Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q6DFV7

- NCOA7_MOUSE

UniProt

Q6DFV7 - NCOA7_MOUSE

Protein

Nuclear receptor coactivator 7

Gene

Ncoa7

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 87 (01 Oct 2014)
      Sequence version 2 (11 Jul 2006)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Enhances the transcriptional activities of several nuclear receptors. Involved in the coactivation of different nuclear receptors, such as ESR1, THRB, PPARG and RARA By similarity.By similarity

    GO - Molecular functioni

    1. ligand-dependent nuclear receptor transcription coactivator activity Source: UniProtKB
    2. nuclear hormone receptor binding Source: UniProtKB

    GO - Biological processi

    1. positive regulation of transcription from RNA polymerase II promoter Source: UniProtKB
    2. transcription, DNA-templated Source: UniProtKB-KW

    Keywords - Molecular functioni

    Activator

    Keywords - Biological processi

    Transcription, Transcription regulation

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Nuclear receptor coactivator 7
    Gene namesi
    Name:Ncoa7
    OrganismiMus musculus (Mouse)
    Taxonomic identifieri10090 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
    ProteomesiUP000000589: Chromosome 10

    Organism-specific databases

    MGIiMGI:2444847. Ncoa7.

    Subcellular locationi

    Nucleus By similarity

    GO - Cellular componenti

    1. nucleus Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Nucleus

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 943943Nuclear receptor coactivator 7PRO_0000245230Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei1 – 11N-acetylmethionineBy similarity
    Modified residuei182 – 1821PhosphoserineBy similarity
    Modified residuei186 – 1861PhosphoserineBy similarity
    Modified residuei211 – 2111PhosphoserineBy similarity
    Modified residuei214 – 2141PhosphoserineBy similarity
    Modified residuei442 – 4421PhosphoserineBy similarity

    Keywords - PTMi

    Acetylation, Phosphoprotein

    Proteomic databases

    MaxQBiQ6DFV7.
    PaxDbiQ6DFV7.
    PRIDEiQ6DFV7.

    PTM databases

    PhosphoSiteiQ6DFV7.

    Expressioni

    Tissue specificityi

    Highly expressed in brain and kidney. Weakly expressed in mammary gland, lung and testis. In brain, expression is found in neurons of cerebral cortex, thalamus, hypothalamus, hippocampus, cerebellum, striatum and choroid plexus.1 Publication

    Gene expression databases

    BgeeiQ6DFV7.
    CleanExiMM_NCOA7.
    GenevestigatoriQ6DFV7.

    Interactioni

    Subunit structurei

    Interacts with ESR1, ESR2A, ESR2B, THRB, PPARG and RARA in a ligand-inducible manner. Interacts with the heterodimer AHR-ARNT By similarity.By similarity

    Structurei

    3D structure databases

    ProteinModelPortaliQ6DFV7.
    SMRiQ6DFV7. Positions 781-943.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Repeati119 – 16143LysMAdd
    BLAST
    Domaini807 – 943137TLDAdd
    BLAST

    Coiled coil

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Coiled coili1 – 3232Sequence AnalysisAdd
    BLAST

    Sequence similaritiesi

    Belongs to the OXR1 family.Curated
    Contains 1 LysM repeat.Curated
    Contains 1 TLD domain.Curated

    Keywords - Domaini

    Coiled coil

    Phylogenomic databases

    eggNOGiCOG5142.
    GeneTreeiENSGT00410000025363.
    HOVERGENiHBG065488.
    InParanoidiQ6DFV7.
    OMAiETCEKQD.
    OrthoDBiEOG77M8PQ.
    PhylomeDBiQ6DFV7.
    TreeFamiTF313530.

    Family and domain databases

    Gene3Di3.10.350.10. 1 hit.
    InterProiIPR018392. LysM_dom.
    IPR006571. TLDc.
    [Graphical view]
    PfamiPF01476. LysM. 1 hit.
    PF07534. TLD. 1 hit.
    [Graphical view]
    SMARTiSM00257. LysM. 1 hit.
    SM00584. TLDc. 1 hit.
    [Graphical view]
    SUPFAMiSSF54106. SSF54106. 1 hit.

    Sequences (6)i

    Sequence statusi: Complete.

    This entry describes 6 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q6DFV7-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MDTKEEKKEQ KERKQSYFAR LKKKKQAKQN AEIVSAASSK SRSGKDDANS    50
    DILEQDKFNV TAEGDHSTDD KKKRKSNQLK EIRRTELKRY YSVDDNQNKT 100
    HDKKEKKMMV QKPQGTMEYT AGSQDTLNSV ALKFNVTPNK LVELNKLFTH 150
    TIVPGQVLFV PDANISSSTI QLSSSTPGAT VSPSSSDAEY DKLPDADLAR 200
    KALKPIERVL SSTSEEDEPG VVKFLKMNCR YFTDGKGVVG GVMIVTPNNI 250
    MFDPHKSDPL VIENGCEEYG LICPMEEVVS IALYSDISHM KIKDALPSDL 300
    PRDLCPLYRP GEWEDLASEK DINPFSKFKS INKEKRQQNG ERTLALDAKS 350
    VRSPEESTER TCTRIEPPDN SELWKLKNLQ SSRGTTSESP SVTQLSMRAA 400
    LEPTAKENCL LKGDEDFVDL EELSSQPESG INKGDATKEC LSYDQKKDGP 450
    HTVMSAKKGH VQSAQEVMGP ESDTELKGAL DLETAEKQDE APEVDKHSGS 500
    PENLGESTLN IHEDLDKIKL IEFYLNKNKE GSQLLENVQK SELSDRKSIE 550
    PGGIDITLSS SLPQAGDSPP EDNKEPGTLW VKGGETLPLK LDPSAEETVI 600
    NNKEVLDSLG SSLDKMCHSA QMDNKSEIQL WLLKRIQVPI EDILPSKEEK 650
    SKTPPMFLCI KVGKPMRKSF ASHTATMVQQ YSKRRKQPEY WFAVPRERVD 700
    HLYTFFVQWS PDVYGKDAKE QGFVVVEKEE LNMIDNFFSE PTTKSWEIIT 750
    VEEAKRRKST CSYYEEEEEE EEGLPILQPH SALLENMHIE QLARRLPARV 800
    QGYPWRLAYS TLEHGTSLKT LYRKSASLDS PVLLVIKDMD NQIFGAYATH 850
    PFKFSDHYYG TGETFLYTFS PNFKVFKWSG ENSYFINGDI SSLELGGGGG 900
    RFGLWLDADL YHGRSNSCST FNNDILSKKE DFIVQDLEVW TFE 943
    Length:943
    Mass (Da):106,357
    Last modified:July 11, 2006 - v2
    Checksum:i872D551ACEEE5109
    GO
    Isoform 2 (identifier: Q6DFV7-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         237-271: GVVGGVMIVTPNNIMFDPHKSDPLVIENGCEEYGL → VSATVIAYWSGNLQKLNKKTHCWMGVFYPQLKCMI
         272-943: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:271
    Mass (Da):30,630
    Checksum:i22636C608F687204
    GO
    Isoform 3 (identifier: Q6DFV7-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-722: Missing.
         723-747: FVVVEKEELNMIDNFFSEPTTKSWE → MRGRGLPLDIQIFYCARPDQEPFVK

    Note: No experimental confirmation available.

    Show »
    Length:221
    Mass (Da):25,450
    Checksum:i2BA43AF7D482B98E
    GO
    Isoform 4 (identifier: Q6DFV7-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-722: Missing.
         723-747: FVVVEKEELNMIDNFFSEPTTKSWE → MRGRGLPLDIQIFYCARPDQEPFVK
         900-943: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:177
    Mass (Da):20,300
    Checksum:i9EDFA4A2F73C7B37
    GO
    Isoform 5 (identifier: Q6DFV7-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-722: Missing.
         723-747: FVVVEKEELNMIDNFFSEPTTKSWE → MRGRGLPLDIQIFYCARPDQEPFVK
         875-883: VFKWSGENS → GTIWSVARC
         884-943: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:161
    Mass (Da):18,658
    Checksum:iC7B65B19EE1B81CF
    GO
    Isoform 6 (identifier: Q6DFV7-6) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-722: Missing.
         723-747: FVVVEKEELNMIDNFFSEPTTKSWE → MRGRGLPLDIQIFYCARPDQEPFVK
         875-881: VFKWSGE → PISHLGH
         882-943: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:159
    Mass (Da):18,426
    Checksum:iC7334C99043E3B9D
    GO

    Sequence cautioni

    The sequence BAC87660.1 differs from that shown. Reason: Frameshift at position 22.

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 722722Missing in isoform 3, isoform 4, isoform 5 and isoform 6. 2 PublicationsVSP_019640Add
    BLAST
    Alternative sequencei237 – 27135GVVGG…EEYGL → VSATVIAYWSGNLQKLNKKT HCWMGVFYPQLKCMI in isoform 2. 1 PublicationVSP_019641Add
    BLAST
    Alternative sequencei272 – 943672Missing in isoform 2. 1 PublicationVSP_019642Add
    BLAST
    Alternative sequencei723 – 74725FVVVE…TKSWE → MRGRGLPLDIQIFYCARPDQ EPFVK in isoform 3, isoform 4, isoform 5 and isoform 6. 2 PublicationsVSP_019643Add
    BLAST
    Alternative sequencei875 – 8839VFKWSGENS → GTIWSVARC in isoform 5. 1 PublicationVSP_019644
    Alternative sequencei875 – 8817VFKWSGE → PISHLGH in isoform 6. 1 PublicationVSP_019645
    Alternative sequencei882 – 94362Missing in isoform 6. 1 PublicationVSP_019646Add
    BLAST
    Alternative sequencei884 – 94360Missing in isoform 5. 1 PublicationVSP_019647Add
    BLAST
    Alternative sequencei900 – 94344Missing in isoform 4. 1 PublicationVSP_019648Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK128935 mRNA. Translation: BAC87660.1. Frameshift.
    AK033503 mRNA. Translation: BAC28325.1.
    AK042369 mRNA. Translation: BAC31241.1.
    AK144324 mRNA. Translation: BAE25834.1.
    AK171679 mRNA. Translation: BAE42607.1.
    BC049997 mRNA. Translation: AAH49997.1.
    BC058572 mRNA. Translation: AAH58572.1.
    BC076623 mRNA. Translation: AAH76623.1.
    BC080670 mRNA. Translation: AAH80670.1.
    CCDSiCCDS23765.1. [Q6DFV7-1]
    CCDS48530.1. [Q6DFV7-3]
    RefSeqiNP_001104737.1. NM_001111267.2. [Q6DFV7-3]
    NP_766083.3. NM_172495.5. [Q6DFV7-1]
    UniGeneiMm.297903.

    Genome annotation databases

    EnsembliENSMUST00000068567; ENSMUSP00000066741; ENSMUSG00000039697. [Q6DFV7-1]
    ENSMUST00000092610; ENSMUSP00000090273; ENSMUSG00000039697. [Q6DFV7-3]
    GeneIDi211329.
    KEGGimmu:211329.
    UCSCiuc007etj.2. mouse. [Q6DFV7-5]
    uc007etk.2. mouse. [Q6DFV7-1]
    uc007etm.2. mouse. [Q6DFV7-4]
    uc007eto.2. mouse. [Q6DFV7-2]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK128935 mRNA. Translation: BAC87660.1 . Frameshift.
    AK033503 mRNA. Translation: BAC28325.1 .
    AK042369 mRNA. Translation: BAC31241.1 .
    AK144324 mRNA. Translation: BAE25834.1 .
    AK171679 mRNA. Translation: BAE42607.1 .
    BC049997 mRNA. Translation: AAH49997.1 .
    BC058572 mRNA. Translation: AAH58572.1 .
    BC076623 mRNA. Translation: AAH76623.1 .
    BC080670 mRNA. Translation: AAH80670.1 .
    CCDSi CCDS23765.1. [Q6DFV7-1 ]
    CCDS48530.1. [Q6DFV7-3 ]
    RefSeqi NP_001104737.1. NM_001111267.2. [Q6DFV7-3 ]
    NP_766083.3. NM_172495.5. [Q6DFV7-1 ]
    UniGenei Mm.297903.

    3D structure databases

    ProteinModelPortali Q6DFV7.
    SMRi Q6DFV7. Positions 781-943.
    ModBasei Search...
    MobiDBi Search...

    PTM databases

    PhosphoSitei Q6DFV7.

    Proteomic databases

    MaxQBi Q6DFV7.
    PaxDbi Q6DFV7.
    PRIDEi Q6DFV7.

    Protocols and materials databases

    DNASUi 211329.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENSMUST00000068567 ; ENSMUSP00000066741 ; ENSMUSG00000039697 . [Q6DFV7-1 ]
    ENSMUST00000092610 ; ENSMUSP00000090273 ; ENSMUSG00000039697 . [Q6DFV7-3 ]
    GeneIDi 211329.
    KEGGi mmu:211329.
    UCSCi uc007etj.2. mouse. [Q6DFV7-5 ]
    uc007etk.2. mouse. [Q6DFV7-1 ]
    uc007etm.2. mouse. [Q6DFV7-4 ]
    uc007eto.2. mouse. [Q6DFV7-2 ]

    Organism-specific databases

    CTDi 135112.
    MGIi MGI:2444847. Ncoa7.

    Phylogenomic databases

    eggNOGi COG5142.
    GeneTreei ENSGT00410000025363.
    HOVERGENi HBG065488.
    InParanoidi Q6DFV7.
    OMAi ETCEKQD.
    OrthoDBi EOG77M8PQ.
    PhylomeDBi Q6DFV7.
    TreeFami TF313530.

    Miscellaneous databases

    NextBioi 373204.
    PROi Q6DFV7.
    SOURCEi Search...

    Gene expression databases

    Bgeei Q6DFV7.
    CleanExi MM_NCOA7.
    Genevestigatori Q6DFV7.

    Family and domain databases

    Gene3Di 3.10.350.10. 1 hit.
    InterProi IPR018392. LysM_dom.
    IPR006571. TLDc.
    [Graphical view ]
    Pfami PF01476. LysM. 1 hit.
    PF07534. TLD. 1 hit.
    [Graphical view ]
    SMARTi SM00257. LysM. 1 hit.
    SM00584. TLDc. 1 hit.
    [Graphical view ]
    SUPFAMi SSF54106. SSF54106. 1 hit.
    ProtoNeti Search...

    Publicationsi

    1. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    2. "The transcriptional landscape of the mammalian genome."
      Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
      , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
      Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2; 3; 4 AND 5).
      Strain: C57BL/6J.
      Tissue: Colon, Lung, Spleen and Thymus.
    3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3 AND 6), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 19-943.
      Strain: C57BL/6.
      Tissue: Head, Kidney and Mammary gland.
    4. "ERAP140, a conserved tissue-specific nuclear receptor coactivator."
      Shao W., Halachmi S., Brown M.
      Mol. Cell. Biol. 22:3358-3372(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: TISSUE SPECIFICITY.

    Entry informationi

    Entry nameiNCOA7_MOUSE
    AccessioniPrimary (citable) accession number: Q6DFV7
    Secondary accession number(s): Q3TAR1
    , Q3UNB3, Q66K05, Q6ZQM4, Q8BJ15, Q8BJ39
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: July 11, 2006
    Last sequence update: July 11, 2006
    Last modified: October 1, 2014
    This is version 87 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. MGD cross-references
      Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
    2. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3