Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q6AWC2

- WWC2_HUMAN

UniProt

Q6AWC2 - WWC2_HUMAN

Protein

Protein WWC2

Gene

WWC2

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 83 (01 Oct 2014)
      Sequence version 2 (13 Nov 2007)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    GO - Molecular functioni

    1. kinase binding Source: BHF-UCL
    2. protein complex scaffold Source: BHF-UCL

    GO - Biological processi

    1. negative regulation of hippo signaling Source: BHF-UCL
    2. negative regulation of organ growth Source: BHF-UCL
    3. negative regulation of transcription from RNA polymerase II promoter Source: BHF-UCL

    Enzyme and pathway databases

    SignaLinkiQ6AWC2.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Protein WWC2
    Alternative name(s):
    BH-3-only member B
    WW domain-containing protein 2
    Gene namesi
    Name:WWC2
    Synonyms:BOMB
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 4

    Organism-specific databases

    HGNCiHGNC:24148. WWC2.

    Subcellular locationi

    GO - Cellular componenti

    1. cytosol Source: BHF-UCL

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA143485671.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 11921192Protein WWC2PRO_0000309490Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei1004 – 10041PhosphothreonineBy similarity
    Modified residuei1022 – 10221Phosphoserine2 Publications

    Keywords - PTMi

    Phosphoprotein

    Proteomic databases

    MaxQBiQ6AWC2.
    PaxDbiQ6AWC2.
    PRIDEiQ6AWC2.

    PTM databases

    PhosphoSiteiQ6AWC2.

    Expressioni

    Gene expression databases

    ArrayExpressiQ6AWC2.
    BgeeiQ6AWC2.
    CleanExiHS_WWC2.
    GenevestigatoriQ6AWC2.

    Organism-specific databases

    HPAiHPA044005.

    Interactioni

    Protein-protein interaction databases

    BioGridi123070. 3 interactions.
    IntActiQ6AWC2. 3 interactions.
    MINTiMINT-3318301.

    Structurei

    3D structure databases

    ProteinModelPortaliQ6AWC2.
    SMRiQ6AWC2. Positions 11-90, 701-824.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini10 – 4334WW 1PROSITE-ProRule annotationAdd
    BLAST
    Domaini57 – 9034WW 2PROSITE-ProRule annotationAdd
    BLAST
    Domaini715 – 80490C2Add
    BLAST

    Coiled coil

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Coiled coili121 – 19474Sequence AnalysisAdd
    BLAST
    Coiled coili224 – 25633Sequence AnalysisAdd
    BLAST
    Coiled coili302 – 421120Sequence AnalysisAdd
    BLAST
    Coiled coili859 – 88729Sequence AnalysisAdd
    BLAST
    Coiled coili1068 – 114477Sequence AnalysisAdd
    BLAST

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi425 – 47551Ser-richAdd
    BLAST
    Compositional biasi526 – 5294Poly-Ala

    Sequence similaritiesi

    Belongs to the WWC family.Curated
    Contains 1 C2 domain.Curated
    Contains 2 WW domains.PROSITE-ProRule annotation

    Keywords - Domaini

    Coiled coil, Repeat

    Phylogenomic databases

    eggNOGiCOG5021.
    HOVERGENiHBG058082.
    InParanoidiQ6AWC2.
    OMAiDELPWGW.
    OrthoDBiEOG7DJSNR.
    PhylomeDBiQ6AWC2.
    TreeFamiTF324040.

    Family and domain databases

    Gene3Di2.60.40.150. 1 hit.
    InterProiIPR000008. C2_dom.
    IPR001202. WW_dom.
    [Graphical view]
    PfamiPF00397. WW. 2 hits.
    [Graphical view]
    SMARTiSM00456. WW. 2 hits.
    [Graphical view]
    SUPFAMiSSF49562. SSF49562. 1 hit.
    SSF51045. SSF51045. 2 hits.
    PROSITEiPS01159. WW_DOMAIN_1. 1 hit.
    PS50020. WW_DOMAIN_2. 2 hits.
    [Graphical view]

    Sequences (7)i

    Sequence statusi: Complete.

    This entry describes 7 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q6AWC2-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MPRRAGSGQL PLPRGWEEAR DYDGKVFYID HNTRRTSWID PRDRLTKPLS     50
    FADCVGDELP WGWEAGFDPQ IGVYYIDHIN KTTQIEDPRK QWRGEQEKML 100
    KDYLSVAQDA LRTQKELYHV KEQRLALALD EYVRLNDAYK EKSSSHTSLF 150
    SGSSSSTKYD PDILKAEIST TRLRVKKLKR ELSQMKQELL YKEQGFETLQ 200
    QIDKKMSGGQ SGYELSEAKA ILTELKSIRK AISSGEKEKQ DLMQSLAKLQ 250
    ERFHLDQNIG RSEPDLRCSP VNSHLCLSRQ TLDAGSQTSI SGDIGVRSRS 300
    NLAEKVRLSL QYEEAKRSMA NLKIELSKLD SEAWPGALDI EKEKLMLINE 350
    KEELLKELQF VTPQKRTQDE LERLEAERQR LEEELLSVRG TPSRALAERL 400
    RLEERRKELL QKLEETTKLT TYLHSQLKSL SASTLSMSSG SSLGSLASSR 450
    GSLNTSSRGS LNSLSSTELY YSSQSDQIDV DYQYKLDFLL QEKSGYIPSG 500
    PITTIHENEV VKSPSQPGQS GLCGVAAAAT GHTPPLAEAP KSVASLSSRS 550
    SLSSLSPPGS PLVLEGTFPM SSSHDASLHQ FTADFEDCEL SSHFADISLI 600
    ENQILLDSDS GGASQSLSED KDLNECAREP LYEGTADVEK SLPKRRVIHL 650
    LGEKTTCVSA AVSDESVAGD SGVYEAFVKQ PSEMEDVTYS EEDVAIVETA 700
    QVQIGLRYNA KSSSFMVIIA QLRNLHAFLI PHTSKVYFRV AVLPSSTDVS 750
    CLFRTKVHPP TESILFNDVF RVAISQTALQ QKTLRVDLCS VSKHRREECL 800
    AGTQISLADL PFSSEVFTLW YNLLPSKQMP CKKNEENEDS VFQPNQPLVD 850
    SIDLDAVSAL LARTSAELLA VEQELAQEEE EESGQEEPRG PDGDWLTMLR 900
    EASDEIVAEK EAEVKLPEDS SCTEDLSSCT SVPEMNEDGN RKESNCAKDL 950
    RSQPPTRIPT LVDKETNTDE AANDNMAVRP KERSSLSSRQ HPFVRSSVIV 1000
    RSQTFSPGER NQYICRLNRS DSDSSTLAKK SLFVRNSTER RSLRVKRTVC 1050
    QSVLRRTTQE CPVRTSLDLE LDLQASLTRQ SRLNDELQAL RDLRQKLEEL 1100
    KAQGETDLPP GVLEDERFQR LLKQAEKQAE QSKEEQKQGL NAEKLMRQVS 1150
    KDVCRLREQS QKVPRQVQSF REKIAYFTRA KISIPSLPAD DV 1192
    Length:1,192
    Mass (Da):133,891
    Last modified:November 13, 2007 - v2
    Checksum:i937D419FF18F62C0
    GO
    Isoform 2 (identifier: Q6AWC2-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-205: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:987
    Mass (Da):109,863
    Checksum:i8346D26F17DC87F3
    GO
    Isoform 3 (identifier: Q6AWC2-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-318: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:874
    Mass (Da):97,402
    Checksum:i9562CB76735607FA
    GO
    Isoform 4 (identifier: Q6AWC2-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         588-637: CELSSHFADISLIENQILLDSDSGGASQSLSEDKDLNECAREPLYEGTAD → Y

    Note: No experimental confirmation available.

    Show »
    Length:1,143
    Mass (Da):128,685
    Checksum:iB7588FB75417ADB7
    GO
    Isoform 5 (identifier: Q6AWC2-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-98: Missing.
         786-1192: VDLCSVSKHR...SIPSLPADDV → KNFTFVTAITHGVCLPLPVPMPSFA

    Note: No experimental confirmation available.

    Show »
    Length:712
    Mass (Da):78,825
    Checksum:i272020787DAB3E1D
    GO
    Isoform 6 (identifier: Q6AWC2-6) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         895-895: W → WLNTYFLCCWELKDDVFTRLTVKPL

    Note: No experimental confirmation available.

    Show »
    Length:1,216
    Mass (Da):136,792
    Checksum:i17385946EC6CBFBE
    GO
    Isoform 7 (identifier: Q6AWC2-7) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-895: MPRRAGSGQL...EEPRGPDGDW → MPRLRVHGACLPTKSVLFLFYHR

    Note: No experimental confirmation available.

    Show »
    Length:320
    Mass (Da):36,660
    Checksum:iFDA6B5A0582B8E2D
    GO

    Sequence cautioni

    The sequence AAI07684.1 differs from that shown. Reason: Contaminating sequence. Potential poly-A sequence.
    The sequence AAH17957.1 differs from that shown. Reason: Erroneous initiation.
    The sequence BAB15215.1 differs from that shown. Reason: Erroneous initiation.
    The sequence BAB85032.1 differs from that shown. Reason: Erroneous initiation.
    The sequence CAD97477.1 differs from that shown. Reason: Erroneous initiation.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti108 – 1081Q → R in BAC86418. (PubMed:14702039)Curated
    Sequence conflicti177 – 1771K → E in BAC86418. (PubMed:14702039)Curated
    Sequence conflicti969 – 9691D → Y in CAH10569. (PubMed:17974005)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti773 – 7731A → S.1 Publication
    Corresponds to variant rs11941467 [ dbSNP | Ensembl ].
    VAR_036965
    Natural varianti816 – 8161V → F.2 Publications
    Corresponds to variant rs11734376 [ dbSNP | Ensembl ].
    VAR_036966
    Natural varianti904 – 9041D → H.2 Publications
    Corresponds to variant rs3814422 [ dbSNP | Ensembl ].
    VAR_036967
    Natural varianti979 – 9791R → C.
    Corresponds to variant rs45470696 [ dbSNP | Ensembl ].
    VAR_062108
    Natural varianti1189 – 11891A → T.1 Publication
    Corresponds to variant rs4862155 [ dbSNP | Ensembl ].
    VAR_036968

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 895895MPRRA…PDGDW → MPRLRVHGACLPTKSVLFLF YHR in isoform 7. 1 PublicationVSP_029213Add
    BLAST
    Alternative sequencei1 – 318318Missing in isoform 3. 1 PublicationVSP_029214Add
    BLAST
    Alternative sequencei1 – 205205Missing in isoform 2. 1 PublicationVSP_029215Add
    BLAST
    Alternative sequencei1 – 9898Missing in isoform 5. 1 PublicationVSP_029216Add
    BLAST
    Alternative sequencei588 – 63750CELSS…EGTAD → Y in isoform 4. 1 PublicationVSP_029217Add
    BLAST
    Alternative sequencei786 – 1192407VDLCS…PADDV → KNFTFVTAITHGVCLPLPVP MPSFA in isoform 5. 1 PublicationVSP_029218Add
    BLAST
    Alternative sequencei895 – 8951W → WLNTYFLCCWELKDDVFTRL TVKPL in isoform 6. 1 PublicationVSP_029219

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK025682 mRNA. Translation: BAB15215.1. Different initiation.
    AK074260 mRNA. Translation: BAB85032.1. Different initiation.
    AK126057 mRNA. Translation: BAC86418.1.
    AK127061 mRNA. Translation: BAC86807.1.
    BX647378 mRNA. Translation: CAH10569.1.
    BX647704 mRNA. Translation: CAH10570.1.
    AL832424 mRNA. Translation: CAH10641.1.
    AC093844 Genomic DNA. No translation available.
    AC099397 Genomic DNA. No translation available.
    AC019193 Genomic DNA. No translation available.
    BC017957 mRNA. Translation: AAH17957.1. Different initiation.
    BC053873 mRNA. Translation: AAH53873.2.
    BC107683 mRNA. Translation: AAI07684.1. Sequence problems.
    AJ566366 mRNA. Translation: CAD97477.1. Different initiation.
    CCDSiCCDS34109.2. [Q6AWC2-1]
    RefSeqiNP_079225.5. NM_024949.5. [Q6AWC2-1]
    UniGeneiHs.333179.

    Genome annotation databases

    EnsembliENST00000403733; ENSP00000384222; ENSG00000151718. [Q6AWC2-1]
    ENST00000438543; ENSP00000413521; ENSG00000151718. [Q6AWC2-5]
    ENST00000448232; ENSP00000398577; ENSG00000151718. [Q6AWC2-6]
    ENST00000504005; ENSP00000427569; ENSG00000151718. [Q6AWC2-3]
    ENST00000508747; ENSP00000420835; ENSG00000151718. [Q6AWC2-7]
    ENST00000513834; ENSP00000425054; ENSG00000151718. [Q6AWC2-4]
    GeneIDi80014.
    KEGGihsa:80014.
    UCSCiuc003ivk.4. human. [Q6AWC2-1]
    uc003ivn.4. human. [Q6AWC2-4]
    uc003ivo.4. human. [Q6AWC2-7]
    uc010irz.3. human. [Q6AWC2-3]

    Polymorphism databases

    DMDMi160358940.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK025682 mRNA. Translation: BAB15215.1 . Different initiation.
    AK074260 mRNA. Translation: BAB85032.1 . Different initiation.
    AK126057 mRNA. Translation: BAC86418.1 .
    AK127061 mRNA. Translation: BAC86807.1 .
    BX647378 mRNA. Translation: CAH10569.1 .
    BX647704 mRNA. Translation: CAH10570.1 .
    AL832424 mRNA. Translation: CAH10641.1 .
    AC093844 Genomic DNA. No translation available.
    AC099397 Genomic DNA. No translation available.
    AC019193 Genomic DNA. No translation available.
    BC017957 mRNA. Translation: AAH17957.1 . Different initiation.
    BC053873 mRNA. Translation: AAH53873.2 .
    BC107683 mRNA. Translation: AAI07684.1 . Sequence problems.
    AJ566366 mRNA. Translation: CAD97477.1 . Different initiation.
    CCDSi CCDS34109.2. [Q6AWC2-1 ]
    RefSeqi NP_079225.5. NM_024949.5. [Q6AWC2-1 ]
    UniGenei Hs.333179.

    3D structure databases

    ProteinModelPortali Q6AWC2.
    SMRi Q6AWC2. Positions 11-90, 701-824.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 123070. 3 interactions.
    IntActi Q6AWC2. 3 interactions.
    MINTi MINT-3318301.

    PTM databases

    PhosphoSitei Q6AWC2.

    Polymorphism databases

    DMDMi 160358940.

    Proteomic databases

    MaxQBi Q6AWC2.
    PaxDbi Q6AWC2.
    PRIDEi Q6AWC2.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000403733 ; ENSP00000384222 ; ENSG00000151718 . [Q6AWC2-1 ]
    ENST00000438543 ; ENSP00000413521 ; ENSG00000151718 . [Q6AWC2-5 ]
    ENST00000448232 ; ENSP00000398577 ; ENSG00000151718 . [Q6AWC2-6 ]
    ENST00000504005 ; ENSP00000427569 ; ENSG00000151718 . [Q6AWC2-3 ]
    ENST00000508747 ; ENSP00000420835 ; ENSG00000151718 . [Q6AWC2-7 ]
    ENST00000513834 ; ENSP00000425054 ; ENSG00000151718 . [Q6AWC2-4 ]
    GeneIDi 80014.
    KEGGi hsa:80014.
    UCSCi uc003ivk.4. human. [Q6AWC2-1 ]
    uc003ivn.4. human. [Q6AWC2-4 ]
    uc003ivo.4. human. [Q6AWC2-7 ]
    uc010irz.3. human. [Q6AWC2-3 ]

    Organism-specific databases

    CTDi 80014.
    GeneCardsi GC04P184020.
    H-InvDB HIX0004660.
    HGNCi HGNC:24148. WWC2.
    HPAi HPA044005.
    neXtProti NX_Q6AWC2.
    PharmGKBi PA143485671.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG5021.
    HOVERGENi HBG058082.
    InParanoidi Q6AWC2.
    OMAi DELPWGW.
    OrthoDBi EOG7DJSNR.
    PhylomeDBi Q6AWC2.
    TreeFami TF324040.

    Enzyme and pathway databases

    SignaLinki Q6AWC2.

    Miscellaneous databases

    ChiTaRSi WWC2. human.
    GenomeRNAii 80014.
    NextBioi 70118.
    PROi Q6AWC2.

    Gene expression databases

    ArrayExpressi Q6AWC2.
    Bgeei Q6AWC2.
    CleanExi HS_WWC2.
    Genevestigatori Q6AWC2.

    Family and domain databases

    Gene3Di 2.60.40.150. 1 hit.
    InterProi IPR000008. C2_dom.
    IPR001202. WW_dom.
    [Graphical view ]
    Pfami PF00397. WW. 2 hits.
    [Graphical view ]
    SMARTi SM00456. WW. 2 hits.
    [Graphical view ]
    SUPFAMi SSF49562. SSF49562. 1 hit.
    SSF51045. SSF51045. 2 hits.
    PROSITEi PS01159. WW_DOMAIN_1. 1 hit.
    PS50020. WW_DOMAIN_2. 2 hits.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3 AND 5), VARIANT HIS-904.
      Tissue: Brain.
    2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 698-1192 (ISOFORM 6), VARIANTS PHE-816; HIS-904 AND THR-1189.
      Tissue: Fetal kidney, Lung endothelial cell and Melanoma.
    3. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
      Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
      , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
      Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 7), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 408-879 (ISOFORM 1), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 415-1192 (ISOFORM 4), VARIANTS SER-773 AND PHE-816.
      Tissue: Kidney and Skin.
    5. "Novel pro-apoptotic BH-3-only proteins, apolipoprotein L6 (ApoL6) and BH3-only member B (BOMB), by genomics and functional expression approaches in cancer."
      Liu Z., Jiang Z., Hu C.-A.A.
      Submitted (JUN-2003) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 713-1192 (ISOFORM 1).
    6. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
      Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
      Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1022, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    7. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
      Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
      Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1022, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

    Entry informationi

    Entry nameiWWC2_HUMAN
    AccessioniPrimary (citable) accession number: Q6AWC2
    Secondary accession number(s): Q32Q84
    , Q69YQ1, Q6AWB8, Q6ZSY9, Q6ZU09, Q7Z620, Q8TEB8, Q9H6P0
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: November 13, 2007
    Last sequence update: November 13, 2007
    Last modified: October 1, 2014
    This is version 83 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 4
      Human chromosome 4: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3