Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Protein WWC2

Gene

WWC2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

GO - Molecular functioni

  • kinase binding Source: BHF-UCL
  • protein-containing complex scaffold activity Source: BHF-UCL

GO - Biological processi

  • negative regulation of hippo signaling Source: BHF-UCL
  • negative regulation of organ growth Source: BHF-UCL
  • negative regulation of transcription by RNA polymerase II Source: BHF-UCL

Enzyme and pathway databases

SignaLinkiQ6AWC2

Names & Taxonomyi

Protein namesi
Recommended name:
Protein WWC2
Alternative name(s):
BH-3-only member B
WW domain-containing protein 2
Gene namesi
Name:WWC2
Synonyms:BOMB
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 4

Organism-specific databases

EuPathDBiHostDB:ENSG00000151718.15
HGNCiHGNC:24148 WWC2
neXtProtiNX_Q6AWC2

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000151718
PharmGKBiPA143485671

Polymorphism and mutation databases

BioMutaiWWC2
DMDMi160358940

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003094901 – 1192Protein WWC2Add BLAST1192

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei286PhosphoserineBy similarity1
Modified residuei1004PhosphothreonineBy similarity1
Modified residuei1022PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ6AWC2
PaxDbiQ6AWC2
PeptideAtlasiQ6AWC2
PRIDEiQ6AWC2
ProteomicsDBi66193
66194 [Q6AWC2-2]
66195 [Q6AWC2-3]
66196 [Q6AWC2-4]
66197 [Q6AWC2-5]
66198 [Q6AWC2-6]
66199 [Q6AWC2-7]

PTM databases

iPTMnetiQ6AWC2
PhosphoSitePlusiQ6AWC2

Expressioni

Gene expression databases

BgeeiENSG00000151718
CleanExiHS_WWC2
ExpressionAtlasiQ6AWC2 baseline and differential
GenevisibleiQ6AWC2 HS

Organism-specific databases

HPAiHPA044005

Interactioni

GO - Molecular functioni

  • kinase binding Source: BHF-UCL
  • protein-containing complex scaffold activity Source: BHF-UCL

Protein-protein interaction databases

BioGridi123070, 15 interactors
IntActiQ6AWC2, 5 interactors
MINTiQ6AWC2
STRINGi9606.ENSP00000384222

Structurei

3D structure databases

ProteinModelPortaliQ6AWC2
SMRiQ6AWC2
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini10 – 43WW 1PROSITE-ProRule annotationAdd BLAST34
Domaini57 – 90WW 2PROSITE-ProRule annotationAdd BLAST34
Domaini715 – 804C2Add BLAST90

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili121 – 194Sequence analysisAdd BLAST74
Coiled coili224 – 256Sequence analysisAdd BLAST33
Coiled coili302 – 421Sequence analysisAdd BLAST120
Coiled coili859 – 887Sequence analysisAdd BLAST29
Coiled coili1068 – 1144Sequence analysisAdd BLAST77

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi425 – 475Ser-richAdd BLAST51
Compositional biasi526 – 529Poly-Ala4

Sequence similaritiesi

Belongs to the WWC family.Curated

Keywords - Domaini

Coiled coil, Repeat

Phylogenomic databases

eggNOGiKOG3209 Eukaryota
COG5021 LUCA
GeneTreeiENSGT00410000025556
HOVERGENiHBG058082
InParanoidiQ6AWC2
OMAiGWEAGFD
OrthoDBiEOG091G0UU4
PhylomeDBiQ6AWC2
TreeFamiTF324040

Family and domain databases

CDDicd08680 C2_Kibra, 1 hit
cd00201 WW, 2 hits
Gene3Di2.60.40.150, 1 hit
InterProiView protein in InterPro
IPR035892 C2_domain_sf
IPR037771 C2_WWC
IPR001202 WW_dom
IPR036020 WW_dom_sf
PfamiView protein in Pfam
PF00397 WW, 2 hits
SMARTiView protein in SMART
SM00456 WW, 2 hits
SUPFAMiSSF51045 SSF51045, 2 hits
PROSITEiView protein in PROSITE
PS01159 WW_DOMAIN_1, 1 hit
PS50020 WW_DOMAIN_2, 2 hits

Sequences (7)i

Sequence statusi: Complete.

This entry describes 7 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q6AWC2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MPRRAGSGQL PLPRGWEEAR DYDGKVFYID HNTRRTSWID PRDRLTKPLS
60 70 80 90 100
FADCVGDELP WGWEAGFDPQ IGVYYIDHIN KTTQIEDPRK QWRGEQEKML
110 120 130 140 150
KDYLSVAQDA LRTQKELYHV KEQRLALALD EYVRLNDAYK EKSSSHTSLF
160 170 180 190 200
SGSSSSTKYD PDILKAEIST TRLRVKKLKR ELSQMKQELL YKEQGFETLQ
210 220 230 240 250
QIDKKMSGGQ SGYELSEAKA ILTELKSIRK AISSGEKEKQ DLMQSLAKLQ
260 270 280 290 300
ERFHLDQNIG RSEPDLRCSP VNSHLCLSRQ TLDAGSQTSI SGDIGVRSRS
310 320 330 340 350
NLAEKVRLSL QYEEAKRSMA NLKIELSKLD SEAWPGALDI EKEKLMLINE
360 370 380 390 400
KEELLKELQF VTPQKRTQDE LERLEAERQR LEEELLSVRG TPSRALAERL
410 420 430 440 450
RLEERRKELL QKLEETTKLT TYLHSQLKSL SASTLSMSSG SSLGSLASSR
460 470 480 490 500
GSLNTSSRGS LNSLSSTELY YSSQSDQIDV DYQYKLDFLL QEKSGYIPSG
510 520 530 540 550
PITTIHENEV VKSPSQPGQS GLCGVAAAAT GHTPPLAEAP KSVASLSSRS
560 570 580 590 600
SLSSLSPPGS PLVLEGTFPM SSSHDASLHQ FTADFEDCEL SSHFADISLI
610 620 630 640 650
ENQILLDSDS GGASQSLSED KDLNECAREP LYEGTADVEK SLPKRRVIHL
660 670 680 690 700
LGEKTTCVSA AVSDESVAGD SGVYEAFVKQ PSEMEDVTYS EEDVAIVETA
710 720 730 740 750
QVQIGLRYNA KSSSFMVIIA QLRNLHAFLI PHTSKVYFRV AVLPSSTDVS
760 770 780 790 800
CLFRTKVHPP TESILFNDVF RVAISQTALQ QKTLRVDLCS VSKHRREECL
810 820 830 840 850
AGTQISLADL PFSSEVFTLW YNLLPSKQMP CKKNEENEDS VFQPNQPLVD
860 870 880 890 900
SIDLDAVSAL LARTSAELLA VEQELAQEEE EESGQEEPRG PDGDWLTMLR
910 920 930 940 950
EASDEIVAEK EAEVKLPEDS SCTEDLSSCT SVPEMNEDGN RKESNCAKDL
960 970 980 990 1000
RSQPPTRIPT LVDKETNTDE AANDNMAVRP KERSSLSSRQ HPFVRSSVIV
1010 1020 1030 1040 1050
RSQTFSPGER NQYICRLNRS DSDSSTLAKK SLFVRNSTER RSLRVKRTVC
1060 1070 1080 1090 1100
QSVLRRTTQE CPVRTSLDLE LDLQASLTRQ SRLNDELQAL RDLRQKLEEL
1110 1120 1130 1140 1150
KAQGETDLPP GVLEDERFQR LLKQAEKQAE QSKEEQKQGL NAEKLMRQVS
1160 1170 1180 1190
KDVCRLREQS QKVPRQVQSF REKIAYFTRA KISIPSLPAD DV
Length:1,192
Mass (Da):133,891
Last modified:November 13, 2007 - v2
Checksum:i937D419FF18F62C0
GO
Isoform 2 (identifier: Q6AWC2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-205: Missing.

Note: No experimental confirmation available.
Show »
Length:987
Mass (Da):109,863
Checksum:i8346D26F17DC87F3
GO
Isoform 3 (identifier: Q6AWC2-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-318: Missing.

Note: No experimental confirmation available.
Show »
Length:874
Mass (Da):97,402
Checksum:i9562CB76735607FA
GO
Isoform 4 (identifier: Q6AWC2-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     588-637: CELSSHFADISLIENQILLDSDSGGASQSLSEDKDLNECAREPLYEGTAD → Y

Note: No experimental confirmation available.
Show »
Length:1,143
Mass (Da):128,685
Checksum:iB7588FB75417ADB7
GO
Isoform 5 (identifier: Q6AWC2-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-98: Missing.
     786-1192: VDLCSVSKHR...SIPSLPADDV → KNFTFVTAITHGVCLPLPVPMPSFA

Note: No experimental confirmation available.
Show »
Length:712
Mass (Da):78,825
Checksum:i272020787DAB3E1D
GO
Isoform 6 (identifier: Q6AWC2-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     895-895: W → WLNTYFLCCWELKDDVFTRLTVKPL

Note: No experimental confirmation available.
Show »
Length:1,216
Mass (Da):136,792
Checksum:i17385946EC6CBFBE
GO
Isoform 7 (identifier: Q6AWC2-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-895: MPRRAGSGQL...EEPRGPDGDW → MPRLRVHGACLPTKSVLFLFYHR

Note: No experimental confirmation available.
Show »
Length:320
Mass (Da):36,660
Checksum:iFDA6B5A0582B8E2D
GO

Sequence cautioni

The sequence AAH17957 differs from that shown. Reason: Erroneous initiation.Curated
The sequence AAI07684 differs from that shown. Contaminating sequence. Potential poly-A sequence.Curated
The sequence BAB15215 differs from that shown. Reason: Erroneous initiation.Curated
The sequence BAB85032 differs from that shown. Reason: Erroneous initiation.Curated
The sequence CAD97477 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti108Q → R in BAC86418 (PubMed:14702039).Curated1
Sequence conflicti177K → E in BAC86418 (PubMed:14702039).Curated1
Sequence conflicti969D → Y in CAH10569 (PubMed:17974005).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_036965773A → S1 PublicationCorresponds to variant dbSNP:rs11941467Ensembl.1
Natural variantiVAR_036966816V → F2 PublicationsCorresponds to variant dbSNP:rs11734376Ensembl.1
Natural variantiVAR_036967904D → H2 PublicationsCorresponds to variant dbSNP:rs3814422Ensembl.1
Natural variantiVAR_062108979R → C. Corresponds to variant dbSNP:rs45470696Ensembl.1
Natural variantiVAR_0369681189A → T1 PublicationCorresponds to variant dbSNP:rs4862155Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0292131 – 895MPRRA…PDGDW → MPRLRVHGACLPTKSVLFLF YHR in isoform 7. 1 PublicationAdd BLAST895
Alternative sequenceiVSP_0292141 – 318Missing in isoform 3. 1 PublicationAdd BLAST318
Alternative sequenceiVSP_0292151 – 205Missing in isoform 2. 1 PublicationAdd BLAST205
Alternative sequenceiVSP_0292161 – 98Missing in isoform 5. 1 PublicationAdd BLAST98
Alternative sequenceiVSP_029217588 – 637CELSS…EGTAD → Y in isoform 4. 1 PublicationAdd BLAST50
Alternative sequenceiVSP_029218786 – 1192VDLCS…PADDV → KNFTFVTAITHGVCLPLPVP MPSFA in isoform 5. 1 PublicationAdd BLAST407
Alternative sequenceiVSP_029219895W → WLNTYFLCCWELKDDVFTRL TVKPL in isoform 6. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK025682 mRNA Translation: BAB15215.1 Different initiation.
AK074260 mRNA Translation: BAB85032.1 Different initiation.
AK126057 mRNA Translation: BAC86418.1
AK127061 mRNA Translation: BAC86807.1
BX647378 mRNA Translation: CAH10569.1
BX647704 mRNA Translation: CAH10570.1
AL832424 mRNA Translation: CAH10641.1
AC093844 Genomic DNA No translation available.
AC099397 Genomic DNA No translation available.
AC019193 Genomic DNA No translation available.
BC017957 mRNA Translation: AAH17957.1 Different initiation.
BC053873 mRNA Translation: AAH53873.2
BC107683 mRNA Translation: AAI07684.1 Sequence problems.
AJ566366 mRNA Translation: CAD97477.1 Different initiation.
CCDSiCCDS34109.2 [Q6AWC2-1]
RefSeqiNP_079225.5, NM_024949.5 [Q6AWC2-1]
XP_011530571.1, XM_011532269.2 [Q6AWC2-6]
UniGeneiHs.333179

Genome annotation databases

EnsembliENST00000403733; ENSP00000384222; ENSG00000151718 [Q6AWC2-1]
ENST00000438543; ENSP00000413521; ENSG00000151718 [Q6AWC2-5]
ENST00000448232; ENSP00000398577; ENSG00000151718 [Q6AWC2-6]
ENST00000504005; ENSP00000427569; ENSG00000151718 [Q6AWC2-3]
ENST00000508747; ENSP00000420835; ENSG00000151718 [Q6AWC2-7]
ENST00000513834; ENSP00000425054; ENSG00000151718 [Q6AWC2-4]
GeneIDi80014
KEGGihsa:80014
UCSCiuc003ivo.5 human [Q6AWC2-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiWWC2_HUMAN
AccessioniPrimary (citable) accession number: Q6AWC2
Secondary accession number(s): Q32Q84
, Q69YQ1, Q6AWB8, Q6ZSY9, Q6ZU09, Q7Z620, Q8TEB8, Q9H6P0
Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 13, 2007
Last sequence update: November 13, 2007
Last modified: June 20, 2018
This is version 114 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health