Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q6AWC2 (WWC2_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 82. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (4) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Protein WWC2
Alternative name(s):
BH-3-only member B
WW domain-containing protein 2
Gene names
Name:WWC2
Synonyms:BOMB
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length1192 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Sequence similarities

Belongs to the WWC family.

Contains 1 C2 domain.

Contains 2 WW domains.

Sequence caution

The sequence AAH17957.1 differs from that shown. Reason: Erroneous initiation.

The sequence AAI07684.1 differs from that shown. Reason: Contaminating sequence. Potential poly-A sequence.

The sequence BAB15215.1 differs from that shown. Reason: Erroneous initiation.

The sequence BAB85032.1 differs from that shown. Reason: Erroneous initiation.

The sequence CAD97477.1 differs from that shown. Reason: Erroneous initiation.

Alternative products

This entry describes 7 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q6AWC2-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q6AWC2-2)

The sequence of this isoform differs from the canonical sequence as follows:
     1-205: Missing.
Note: No experimental confirmation available.
Isoform 3 (identifier: Q6AWC2-3)

The sequence of this isoform differs from the canonical sequence as follows:
     1-318: Missing.
Note: No experimental confirmation available.
Isoform 4 (identifier: Q6AWC2-4)

The sequence of this isoform differs from the canonical sequence as follows:
     588-637: CELSSHFADISLIENQILLDSDSGGASQSLSEDKDLNECAREPLYEGTAD → Y
Note: No experimental confirmation available.
Isoform 5 (identifier: Q6AWC2-5)

The sequence of this isoform differs from the canonical sequence as follows:
     1-98: Missing.
     786-1192: VDLCSVSKHR...SIPSLPADDV → KNFTFVTAITHGVCLPLPVPMPSFA
Note: No experimental confirmation available.
Isoform 6 (identifier: Q6AWC2-6)

The sequence of this isoform differs from the canonical sequence as follows:
     895-895: W → WLNTYFLCCWELKDDVFTRLTVKPL
Note: No experimental confirmation available.
Isoform 7 (identifier: Q6AWC2-7)

The sequence of this isoform differs from the canonical sequence as follows:
     1-895: MPRRAGSGQL...EEPRGPDGDW → MPRLRVHGACLPTKSVLFLFYHR
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 11921192Protein WWC2
PRO_0000309490

Regions

Domain10 – 4334WW 1
Domain57 – 9034WW 2
Domain715 – 80490C2
Coiled coil121 – 19474 Potential
Coiled coil224 – 25633 Potential
Coiled coil302 – 421120 Potential
Coiled coil859 – 88729 Potential
Coiled coil1068 – 114477 Potential
Compositional bias425 – 47551Ser-rich
Compositional bias526 – 5294Poly-Ala

Amino acid modifications

Modified residue10041Phosphothreonine By similarity
Modified residue10221Phosphoserine Ref.6 Ref.7

Natural variations

Alternative sequence1 – 895895MPRRA…PDGDW → MPRLRVHGACLPTKSVLFLF YHR in isoform 7.
VSP_029213
Alternative sequence1 – 318318Missing in isoform 3.
VSP_029214
Alternative sequence1 – 205205Missing in isoform 2.
VSP_029215
Alternative sequence1 – 9898Missing in isoform 5.
VSP_029216
Alternative sequence588 – 63750CELSS…EGTAD → Y in isoform 4.
VSP_029217
Alternative sequence786 – 1192407VDLCS…PADDV → KNFTFVTAITHGVCLPLPVP MPSFA in isoform 5.
VSP_029218
Alternative sequence8951W → WLNTYFLCCWELKDDVFTRL TVKPL in isoform 6.
VSP_029219
Natural variant7731A → S. Ref.4
Corresponds to variant rs11941467 [ dbSNP | Ensembl ].
VAR_036965
Natural variant8161V → F. Ref.2 Ref.4
Corresponds to variant rs11734376 [ dbSNP | Ensembl ].
VAR_036966
Natural variant9041D → H. Ref.1 Ref.2
Corresponds to variant rs3814422 [ dbSNP | Ensembl ].
VAR_036967
Natural variant9791R → C.
Corresponds to variant rs45470696 [ dbSNP | Ensembl ].
VAR_062108
Natural variant11891A → T. Ref.2
Corresponds to variant rs4862155 [ dbSNP | Ensembl ].
VAR_036968

Experimental info

Sequence conflict1081Q → R in BAC86418. Ref.1
Sequence conflict1771K → E in BAC86418. Ref.1
Sequence conflict9691D → Y in CAH10569. Ref.2

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified November 13, 2007. Version 2.
Checksum: 937D419FF18F62C0

FASTA1,192133,891
        10         20         30         40         50         60 
MPRRAGSGQL PLPRGWEEAR DYDGKVFYID HNTRRTSWID PRDRLTKPLS FADCVGDELP 

        70         80         90        100        110        120 
WGWEAGFDPQ IGVYYIDHIN KTTQIEDPRK QWRGEQEKML KDYLSVAQDA LRTQKELYHV 

       130        140        150        160        170        180 
KEQRLALALD EYVRLNDAYK EKSSSHTSLF SGSSSSTKYD PDILKAEIST TRLRVKKLKR 

       190        200        210        220        230        240 
ELSQMKQELL YKEQGFETLQ QIDKKMSGGQ SGYELSEAKA ILTELKSIRK AISSGEKEKQ 

       250        260        270        280        290        300 
DLMQSLAKLQ ERFHLDQNIG RSEPDLRCSP VNSHLCLSRQ TLDAGSQTSI SGDIGVRSRS 

       310        320        330        340        350        360 
NLAEKVRLSL QYEEAKRSMA NLKIELSKLD SEAWPGALDI EKEKLMLINE KEELLKELQF 

       370        380        390        400        410        420 
VTPQKRTQDE LERLEAERQR LEEELLSVRG TPSRALAERL RLEERRKELL QKLEETTKLT 

       430        440        450        460        470        480 
TYLHSQLKSL SASTLSMSSG SSLGSLASSR GSLNTSSRGS LNSLSSTELY YSSQSDQIDV 

       490        500        510        520        530        540 
DYQYKLDFLL QEKSGYIPSG PITTIHENEV VKSPSQPGQS GLCGVAAAAT GHTPPLAEAP 

       550        560        570        580        590        600 
KSVASLSSRS SLSSLSPPGS PLVLEGTFPM SSSHDASLHQ FTADFEDCEL SSHFADISLI 

       610        620        630        640        650        660 
ENQILLDSDS GGASQSLSED KDLNECAREP LYEGTADVEK SLPKRRVIHL LGEKTTCVSA 

       670        680        690        700        710        720 
AVSDESVAGD SGVYEAFVKQ PSEMEDVTYS EEDVAIVETA QVQIGLRYNA KSSSFMVIIA 

       730        740        750        760        770        780 
QLRNLHAFLI PHTSKVYFRV AVLPSSTDVS CLFRTKVHPP TESILFNDVF RVAISQTALQ 

       790        800        810        820        830        840 
QKTLRVDLCS VSKHRREECL AGTQISLADL PFSSEVFTLW YNLLPSKQMP CKKNEENEDS 

       850        860        870        880        890        900 
VFQPNQPLVD SIDLDAVSAL LARTSAELLA VEQELAQEEE EESGQEEPRG PDGDWLTMLR 

       910        920        930        940        950        960 
EASDEIVAEK EAEVKLPEDS SCTEDLSSCT SVPEMNEDGN RKESNCAKDL RSQPPTRIPT 

       970        980        990       1000       1010       1020 
LVDKETNTDE AANDNMAVRP KERSSLSSRQ HPFVRSSVIV RSQTFSPGER NQYICRLNRS 

      1030       1040       1050       1060       1070       1080 
DSDSSTLAKK SLFVRNSTER RSLRVKRTVC QSVLRRTTQE CPVRTSLDLE LDLQASLTRQ 

      1090       1100       1110       1120       1130       1140 
SRLNDELQAL RDLRQKLEEL KAQGETDLPP GVLEDERFQR LLKQAEKQAE QSKEEQKQGL 

      1150       1160       1170       1180       1190 
NAEKLMRQVS KDVCRLREQS QKVPRQVQSF REKIAYFTRA KISIPSLPAD DV 

« Hide

Isoform 2 [UniParc].

Checksum: 8346D26F17DC87F3
Show »

FASTA987109,863
Isoform 3 [UniParc].

Checksum: 9562CB76735607FA
Show »

FASTA87497,402
Isoform 4 [UniParc].

Checksum: B7588FB75417ADB7
Show »

FASTA1,143128,685
Isoform 5 [UniParc].

Checksum: 272020787DAB3E1D
Show »

FASTA71278,825
Isoform 6 [UniParc].

Checksum: 17385946EC6CBFBE
Show »

FASTA1,216136,792
Isoform 7 [UniParc].

Checksum: FDA6B5A0582B8E2D
Show »

FASTA32036,660

References

« Hide 'large scale' references
[1]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3 AND 5), VARIANT HIS-904.
Tissue: Brain.
[2]"The full-ORF clone resource of the German cDNA consortium."
Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I.
BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 698-1192 (ISOFORM 6), VARIANTS PHE-816; HIS-904 AND THR-1189.
Tissue: Fetal kidney, Lung endothelial cell and Melanoma.
[3]"Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H. expand/collapse author list , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[4]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 7), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 408-879 (ISOFORM 1), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 415-1192 (ISOFORM 4), VARIANTS SER-773 AND PHE-816.
Tissue: Kidney and Skin.
[5]"Novel pro-apoptotic BH-3-only proteins, apolipoprotein L6 (ApoL6) and BH3-only member B (BOMB), by genomics and functional expression approaches in cancer."
Liu Z., Jiang Z., Hu C.-A.A.
Submitted (JUN-2003) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 713-1192 (ISOFORM 1).
[6]"Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1022, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.
[7]"System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1022, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AK025682 mRNA. Translation: BAB15215.1. Different initiation.
AK074260 mRNA. Translation: BAB85032.1. Different initiation.
AK126057 mRNA. Translation: BAC86418.1.
AK127061 mRNA. Translation: BAC86807.1.
BX647378 mRNA. Translation: CAH10569.1.
BX647704 mRNA. Translation: CAH10570.1.
AL832424 mRNA. Translation: CAH10641.1.
AC093844 Genomic DNA. No translation available.
AC099397 Genomic DNA. No translation available.
AC019193 Genomic DNA. No translation available.
BC017957 mRNA. Translation: AAH17957.1. Different initiation.
BC053873 mRNA. Translation: AAH53873.2.
BC107683 mRNA. Translation: AAI07684.1. Sequence problems.
AJ566366 mRNA. Translation: CAD97477.1. Different initiation.
CCDSCCDS34109.2. [Q6AWC2-1]
RefSeqNP_079225.5. NM_024949.5. [Q6AWC2-1]
UniGeneHs.333179.

3D structure databases

ProteinModelPortalQ6AWC2.
SMRQ6AWC2. Positions 11-90, 701-824.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid123070. 3 interactions.
IntActQ6AWC2. 3 interactions.
MINTMINT-3318301.

PTM databases

PhosphoSiteQ6AWC2.

Polymorphism databases

DMDM160358940.

Proteomic databases

MaxQBQ6AWC2.
PaxDbQ6AWC2.
PRIDEQ6AWC2.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000378925; ENSP00000368205; ENSG00000151718. [Q6AWC2-5]
ENST00000403733; ENSP00000384222; ENSG00000151718. [Q6AWC2-1]
ENST00000438543; ENSP00000413521; ENSG00000151718. [Q6AWC2-5]
ENST00000448232; ENSP00000398577; ENSG00000151718. [Q6AWC2-6]
ENST00000504005; ENSP00000427569; ENSG00000151718. [Q6AWC2-3]
ENST00000508747; ENSP00000420835; ENSG00000151718. [Q6AWC2-7]
ENST00000513834; ENSP00000425054; ENSG00000151718. [Q6AWC2-4]
GeneID80014.
KEGGhsa:80014.
UCSCuc003ivk.4. human. [Q6AWC2-1]
uc003ivn.4. human. [Q6AWC2-4]
uc003ivo.4. human. [Q6AWC2-7]
uc010irz.3. human. [Q6AWC2-3]

Organism-specific databases

CTD80014.
GeneCardsGC04P184020.
H-InvDBHIX0004660.
HGNCHGNC:24148. WWC2.
HPAHPA044005.
neXtProtNX_Q6AWC2.
PharmGKBPA143485671.
GenAtlasSearch...

Phylogenomic databases

eggNOGCOG5021.
HOVERGENHBG058082.
InParanoidQ6AWC2.
OMADELPWGW.
OrthoDBEOG7DJSNR.
PhylomeDBQ6AWC2.
TreeFamTF324040.

Enzyme and pathway databases

SignaLinkQ6AWC2.

Gene expression databases

ArrayExpressQ6AWC2.
BgeeQ6AWC2.
CleanExHS_WWC2.
GenevestigatorQ6AWC2.

Family and domain databases

Gene3D2.60.40.150. 1 hit.
InterProIPR000008. C2_dom.
IPR001202. WW_dom.
[Graphical view]
PfamPF00397. WW. 2 hits.
[Graphical view]
SMARTSM00456. WW. 2 hits.
[Graphical view]
SUPFAMSSF49562. SSF49562. 1 hit.
SSF51045. SSF51045. 2 hits.
PROSITEPS01159. WW_DOMAIN_1. 1 hit.
PS50020. WW_DOMAIN_2. 2 hits.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSWWC2. human.
GenomeRNAi80014.
NextBio70118.
PROQ6AWC2.

Entry information

Entry nameWWC2_HUMAN
AccessionPrimary (citable) accession number: Q6AWC2
Secondary accession number(s): Q32Q84 expand/collapse secondary AC list , Q69YQ1, Q6AWB8, Q6ZSY9, Q6ZU09, Q7Z620, Q8TEB8, Q9H6P0
Entry history
Integrated into UniProtKB/Swiss-Prot: November 13, 2007
Last sequence update: November 13, 2007
Last modified: July 9, 2014
This is version 82 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 4

Human chromosome 4: entries, gene names and cross-references to MIM