mol. Cell. Biol. 22:3358-3372(2002) [PubMed] [Europe PMC] [Abstract]
Cited for: TISSUE SPECIFICITY.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AK128935 mRNA. Translation: BAC87660.1. Frameshift.
AK033503 mRNA. Translation: BAC28325.1.
AK042369 mRNA. Translation: BAC31241.1.
AK144324 mRNA. Translation: BAE25834.1.
AK171679 mRNA. Translation: BAE42607.1.
BC049997 mRNA. Translation: AAH49997.1.
BC058572 mRNA. Translation: AAH58572.1.
BC076623 mRNA. Translation: AAH76623.1.
BC080670 mRNA. Translation: AAH80670.1.
RefSeqNP_001104737.1. NM_001111267.2.
NP_766083.3. NM_172495.5.
UniGeneMm.297903.

3D structure databases

ProteinModelPortalQ6DFV7.
SMRQ6DFV7. Positions 86-166, 781-943.
ModBaseSearch...
MobiDBSearch...

PTM databases

PhosphoSiteQ6DFV7.

Proteomic databases

PaxDbQ6DFV7.
PRIDEQ6DFV7.

Protocols and materials databases

DNASU211329.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENSMUST00000068567; ENSMUSP00000066741; ENSMUSG00000039697. [Q6DFV7-1]
ENSMUST00000092610; ENSMUSP00000090273; ENSMUSG00000039697. [Q6DFV7-3]
GeneID211329.
KEGGmmu:211329.
UCSCuc007etj.2. mouse. [Q6DFV7-5]
uc007etk.2. mouse. [Q6DFV7-1]
uc007etm.2. mouse. [Q6DFV7-4]
uc007eto.2. mouse. [Q6DFV7-2]

Organism-specific databases

CTD135112.
MGIMGI:2444847. Ncoa7.

Phylogenomic databases

eggNOGCOG5142.
GeneTreeENSGT00410000025363.
HOVERGENHBG065488.
InParanoidQ6DFV7.
OMAETCEKQD.
OrthoDBEOG77M8PQ.
PhylomeDBQ6DFV7.
TreeFamTF313530.

Gene expression databases

BgeeQ6DFV7.
CleanExMM_NCOA7.
GenevestigatorQ6DFV7.

Family and domain databases

Gene3D3.10.350.10. 1 hit.
InterProIPR018392. LysM_dom.
IPR006571. TLDc.
[Graphical view]
PfamPF01476. LysM. 1 hit.
PF07534. TLD. 1 hit.
[Graphical view]
SMARTSM00257. LysM. 1 hit.
SM00584. TLDc. 1 hit.
[Graphical view]
SUPFAMSSF54106. SSF54106. 1 hit.
ProtoNetSearch...

Other

NextBio373204.
PROQ6DFV7.
SOURCESearch...

Entry information

Entry nameNCOA7_MOUSE
AccessionPrimary (citable) accession number: Q6DFV7
Secondary accession number(s): Q3TAR1 expand/collapse secondary AC list , Q3UNB3, Q66K05, Q6ZQM4, Q8BJ15, Q8BJ39
Entry history
Integrated into UniProtKB/Swiss-Prot: July 11, 2006
Last sequence update: July 11, 2006
Last modified: April 16, 2014
This is version 82 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Relevant documents

SIMILARITY comments

Index of protein domains and families

MGD cross-references

Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot