Q6BCY4 (NB5R2_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 72.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: NADH-cytochrome b5 reductase 2 Short name=b5R.2 EC=1.6.2.2 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 276 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | NADH-cytochrome b5 reductases are involved in desaturation and elongation of fatty acids, cholesterol biosynthesis, drug metabolism, and, in erythrocyte, methemoglobin reduction By similarity. Responsible for NADH-dependent lucigenin chemiluminescence in spermatozoa by reducing both lucigenin and 2-[4-iodophenyl]-3-[4-nitrophenyl]-5-[2,4-disulfophenyl]-2H tetrazolium monosodium salt (WST-1). Ref.2 |
| Catalytic activity | NADH + 2 ferricytochrome b5 = NAD+ + H+ + 2 ferrocytochrome b5. |
| Cofactor | FAD By similarity. |
| Tissue specificity | Restricted expression. Ref.1 |
| Sequence similarities | Belongs to the flavoprotein pyridine nucleotide cytochrome reductase family. Contains 1 FAD-binding FR-type domain. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Lipid biosynthesis Lipid metabolism Steroid biosynthesis Steroid metabolism Sterol biosynthesis Sterol metabolism |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Ligand | FAD Flavoprotein NAD |
| Molecular function | Oxidoreductase |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | sterol biosynthetic process Inferred from electronic annotation. Source: UniProtKB-KW |
| Cellular_component | membrane Inferred from direct assay Ref.1. Source: UniProtKB mitochondrionInferred from electronic annotation. Source: Compara |
| Molecular_function | cytochrome-b5 reductase activity, acting on NAD(P)H Inferred from direct assay Ref.1. Source: UniProtKB |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q6BCY4-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q6BCY4-2) The sequence of this isoform differs from the canonical sequence as follows: 221-276: WKYSSGFVTADMIKEHLPPPAKSTLILVCGPPPLIQTAAHPNLEKLGYTQDMIFTY → PWSAEGATLLSNSAQFH | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 276 | 276 | NADH-cytochrome b5 reductase 2 | PRO_0000287548 | |||||
Regions | |||||||||
| Domain | 15 – 127 | 113 | FAD-binding FR-type | ||||||
| Nucleotide binding | 107 – 137 | 31 | FAD By similarity | ||||||
| Nucleotide binding | 146 – 181 | 36 | FAD By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 221 – 276 | 56 | WKYSS…MIFTY → PWSAEGATLLSNSAQFH in isoform 2. | VSP_025559 | |||||
| Natural variant | 15 | 1 | E → A. Corresponds to variant rs11041525 [ dbSNP | Ensembl ]. | VAR_032321 | |||||
| Natural variant | 209 | 1 | N → D. Ref.1 Ref.3 Ref.4 Corresponds to variant rs12801394 [ dbSNP | Ensembl ]. | VAR_032322 | |||||
Experimental info | |||||||||
| Sequence conflict | 130 | 1 | G → R in AAF04811. Ref.1 | ||||||
| Sequence conflict | 253 | 1 | P → T in AAF04811. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Identification of a cytochrome b-type NAD(P)H oxidoreductase ubiquitously expressed in human cells." Zhu H., Qiu H., Yoon H.-W., Huang S., Bunn H.F. Proc. Natl. Acad. Sci. U.S.A. 96:14742-14747(1999) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY, VARIANT ASP-209. |
| [2] | "Identification of cytochrome-b5 reductase as the enzyme responsible for NADH-dependent lucigenin chemiluminescence in human spermatozoa." Baker M.A., Krutskikh A., Curry B.J., Hetherington L., Aitken R.J. Biol. Reprod. 73:334-342(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), IDENTIFICATION BY MASS SPECTROMETRY, FUNCTION. |
| [3] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), VARIANT ASP-209. Tissue: Placenta. |
| [4] | "The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 7-276 (ISOFORM 1), VARIANT ASP-209. Tissue: Testis. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF169802 mRNA. Translation: AAF04811.1. AY665398 mRNA. Translation: AAT75296.1. BC001346 mRNA. Translation: AAH01346.1. AL133582 mRNA. Translation: CAB63726.1. |
| IPI | IPI00008234. IPI00332396. |
| PIR | T43491. |
| RefSeq | NP_057313.2. NM_016229.3. |
| UniGene | Hs.414362. |
3D structure databases | |
| HSSP | HSSP built from PDB template 1QX4 based on UniProtKB P20070. |
| ProteinModelPortal | Q6BCY4. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q6BCY4. 3 interactions. |
| MINT | MINT-1447606. |
| STRING | 9606.ENSP00000299498. |
PTM databases | |
| PhosphoSite | Q6BCY4. |
Polymorphism databases | |
| DMDM | 74709211. |
2D gel databases | |
| REPRODUCTION-2DPAGE | IPI00332396. |
Proteomic databases | |
| PaxDb | Q6BCY4. |
| PRIDE | Q6BCY4. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000299497; ENSP00000299497; ENSG00000166394. ENST00000299498; ENSP00000299498; ENSG00000166394. ENST00000524790; ENSP00000435916; ENSG00000166394. ENST00000533558; ENSP00000437041; ENSG00000166394. |
| GeneID | 51700. |
| KEGG | hsa:51700. |
| UCSC | uc001mfm.3. human. |
Organism-specific databases | |
| CTD | 51700. |
| GeneCards | GC11M007642. |
| HGNC | HGNC:24376. CYB5R2. |
| HPA | HPA038962. |
| MIM | 608342. gene. |
| neXtProt | NX_Q6BCY4. |
| PharmGKB | PA142672060. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | COG0543. |
| HOGENOM | HOG000175005. |
| HOVERGEN | HBG052580. |
| InParanoid | Q6BCY4. |
| KO | K00326. |
| OMA | IGWKYSS. |
| OrthoDB | EOG4WDDCG. |
| PhylomeDB | Q6BCY4. |
Gene expression databases | |
| ArrayExpress | Q6BCY4. |
| Bgee | Q6BCY4. |
| CleanEx | HS_CYB5R2. |
| Genevestigator | Q6BCY4. |
Family and domain databases | |
| InterPro | IPR017927. Fd_Rdtase_FAD-bd. IPR001709. Flavoprot_Pyr_Nucl_cyt_Rdtase. IPR001834. NADH-Cyt_B5_reductase. IPR008333. OxRdtase_FAD-bd_dom. IPR001433. OxRdtase_FAD/NAD-bd. IPR017938. Riboflavin_synthase-like_b-brl. [Graphical view] |
| Pfam | PF00970. FAD_binding_6. 1 hit. PF00175. NAD_binding_1. 1 hit. [Graphical view] |
| PRINTS | PR00406. CYTB5RDTASE. PR00371. FPNCR. |
| SUPFAM | SSF63380. Riboflavin_synthase_like_b-brl. 1 hit. |
| PROSITE | PS51384. FAD_FR. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 51700. |
| NextBio | 55720. |
| SOURCE | Search... |
Entry information
| Entry name | NB5R2_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q6BCY4 Secondary accession number(s): Q9BVA3, Q9UF68, Q9UHJ0 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 11 Human chromosome 11: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
