SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q6DFV7

- NCOA7_MOUSE

UniProt

Q6DFV7 - NCOA7_MOUSE

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Nuclear receptor coactivator 7

Gene
Ncoa7
Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 4 out of 5 - Experimental evidence at transcript leveli

Functioni

Enhances the transcriptional activities of several nuclear receptors. Involved in the coactivation of different nuclear receptors, such as ESR1, THRB, PPARG and RARA By similarity.

GO - Molecular functioni

  1. ligand-dependent nuclear receptor transcription coactivator activity Source: UniProtKB
  2. nuclear hormone receptor binding Source: UniProtKB

GO - Biological processi

  1. positive regulation of transcription from RNA polymerase II promoter Source: UniProtKB
  2. transcription, DNA-templated Source: UniProtKB-KW
Complete GO annotation...

Keywords - Molecular functioni

Activator

Keywords - Biological processi

Transcription, Transcription regulation

Names & Taxonomyi

Protein namesi
Recommended name:
Nuclear receptor coactivator 7
Gene namesi
Name:Ncoa7
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589: Chromosome 10

Organism-specific databases

MGIiMGI:2444847. Ncoa7.

Subcellular locationi

Nucleus By similarity

GO - Cellular componenti

  1. nucleus Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 943943Nuclear receptor coactivator 7PRO_0000245230Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei1 – 11N-acetylmethionine By similarity
Modified residuei182 – 1821Phosphoserine By similarity
Modified residuei186 – 1861Phosphoserine By similarity
Modified residuei211 – 2111Phosphoserine By similarity
Modified residuei214 – 2141Phosphoserine By similarity
Modified residuei442 – 4421Phosphoserine By similarity

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

MaxQBiQ6DFV7.
PaxDbiQ6DFV7.
PRIDEiQ6DFV7.

PTM databases

PhosphoSiteiQ6DFV7.

Expressioni

Tissue specificityi

Highly expressed in brain and kidney. Weakly expressed in mammary gland, lung and testis. In brain, expression is found in neurons of cerebral cortex, thalamus, hypothalamus, hippocampus, cerebellum, striatum and choroid plexus.1 Publication

Gene expression databases

BgeeiQ6DFV7.
CleanExiMM_NCOA7.
GenevestigatoriQ6DFV7.

Interactioni

Subunit structurei

Interacts with ESR1, ESR2A, ESR2B, THRB, PPARG and RARA in a ligand-inducible manner. Interacts with the heterodimer AHR-ARNT By similarity.

Structurei

3D structure databases

ProteinModelPortaliQ6DFV7.
SMRiQ6DFV7. Positions 781-943.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Repeati119 – 16143LysMAdd
BLAST
Domaini807 – 943137TLDAdd
BLAST

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili1 – 3232 Reviewed predictionAdd
BLAST

Sequence similaritiesi

Belongs to the OXR1 family.
Contains 1 LysM repeat.
Contains 1 TLD domain.

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiCOG5142.
GeneTreeiENSGT00410000025363.
HOVERGENiHBG065488.
InParanoidiQ6DFV7.
OMAiETCEKQD.
OrthoDBiEOG77M8PQ.
PhylomeDBiQ6DFV7.
TreeFamiTF313530.

Family and domain databases

Gene3Di3.10.350.10. 1 hit.
InterProiIPR018392. LysM_dom.
IPR006571. TLDc.
[Graphical view]
PfamiPF01476. LysM. 1 hit.
PF07534. TLD. 1 hit.
[Graphical view]
SMARTiSM00257. LysM. 1 hit.
SM00584. TLDc. 1 hit.
[Graphical view]
SUPFAMiSSF54106. SSF54106. 1 hit.

Sequences (6)i

Sequence statusi: Complete.

This entry describes 6 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q6DFV7-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MDTKEEKKEQ KERKQSYFAR LKKKKQAKQN AEIVSAASSK SRSGKDDANS    50
DILEQDKFNV TAEGDHSTDD KKKRKSNQLK EIRRTELKRY YSVDDNQNKT 100
HDKKEKKMMV QKPQGTMEYT AGSQDTLNSV ALKFNVTPNK LVELNKLFTH 150
TIVPGQVLFV PDANISSSTI QLSSSTPGAT VSPSSSDAEY DKLPDADLAR 200
KALKPIERVL SSTSEEDEPG VVKFLKMNCR YFTDGKGVVG GVMIVTPNNI 250
MFDPHKSDPL VIENGCEEYG LICPMEEVVS IALYSDISHM KIKDALPSDL 300
PRDLCPLYRP GEWEDLASEK DINPFSKFKS INKEKRQQNG ERTLALDAKS 350
VRSPEESTER TCTRIEPPDN SELWKLKNLQ SSRGTTSESP SVTQLSMRAA 400
LEPTAKENCL LKGDEDFVDL EELSSQPESG INKGDATKEC LSYDQKKDGP 450
HTVMSAKKGH VQSAQEVMGP ESDTELKGAL DLETAEKQDE APEVDKHSGS 500
PENLGESTLN IHEDLDKIKL IEFYLNKNKE GSQLLENVQK SELSDRKSIE 550
PGGIDITLSS SLPQAGDSPP EDNKEPGTLW VKGGETLPLK LDPSAEETVI 600
NNKEVLDSLG SSLDKMCHSA QMDNKSEIQL WLLKRIQVPI EDILPSKEEK 650
SKTPPMFLCI KVGKPMRKSF ASHTATMVQQ YSKRRKQPEY WFAVPRERVD 700
HLYTFFVQWS PDVYGKDAKE QGFVVVEKEE LNMIDNFFSE PTTKSWEIIT 750
VEEAKRRKST CSYYEEEEEE EEGLPILQPH SALLENMHIE QLARRLPARV 800
QGYPWRLAYS TLEHGTSLKT LYRKSASLDS PVLLVIKDMD NQIFGAYATH 850
PFKFSDHYYG TGETFLYTFS PNFKVFKWSG ENSYFINGDI SSLELGGGGG 900
RFGLWLDADL YHGRSNSCST FNNDILSKKE DFIVQDLEVW TFE 943
Length:943
Mass (Da):106,357
Last modified:July 11, 2006 - v2
Checksum:i872D551ACEEE5109
GO
Isoform 2 (identifier: Q6DFV7-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     237-271: GVVGGVMIVTPNNIMFDPHKSDPLVIENGCEEYGL → VSATVIAYWSGNLQKLNKKTHCWMGVFYPQLKCMI
     272-943: Missing.

Note: No experimental confirmation available.

Show »
Length:271
Mass (Da):30,630
Checksum:i22636C608F687204
GO
Isoform 3 (identifier: Q6DFV7-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-722: Missing.
     723-747: FVVVEKEELNMIDNFFSEPTTKSWE → MRGRGLPLDIQIFYCARPDQEPFVK

Note: No experimental confirmation available.

Show »
Length:221
Mass (Da):25,450
Checksum:i2BA43AF7D482B98E
GO
Isoform 4 (identifier: Q6DFV7-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-722: Missing.
     723-747: FVVVEKEELNMIDNFFSEPTTKSWE → MRGRGLPLDIQIFYCARPDQEPFVK
     900-943: Missing.

Note: No experimental confirmation available.

Show »
Length:177
Mass (Da):20,300
Checksum:i9EDFA4A2F73C7B37
GO
Isoform 5 (identifier: Q6DFV7-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-722: Missing.
     723-747: FVVVEKEELNMIDNFFSEPTTKSWE → MRGRGLPLDIQIFYCARPDQEPFVK
     875-883: VFKWSGENS → GTIWSVARC
     884-943: Missing.

Note: No experimental confirmation available.

Show »
Length:161
Mass (Da):18,658
Checksum:iC7B65B19EE1B81CF
GO
Isoform 6 (identifier: Q6DFV7-6) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-722: Missing.
     723-747: FVVVEKEELNMIDNFFSEPTTKSWE → MRGRGLPLDIQIFYCARPDQEPFVK
     875-881: VFKWSGE → PISHLGH
     882-943: Missing.

Note: No experimental confirmation available.

Show »
Length:159
Mass (Da):18,426
Checksum:iC7334C99043E3B9D
GO

Sequence cautioni

The sequence BAC87660.1 differs from that shown. Reason: Frameshift at position 22.

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 722722Missing in isoform 3, isoform 4, isoform 5 and isoform 6. VSP_019640Add
BLAST
Alternative sequencei237 – 27135GVVGG…EEYGL → VSATVIAYWSGNLQKLNKKT HCWMGVFYPQLKCMI in isoform 2. VSP_019641Add
BLAST
Alternative sequencei272 – 943672Missing in isoform 2. VSP_019642Add
BLAST
Alternative sequencei723 – 74725FVVVE…TKSWE → MRGRGLPLDIQIFYCARPDQ EPFVK in isoform 3, isoform 4, isoform 5 and isoform 6. VSP_019643Add
BLAST
Alternative sequencei875 – 8839VFKWSGENS → GTIWSVARC in isoform 5. VSP_019644
Alternative sequencei875 – 8817VFKWSGE → PISHLGH in isoform 6. VSP_019645
Alternative sequencei882 – 94362Missing in isoform 6. VSP_019646Add
BLAST
Alternative sequencei884 – 94360Missing in isoform 5. VSP_019647Add
BLAST
Alternative sequencei900 – 94344Missing in isoform 4. VSP_019648Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AK128935 mRNA. Translation: BAC87660.1. Frameshift.
AK033503 mRNA. Translation: BAC28325.1.
AK042369 mRNA. Translation: BAC31241.1.
AK144324 mRNA. Translation: BAE25834.1.
AK171679 mRNA. Translation: BAE42607.1.
BC049997 mRNA. Translation: AAH49997.1.
BC058572 mRNA. Translation: AAH58572.1.
BC076623 mRNA. Translation: AAH76623.1.
BC080670 mRNA. Translation: AAH80670.1.
CCDSiCCDS23765.1. [Q6DFV7-1]
CCDS48530.1. [Q6DFV7-3]
RefSeqiNP_001104737.1. NM_001111267.2. [Q6DFV7-3]
NP_766083.3. NM_172495.5. [Q6DFV7-1]
UniGeneiMm.297903.

Genome annotation databases

EnsembliENSMUST00000068567; ENSMUSP00000066741; ENSMUSG00000039697. [Q6DFV7-1]
ENSMUST00000092610; ENSMUSP00000090273; ENSMUSG00000039697. [Q6DFV7-3]
GeneIDi211329.
KEGGimmu:211329.
UCSCiuc007etj.2. mouse. [Q6DFV7-5]
uc007etk.2. mouse. [Q6DFV7-1]
uc007etm.2. mouse. [Q6DFV7-4]
uc007eto.2. mouse. [Q6DFV7-2]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AK128935 mRNA. Translation: BAC87660.1 . Frameshift.
AK033503 mRNA. Translation: BAC28325.1 .
AK042369 mRNA. Translation: BAC31241.1 .
AK144324 mRNA. Translation: BAE25834.1 .
AK171679 mRNA. Translation: BAE42607.1 .
BC049997 mRNA. Translation: AAH49997.1 .
BC058572 mRNA. Translation: AAH58572.1 .
BC076623 mRNA. Translation: AAH76623.1 .
BC080670 mRNA. Translation: AAH80670.1 .
CCDSi CCDS23765.1. [Q6DFV7-1 ]
CCDS48530.1. [Q6DFV7-3 ]
RefSeqi NP_001104737.1. NM_001111267.2. [Q6DFV7-3 ]
NP_766083.3. NM_172495.5. [Q6DFV7-1 ]
UniGenei Mm.297903.

3D structure databases

ProteinModelPortali Q6DFV7.
SMRi Q6DFV7. Positions 781-943.
ModBasei Search...
MobiDBi Search...

PTM databases

PhosphoSitei Q6DFV7.

Proteomic databases

MaxQBi Q6DFV7.
PaxDbi Q6DFV7.
PRIDEi Q6DFV7.

Protocols and materials databases

DNASUi 211329.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENSMUST00000068567 ; ENSMUSP00000066741 ; ENSMUSG00000039697 . [Q6DFV7-1 ]
ENSMUST00000092610 ; ENSMUSP00000090273 ; ENSMUSG00000039697 . [Q6DFV7-3 ]
GeneIDi 211329.
KEGGi mmu:211329.
UCSCi uc007etj.2. mouse. [Q6DFV7-5 ]
uc007etk.2. mouse. [Q6DFV7-1 ]
uc007etm.2. mouse. [Q6DFV7-4 ]
uc007eto.2. mouse. [Q6DFV7-2 ]

Organism-specific databases

CTDi 135112.
MGIi MGI:2444847. Ncoa7.

Phylogenomic databases

eggNOGi COG5142.
GeneTreei ENSGT00410000025363.
HOVERGENi HBG065488.
InParanoidi Q6DFV7.
OMAi ETCEKQD.
OrthoDBi EOG77M8PQ.
PhylomeDBi Q6DFV7.
TreeFami TF313530.

Miscellaneous databases

NextBioi 373204.
PROi Q6DFV7.
SOURCEi Search...

Gene expression databases

Bgeei Q6DFV7.
CleanExi MM_NCOA7.
Genevestigatori Q6DFV7.

Family and domain databases

Gene3Di 3.10.350.10. 1 hit.
InterProi IPR018392. LysM_dom.
IPR006571. TLDc.
[Graphical view ]
Pfami PF01476. LysM. 1 hit.
PF07534. TLD. 1 hit.
[Graphical view ]
SMARTi SM00257. LysM. 1 hit.
SM00584. TLDc. 1 hit.
[Graphical view ]
SUPFAMi SSF54106. SSF54106. 1 hit.
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
  2. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2; 3; 4 AND 5).
    Strain: C57BL/6J.
    Tissue: Colon, Lung, Spleen and Thymus.
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3 AND 6), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 19-943.
    Strain: C57BL/6.
    Tissue: Head, Kidney and Mammary gland.
  4. "ERAP140, a conserved tissue-specific nuclear receptor coactivator."
    Shao W., Halachmi S., Brown M.
    Mol. Cell. Biol. 22:3358-3372(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: TISSUE SPECIFICITY.

Entry informationi

Entry nameiNCOA7_MOUSE
AccessioniPrimary (citable) accession number: Q6DFV7
Secondary accession number(s): Q3TAR1
, Q3UNB3, Q66K05, Q6ZQM4, Q8BJ15, Q8BJ39
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 11, 2006
Last sequence update: July 11, 2006
Last modified: September 3, 2014
This is version 86 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi