Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q6AWC2

- WWC2_HUMAN

UniProt

Q6AWC2 - WWC2_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Protein WWC2

Gene

WWC2

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

GO - Molecular functioni

  1. kinase binding Source: BHF-UCL
  2. protein complex scaffold Source: BHF-UCL

GO - Biological processi

  1. negative regulation of hippo signaling Source: BHF-UCL
  2. negative regulation of organ growth Source: BHF-UCL
  3. negative regulation of transcription from RNA polymerase II promoter Source: BHF-UCL
Complete GO annotation...

Enzyme and pathway databases

SignaLinkiQ6AWC2.

Names & Taxonomyi

Protein namesi
Recommended name:
Protein WWC2
Alternative name(s):
BH-3-only member B
WW domain-containing protein 2
Gene namesi
Name:WWC2
Synonyms:BOMB
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 4

Organism-specific databases

HGNCiHGNC:24148. WWC2.

Subcellular locationi

GO - Cellular componenti

  1. cytosol Source: BHF-UCL
Complete GO annotation...

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA143485671.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 11921192Protein WWC2PRO_0000309490Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei1004 – 10041PhosphothreonineBy similarity
Modified residuei1022 – 10221Phosphoserine2 Publications

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ6AWC2.
PaxDbiQ6AWC2.
PRIDEiQ6AWC2.

PTM databases

PhosphoSiteiQ6AWC2.

Expressioni

Gene expression databases

BgeeiQ6AWC2.
CleanExiHS_WWC2.
ExpressionAtlasiQ6AWC2. baseline and differential.
GenevestigatoriQ6AWC2.

Organism-specific databases

HPAiHPA044005.

Interactioni

Protein-protein interaction databases

BioGridi123070. 4 interactions.
IntActiQ6AWC2. 3 interactions.
MINTiMINT-3318301.

Structurei

3D structure databases

ProteinModelPortaliQ6AWC2.
SMRiQ6AWC2. Positions 11-90, 701-824.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini10 – 4334WW 1PROSITE-ProRule annotationAdd
BLAST
Domaini57 – 9034WW 2PROSITE-ProRule annotationAdd
BLAST
Domaini715 – 80490C2Add
BLAST

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili121 – 19474Sequence AnalysisAdd
BLAST
Coiled coili224 – 25633Sequence AnalysisAdd
BLAST
Coiled coili302 – 421120Sequence AnalysisAdd
BLAST
Coiled coili859 – 88729Sequence AnalysisAdd
BLAST
Coiled coili1068 – 114477Sequence AnalysisAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi425 – 47551Ser-richAdd
BLAST
Compositional biasi526 – 5294Poly-Ala

Sequence similaritiesi

Belongs to the WWC family.Curated
Contains 1 C2 domain.Curated
Contains 2 WW domains.PROSITE-ProRule annotation

Keywords - Domaini

Coiled coil, Repeat

Phylogenomic databases

eggNOGiCOG5021.
GeneTreeiENSGT00410000025556.
HOVERGENiHBG058082.
InParanoidiQ6AWC2.
OMAiDELPWGW.
OrthoDBiEOG7DJSNR.
PhylomeDBiQ6AWC2.
TreeFamiTF324040.

Family and domain databases

Gene3Di2.60.40.150. 1 hit.
InterProiIPR000008. C2_dom.
IPR001202. WW_dom.
[Graphical view]
PfamiPF00397. WW. 2 hits.
[Graphical view]
SMARTiSM00456. WW. 2 hits.
[Graphical view]
SUPFAMiSSF49562. SSF49562. 1 hit.
SSF51045. SSF51045. 2 hits.
PROSITEiPS01159. WW_DOMAIN_1. 1 hit.
PS50020. WW_DOMAIN_2. 2 hits.
[Graphical view]

Sequences (7)i

Sequence statusi: Complete.

This entry describes 7 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q6AWC2-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MPRRAGSGQL PLPRGWEEAR DYDGKVFYID HNTRRTSWID PRDRLTKPLS
60 70 80 90 100
FADCVGDELP WGWEAGFDPQ IGVYYIDHIN KTTQIEDPRK QWRGEQEKML
110 120 130 140 150
KDYLSVAQDA LRTQKELYHV KEQRLALALD EYVRLNDAYK EKSSSHTSLF
160 170 180 190 200
SGSSSSTKYD PDILKAEIST TRLRVKKLKR ELSQMKQELL YKEQGFETLQ
210 220 230 240 250
QIDKKMSGGQ SGYELSEAKA ILTELKSIRK AISSGEKEKQ DLMQSLAKLQ
260 270 280 290 300
ERFHLDQNIG RSEPDLRCSP VNSHLCLSRQ TLDAGSQTSI SGDIGVRSRS
310 320 330 340 350
NLAEKVRLSL QYEEAKRSMA NLKIELSKLD SEAWPGALDI EKEKLMLINE
360 370 380 390 400
KEELLKELQF VTPQKRTQDE LERLEAERQR LEEELLSVRG TPSRALAERL
410 420 430 440 450
RLEERRKELL QKLEETTKLT TYLHSQLKSL SASTLSMSSG SSLGSLASSR
460 470 480 490 500
GSLNTSSRGS LNSLSSTELY YSSQSDQIDV DYQYKLDFLL QEKSGYIPSG
510 520 530 540 550
PITTIHENEV VKSPSQPGQS GLCGVAAAAT GHTPPLAEAP KSVASLSSRS
560 570 580 590 600
SLSSLSPPGS PLVLEGTFPM SSSHDASLHQ FTADFEDCEL SSHFADISLI
610 620 630 640 650
ENQILLDSDS GGASQSLSED KDLNECAREP LYEGTADVEK SLPKRRVIHL
660 670 680 690 700
LGEKTTCVSA AVSDESVAGD SGVYEAFVKQ PSEMEDVTYS EEDVAIVETA
710 720 730 740 750
QVQIGLRYNA KSSSFMVIIA QLRNLHAFLI PHTSKVYFRV AVLPSSTDVS
760 770 780 790 800
CLFRTKVHPP TESILFNDVF RVAISQTALQ QKTLRVDLCS VSKHRREECL
810 820 830 840 850
AGTQISLADL PFSSEVFTLW YNLLPSKQMP CKKNEENEDS VFQPNQPLVD
860 870 880 890 900
SIDLDAVSAL LARTSAELLA VEQELAQEEE EESGQEEPRG PDGDWLTMLR
910 920 930 940 950
EASDEIVAEK EAEVKLPEDS SCTEDLSSCT SVPEMNEDGN RKESNCAKDL
960 970 980 990 1000
RSQPPTRIPT LVDKETNTDE AANDNMAVRP KERSSLSSRQ HPFVRSSVIV
1010 1020 1030 1040 1050
RSQTFSPGER NQYICRLNRS DSDSSTLAKK SLFVRNSTER RSLRVKRTVC
1060 1070 1080 1090 1100
QSVLRRTTQE CPVRTSLDLE LDLQASLTRQ SRLNDELQAL RDLRQKLEEL
1110 1120 1130 1140 1150
KAQGETDLPP GVLEDERFQR LLKQAEKQAE QSKEEQKQGL NAEKLMRQVS
1160 1170 1180 1190
KDVCRLREQS QKVPRQVQSF REKIAYFTRA KISIPSLPAD DV
Length:1,192
Mass (Da):133,891
Last modified:November 13, 2007 - v2
Checksum:i937D419FF18F62C0
GO
Isoform 2 (identifier: Q6AWC2-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-205: Missing.

Note: No experimental confirmation available.

Show »
Length:987
Mass (Da):109,863
Checksum:i8346D26F17DC87F3
GO
Isoform 3 (identifier: Q6AWC2-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-318: Missing.

Note: No experimental confirmation available.

Show »
Length:874
Mass (Da):97,402
Checksum:i9562CB76735607FA
GO
Isoform 4 (identifier: Q6AWC2-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     588-637: CELSSHFADISLIENQILLDSDSGGASQSLSEDKDLNECAREPLYEGTAD → Y

Note: No experimental confirmation available.

Show »
Length:1,143
Mass (Da):128,685
Checksum:iB7588FB75417ADB7
GO
Isoform 5 (identifier: Q6AWC2-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-98: Missing.
     786-1192: VDLCSVSKHR...SIPSLPADDV → KNFTFVTAITHGVCLPLPVPMPSFA

Note: No experimental confirmation available.

Show »
Length:712
Mass (Da):78,825
Checksum:i272020787DAB3E1D
GO
Isoform 6 (identifier: Q6AWC2-6) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     895-895: W → WLNTYFLCCWELKDDVFTRLTVKPL

Note: No experimental confirmation available.

Show »
Length:1,216
Mass (Da):136,792
Checksum:i17385946EC6CBFBE
GO
Isoform 7 (identifier: Q6AWC2-7) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-895: MPRRAGSGQL...EEPRGPDGDW → MPRLRVHGACLPTKSVLFLFYHR

Note: No experimental confirmation available.

Show »
Length:320
Mass (Da):36,660
Checksum:iFDA6B5A0582B8E2D
GO

Sequence cautioni

The sequence AAI07684.1 differs from that shown. Reason: Contaminating sequence. Potential poly-A sequence.
The sequence AAH17957.1 differs from that shown. Reason: Erroneous initiation.
The sequence BAB15215.1 differs from that shown. Reason: Erroneous initiation.
The sequence BAB85032.1 differs from that shown. Reason: Erroneous initiation.
The sequence CAD97477.1 differs from that shown. Reason: Erroneous initiation.

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti108 – 1081Q → R in BAC86418. (PubMed:14702039)Curated
Sequence conflicti177 – 1771K → E in BAC86418. (PubMed:14702039)Curated
Sequence conflicti969 – 9691D → Y in CAH10569. (PubMed:17974005)Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti773 – 7731A → S.1 Publication
Corresponds to variant rs11941467 [ dbSNP | Ensembl ].
VAR_036965
Natural varianti816 – 8161V → F.2 Publications
Corresponds to variant rs11734376 [ dbSNP | Ensembl ].
VAR_036966
Natural varianti904 – 9041D → H.2 Publications
Corresponds to variant rs3814422 [ dbSNP | Ensembl ].
VAR_036967
Natural varianti979 – 9791R → C.
Corresponds to variant rs45470696 [ dbSNP | Ensembl ].
VAR_062108
Natural varianti1189 – 11891A → T.1 Publication
Corresponds to variant rs4862155 [ dbSNP | Ensembl ].
VAR_036968

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 895895MPRRA…PDGDW → MPRLRVHGACLPTKSVLFLF YHR in isoform 7. 1 PublicationVSP_029213Add
BLAST
Alternative sequencei1 – 318318Missing in isoform 3. 1 PublicationVSP_029214Add
BLAST
Alternative sequencei1 – 205205Missing in isoform 2. 1 PublicationVSP_029215Add
BLAST
Alternative sequencei1 – 9898Missing in isoform 5. 1 PublicationVSP_029216Add
BLAST
Alternative sequencei588 – 63750CELSS…EGTAD → Y in isoform 4. 1 PublicationVSP_029217Add
BLAST
Alternative sequencei786 – 1192407VDLCS…PADDV → KNFTFVTAITHGVCLPLPVP MPSFA in isoform 5. 1 PublicationVSP_029218Add
BLAST
Alternative sequencei895 – 8951W → WLNTYFLCCWELKDDVFTRL TVKPL in isoform 6. 1 PublicationVSP_029219

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AK025682 mRNA. Translation: BAB15215.1. Different initiation.
AK074260 mRNA. Translation: BAB85032.1. Different initiation.
AK126057 mRNA. Translation: BAC86418.1.
AK127061 mRNA. Translation: BAC86807.1.
BX647378 mRNA. Translation: CAH10569.1.
BX647704 mRNA. Translation: CAH10570.1.
AL832424 mRNA. Translation: CAH10641.1.
AC093844 Genomic DNA. No translation available.
AC099397 Genomic DNA. No translation available.
AC019193 Genomic DNA. No translation available.
BC017957 mRNA. Translation: AAH17957.1. Different initiation.
BC053873 mRNA. Translation: AAH53873.2.
BC107683 mRNA. Translation: AAI07684.1. Sequence problems.
AJ566366 mRNA. Translation: CAD97477.1. Different initiation.
CCDSiCCDS34109.2. [Q6AWC2-1]
RefSeqiNP_079225.5. NM_024949.5. [Q6AWC2-1]
UniGeneiHs.333179.

Genome annotation databases

EnsembliENST00000403733; ENSP00000384222; ENSG00000151718. [Q6AWC2-1]
ENST00000438543; ENSP00000413521; ENSG00000151718. [Q6AWC2-5]
ENST00000448232; ENSP00000398577; ENSG00000151718. [Q6AWC2-6]
ENST00000504005; ENSP00000427569; ENSG00000151718. [Q6AWC2-3]
ENST00000508747; ENSP00000420835; ENSG00000151718. [Q6AWC2-7]
ENST00000513834; ENSP00000425054; ENSG00000151718. [Q6AWC2-4]
GeneIDi80014.
KEGGihsa:80014.
UCSCiuc003ivk.4. human. [Q6AWC2-1]
uc003ivn.4. human. [Q6AWC2-4]
uc003ivo.4. human. [Q6AWC2-7]
uc010irz.3. human. [Q6AWC2-3]

Polymorphism databases

DMDMi160358940.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AK025682 mRNA. Translation: BAB15215.1 . Different initiation.
AK074260 mRNA. Translation: BAB85032.1 . Different initiation.
AK126057 mRNA. Translation: BAC86418.1 .
AK127061 mRNA. Translation: BAC86807.1 .
BX647378 mRNA. Translation: CAH10569.1 .
BX647704 mRNA. Translation: CAH10570.1 .
AL832424 mRNA. Translation: CAH10641.1 .
AC093844 Genomic DNA. No translation available.
AC099397 Genomic DNA. No translation available.
AC019193 Genomic DNA. No translation available.
BC017957 mRNA. Translation: AAH17957.1 . Different initiation.
BC053873 mRNA. Translation: AAH53873.2 .
BC107683 mRNA. Translation: AAI07684.1 . Sequence problems.
AJ566366 mRNA. Translation: CAD97477.1 . Different initiation.
CCDSi CCDS34109.2. [Q6AWC2-1 ]
RefSeqi NP_079225.5. NM_024949.5. [Q6AWC2-1 ]
UniGenei Hs.333179.

3D structure databases

ProteinModelPortali Q6AWC2.
SMRi Q6AWC2. Positions 11-90, 701-824.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 123070. 4 interactions.
IntActi Q6AWC2. 3 interactions.
MINTi MINT-3318301.

PTM databases

PhosphoSitei Q6AWC2.

Polymorphism databases

DMDMi 160358940.

Proteomic databases

MaxQBi Q6AWC2.
PaxDbi Q6AWC2.
PRIDEi Q6AWC2.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000403733 ; ENSP00000384222 ; ENSG00000151718 . [Q6AWC2-1 ]
ENST00000438543 ; ENSP00000413521 ; ENSG00000151718 . [Q6AWC2-5 ]
ENST00000448232 ; ENSP00000398577 ; ENSG00000151718 . [Q6AWC2-6 ]
ENST00000504005 ; ENSP00000427569 ; ENSG00000151718 . [Q6AWC2-3 ]
ENST00000508747 ; ENSP00000420835 ; ENSG00000151718 . [Q6AWC2-7 ]
ENST00000513834 ; ENSP00000425054 ; ENSG00000151718 . [Q6AWC2-4 ]
GeneIDi 80014.
KEGGi hsa:80014.
UCSCi uc003ivk.4. human. [Q6AWC2-1 ]
uc003ivn.4. human. [Q6AWC2-4 ]
uc003ivo.4. human. [Q6AWC2-7 ]
uc010irz.3. human. [Q6AWC2-3 ]

Organism-specific databases

CTDi 80014.
GeneCardsi GC04P184020.
H-InvDB HIX0004660.
HGNCi HGNC:24148. WWC2.
HPAi HPA044005.
neXtProti NX_Q6AWC2.
PharmGKBi PA143485671.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG5021.
GeneTreei ENSGT00410000025556.
HOVERGENi HBG058082.
InParanoidi Q6AWC2.
OMAi DELPWGW.
OrthoDBi EOG7DJSNR.
PhylomeDBi Q6AWC2.
TreeFami TF324040.

Enzyme and pathway databases

SignaLinki Q6AWC2.

Miscellaneous databases

ChiTaRSi WWC2. human.
GenomeRNAii 80014.
NextBioi 70118.
PROi Q6AWC2.

Gene expression databases

Bgeei Q6AWC2.
CleanExi HS_WWC2.
ExpressionAtlasi Q6AWC2. baseline and differential.
Genevestigatori Q6AWC2.

Family and domain databases

Gene3Di 2.60.40.150. 1 hit.
InterProi IPR000008. C2_dom.
IPR001202. WW_dom.
[Graphical view ]
Pfami PF00397. WW. 2 hits.
[Graphical view ]
SMARTi SM00456. WW. 2 hits.
[Graphical view ]
SUPFAMi SSF49562. SSF49562. 1 hit.
SSF51045. SSF51045. 2 hits.
PROSITEi PS01159. WW_DOMAIN_1. 1 hit.
PS50020. WW_DOMAIN_2. 2 hits.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3 AND 5), VARIANT HIS-904.
    Tissue: Brain.
  2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 698-1192 (ISOFORM 6), VARIANTS PHE-816; HIS-904 AND THR-1189.
    Tissue: Fetal kidney, Lung endothelial cell and Melanoma.
  3. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
    Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
    , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
    Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 7), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 408-879 (ISOFORM 1), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 415-1192 (ISOFORM 4), VARIANTS SER-773 AND PHE-816.
    Tissue: Kidney and Skin.
  5. "Novel pro-apoptotic BH-3-only proteins, apolipoprotein L6 (ApoL6) and BH3-only member B (BOMB), by genomics and functional expression approaches in cancer."
    Liu Z., Jiang Z., Hu C.-A.A.
    Submitted (JUN-2003) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 713-1192 (ISOFORM 1).
  6. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
    Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
    Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1022, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  7. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
    Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
    Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1022, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

Entry informationi

Entry nameiWWC2_HUMAN
AccessioniPrimary (citable) accession number: Q6AWC2
Secondary accession number(s): Q32Q84
, Q69YQ1, Q6AWB8, Q6ZSY9, Q6ZU09, Q7Z620, Q8TEB8, Q9H6P0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 13, 2007
Last sequence update: November 13, 2007
Last modified: October 29, 2014
This is version 84 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 4
    Human chromosome 4: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3