Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Nuclear receptor coactivator 7

Gene

Ncoa7

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Enhances the transcriptional activities of several nuclear receptors. Involved in the coactivation of different nuclear receptors, such as ESR1, THRB, PPARG and RARA (By similarity).By similarity

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Activator

Keywords - Biological processi

Transcription, Transcription regulation

Names & Taxonomyi

Protein namesi
Recommended name:
Nuclear receptor coactivator 7
Gene namesi
Name:Ncoa7
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 10

Organism-specific databases

MGIiMGI:2444847. Ncoa7.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002452301 – 943Nuclear receptor coactivator 7Add BLAST943

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei1N-acetylmethionineBy similarity1
Modified residuei92PhosphoserineCombined sources1
Modified residuei137PhosphothreonineBy similarity1
Modified residuei182PhosphoserineBy similarity1
Modified residuei186PhosphoserineBy similarity1
Modified residuei211PhosphoserineCombined sources1
Modified residuei212PhosphoserineCombined sources1
Modified residuei214PhosphoserineCombined sources1
Modified residuei442PhosphoserineBy similarity1
Modified residuei498PhosphoserineCombined sources1
Modified residuei500PhosphoserineCombined sources1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

PaxDbiQ6DFV7.
PeptideAtlasiQ6DFV7.
PRIDEiQ6DFV7.

PTM databases

iPTMnetiQ6DFV7.
PhosphoSitePlusiQ6DFV7.

Expressioni

Tissue specificityi

Highly expressed in brain and kidney. Weakly expressed in mammary gland, lung and testis. In brain, expression is found in neurons of cerebral cortex, thalamus, hypothalamus, hippocampus, cerebellum, striatum and choroid plexus.1 Publication

Gene expression databases

BgeeiENSMUSG00000039697.
CleanExiMM_NCOA7.
ExpressionAtlasiQ6DFV7. baseline and differential.
GenevisibleiQ6DFV7. MM.

Interactioni

Subunit structurei

Interacts with ESR1, ESR2A, ESR2B, THRB, PPARG and RARA in a ligand-inducible manner. Interacts with the heterodimer AHR-ARNT (By similarity).By similarity

GO - Molecular functioni

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000066741.

Structurei

3D structure databases

ProteinModelPortaliQ6DFV7.
SMRiQ6DFV7.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini117 – 160LysMPROSITE-ProRule annotationAdd BLAST44
Domaini807 – 943TLDAdd BLAST137

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili1 – 32Sequence analysisAdd BLAST32

Sequence similaritiesi

Belongs to the OXR1 family.Curated
Contains 1 LysM domain.PROSITE-ProRule annotation
Contains 1 TLD domain.Curated

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiENOG410KCPQ. Eukaryota.
ENOG4110T63. LUCA.
GeneTreeiENSGT00410000025363.
HOVERGENiHBG065488.
InParanoidiQ6DFV7.
OMAiIQVPIED.
OrthoDBiEOG091G0L15.
PhylomeDBiQ6DFV7.
TreeFamiTF313530.

Family and domain databases

CDDicd00118. LysM. 1 hit.
Gene3Di3.10.350.10. 1 hit.
InterProiIPR018392. LysM_dom.
IPR006571. TLDc_dom.
[Graphical view]
PfamiPF01476. LysM. 1 hit.
PF07534. TLD. 1 hit.
[Graphical view]
SMARTiSM00257. LysM. 1 hit.
SM00584. TLDc. 1 hit.
[Graphical view]
SUPFAMiSSF54106. SSF54106. 1 hit.
PROSITEiPS51782. LYSM. 1 hit.
[Graphical view]

Sequences (6)i

Sequence statusi: Complete.

This entry describes 6 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q6DFV7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MDTKEEKKEQ KERKQSYFAR LKKKKQAKQN AEIVSAASSK SRSGKDDANS
60 70 80 90 100
DILEQDKFNV TAEGDHSTDD KKKRKSNQLK EIRRTELKRY YSVDDNQNKT
110 120 130 140 150
HDKKEKKMMV QKPQGTMEYT AGSQDTLNSV ALKFNVTPNK LVELNKLFTH
160 170 180 190 200
TIVPGQVLFV PDANISSSTI QLSSSTPGAT VSPSSSDAEY DKLPDADLAR
210 220 230 240 250
KALKPIERVL SSTSEEDEPG VVKFLKMNCR YFTDGKGVVG GVMIVTPNNI
260 270 280 290 300
MFDPHKSDPL VIENGCEEYG LICPMEEVVS IALYSDISHM KIKDALPSDL
310 320 330 340 350
PRDLCPLYRP GEWEDLASEK DINPFSKFKS INKEKRQQNG ERTLALDAKS
360 370 380 390 400
VRSPEESTER TCTRIEPPDN SELWKLKNLQ SSRGTTSESP SVTQLSMRAA
410 420 430 440 450
LEPTAKENCL LKGDEDFVDL EELSSQPESG INKGDATKEC LSYDQKKDGP
460 470 480 490 500
HTVMSAKKGH VQSAQEVMGP ESDTELKGAL DLETAEKQDE APEVDKHSGS
510 520 530 540 550
PENLGESTLN IHEDLDKIKL IEFYLNKNKE GSQLLENVQK SELSDRKSIE
560 570 580 590 600
PGGIDITLSS SLPQAGDSPP EDNKEPGTLW VKGGETLPLK LDPSAEETVI
610 620 630 640 650
NNKEVLDSLG SSLDKMCHSA QMDNKSEIQL WLLKRIQVPI EDILPSKEEK
660 670 680 690 700
SKTPPMFLCI KVGKPMRKSF ASHTATMVQQ YSKRRKQPEY WFAVPRERVD
710 720 730 740 750
HLYTFFVQWS PDVYGKDAKE QGFVVVEKEE LNMIDNFFSE PTTKSWEIIT
760 770 780 790 800
VEEAKRRKST CSYYEEEEEE EEGLPILQPH SALLENMHIE QLARRLPARV
810 820 830 840 850
QGYPWRLAYS TLEHGTSLKT LYRKSASLDS PVLLVIKDMD NQIFGAYATH
860 870 880 890 900
PFKFSDHYYG TGETFLYTFS PNFKVFKWSG ENSYFINGDI SSLELGGGGG
910 920 930 940
RFGLWLDADL YHGRSNSCST FNNDILSKKE DFIVQDLEVW TFE
Length:943
Mass (Da):106,357
Last modified:July 11, 2006 - v2
Checksum:i872D551ACEEE5109
GO
Isoform 2 (identifier: Q6DFV7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     237-271: GVVGGVMIVTPNNIMFDPHKSDPLVIENGCEEYGL → VSATVIAYWSGNLQKLNKKTHCWMGVFYPQLKCMI
     272-943: Missing.

Note: No experimental confirmation available.
Show »
Length:271
Mass (Da):30,630
Checksum:i22636C608F687204
GO
Isoform 3 (identifier: Q6DFV7-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-722: Missing.
     723-747: FVVVEKEELNMIDNFFSEPTTKSWE → MRGRGLPLDIQIFYCARPDQEPFVK

Note: No experimental confirmation available.
Show »
Length:221
Mass (Da):25,450
Checksum:i2BA43AF7D482B98E
GO
Isoform 4 (identifier: Q6DFV7-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-722: Missing.
     723-747: FVVVEKEELNMIDNFFSEPTTKSWE → MRGRGLPLDIQIFYCARPDQEPFVK
     900-943: Missing.

Note: No experimental confirmation available.
Show »
Length:177
Mass (Da):20,300
Checksum:i9EDFA4A2F73C7B37
GO
Isoform 5 (identifier: Q6DFV7-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-722: Missing.
     723-747: FVVVEKEELNMIDNFFSEPTTKSWE → MRGRGLPLDIQIFYCARPDQEPFVK
     875-883: VFKWSGENS → GTIWSVARC
     884-943: Missing.

Note: No experimental confirmation available.
Show »
Length:161
Mass (Da):18,658
Checksum:iC7B65B19EE1B81CF
GO
Isoform 6 (identifier: Q6DFV7-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-722: Missing.
     723-747: FVVVEKEELNMIDNFFSEPTTKSWE → MRGRGLPLDIQIFYCARPDQEPFVK
     875-881: VFKWSGE → PISHLGH
     882-943: Missing.

Note: No experimental confirmation available.
Show »
Length:159
Mass (Da):18,426
Checksum:iC7334C99043E3B9D
GO

Sequence cautioni

The sequence BAC87660 differs from that shown. Reason: Frameshift at position 22.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0196401 – 722Missing in isoform 3, isoform 4, isoform 5 and isoform 6. 2 PublicationsAdd BLAST722
Alternative sequenceiVSP_019641237 – 271GVVGG…EEYGL → VSATVIAYWSGNLQKLNKKT HCWMGVFYPQLKCMI in isoform 2. 1 PublicationAdd BLAST35
Alternative sequenceiVSP_019642272 – 943Missing in isoform 2. 1 PublicationAdd BLAST672
Alternative sequenceiVSP_019643723 – 747FVVVE…TKSWE → MRGRGLPLDIQIFYCARPDQ EPFVK in isoform 3, isoform 4, isoform 5 and isoform 6. 2 PublicationsAdd BLAST25
Alternative sequenceiVSP_019644875 – 883VFKWSGENS → GTIWSVARC in isoform 5. 1 Publication9
Alternative sequenceiVSP_019645875 – 881VFKWSGE → PISHLGH in isoform 6. 1 Publication7
Alternative sequenceiVSP_019646882 – 943Missing in isoform 6. 1 PublicationAdd BLAST62
Alternative sequenceiVSP_019647884 – 943Missing in isoform 5. 1 PublicationAdd BLAST60
Alternative sequenceiVSP_019648900 – 943Missing in isoform 4. 1 PublicationAdd BLAST44

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK128935 mRNA. Translation: BAC87660.1. Frameshift.
AK033503 mRNA. Translation: BAC28325.1.
AK042369 mRNA. Translation: BAC31241.1.
AK144324 mRNA. Translation: BAE25834.1.
AK171679 mRNA. Translation: BAE42607.1.
BC049997 mRNA. Translation: AAH49997.1.
BC058572 mRNA. Translation: AAH58572.1.
BC076623 mRNA. Translation: AAH76623.1.
BC080670 mRNA. Translation: AAH80670.1.
CCDSiCCDS23765.1. [Q6DFV7-1]
CCDS48530.1. [Q6DFV7-3]
RefSeqiNP_001104737.1. NM_001111267.2. [Q6DFV7-3]
NP_766083.3. NM_172495.5. [Q6DFV7-1]
UniGeneiMm.297903.

Genome annotation databases

EnsembliENSMUST00000068567; ENSMUSP00000066741; ENSMUSG00000039697. [Q6DFV7-1]
ENSMUST00000092610; ENSMUSP00000090273; ENSMUSG00000039697. [Q6DFV7-3]
GeneIDi211329.
KEGGimmu:211329.
UCSCiuc007etj.2. mouse. [Q6DFV7-5]
uc007etk.2. mouse. [Q6DFV7-1]
uc007etm.2. mouse. [Q6DFV7-4]
uc007eto.2. mouse. [Q6DFV7-2]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK128935 mRNA. Translation: BAC87660.1. Frameshift.
AK033503 mRNA. Translation: BAC28325.1.
AK042369 mRNA. Translation: BAC31241.1.
AK144324 mRNA. Translation: BAE25834.1.
AK171679 mRNA. Translation: BAE42607.1.
BC049997 mRNA. Translation: AAH49997.1.
BC058572 mRNA. Translation: AAH58572.1.
BC076623 mRNA. Translation: AAH76623.1.
BC080670 mRNA. Translation: AAH80670.1.
CCDSiCCDS23765.1. [Q6DFV7-1]
CCDS48530.1. [Q6DFV7-3]
RefSeqiNP_001104737.1. NM_001111267.2. [Q6DFV7-3]
NP_766083.3. NM_172495.5. [Q6DFV7-1]
UniGeneiMm.297903.

3D structure databases

ProteinModelPortaliQ6DFV7.
SMRiQ6DFV7.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000066741.

PTM databases

iPTMnetiQ6DFV7.
PhosphoSitePlusiQ6DFV7.

Proteomic databases

PaxDbiQ6DFV7.
PeptideAtlasiQ6DFV7.
PRIDEiQ6DFV7.

Protocols and materials databases

DNASUi211329.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000068567; ENSMUSP00000066741; ENSMUSG00000039697. [Q6DFV7-1]
ENSMUST00000092610; ENSMUSP00000090273; ENSMUSG00000039697. [Q6DFV7-3]
GeneIDi211329.
KEGGimmu:211329.
UCSCiuc007etj.2. mouse. [Q6DFV7-5]
uc007etk.2. mouse. [Q6DFV7-1]
uc007etm.2. mouse. [Q6DFV7-4]
uc007eto.2. mouse. [Q6DFV7-2]

Organism-specific databases

CTDi135112.
MGIiMGI:2444847. Ncoa7.

Phylogenomic databases

eggNOGiENOG410KCPQ. Eukaryota.
ENOG4110T63. LUCA.
GeneTreeiENSGT00410000025363.
HOVERGENiHBG065488.
InParanoidiQ6DFV7.
OMAiIQVPIED.
OrthoDBiEOG091G0L15.
PhylomeDBiQ6DFV7.
TreeFamiTF313530.

Miscellaneous databases

PROiQ6DFV7.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000039697.
CleanExiMM_NCOA7.
ExpressionAtlasiQ6DFV7. baseline and differential.
GenevisibleiQ6DFV7. MM.

Family and domain databases

CDDicd00118. LysM. 1 hit.
Gene3Di3.10.350.10. 1 hit.
InterProiIPR018392. LysM_dom.
IPR006571. TLDc_dom.
[Graphical view]
PfamiPF01476. LysM. 1 hit.
PF07534. TLD. 1 hit.
[Graphical view]
SMARTiSM00257. LysM. 1 hit.
SM00584. TLDc. 1 hit.
[Graphical view]
SUPFAMiSSF54106. SSF54106. 1 hit.
PROSITEiPS51782. LYSM. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiNCOA7_MOUSE
AccessioniPrimary (citable) accession number: Q6DFV7
Secondary accession number(s): Q3TAR1
, Q3UNB3, Q66K05, Q6ZQM4, Q8BJ15, Q8BJ39
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 11, 2006
Last sequence update: July 11, 2006
Last modified: November 30, 2016
This is version 105 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.