Q69ZP3 (PNKD_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
December 14, 2011.
Version 56.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Probable hydrolase PNKD EC=3.-.-.- Alternative name(s): Myofibrillogenesis regulator 1 Short name=MR-1 Paroxysmal nonkinesiogenic dyskinesia protein | ||||||
| Gene names |
| ||||||
| Organism | Mus musculus (Mouse) | ||||||
| Taxonomic identifier | 10090 [NCBI] | ||||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus |
Protein attributes
| Sequence length | 385 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Function | Probable hydrolase that plays an aggravative role in the development of cardiac hypertrophy via activation of the NF-kappa-B signaling pathway. Ref.9 |
| Subunit structure | Isoform 2 interacts with the sarcomeric proteins, MRLC2, MYOM1 and ENO3 By similarity. |
| Subcellular location | Isoform 1: Membrane; Peripheral membrane protein. Isoform 2: Cytoplasm. Nucleus. Isoform 4: Mitochondrion By similarity. |
| Tissue specificity | Expressed in many discrete areas of the brain. Ref.8 |
| Induction | By Hepatitis C virus core protein. Ref.1 |
| Post-translational modification | Isoform 2 is phosphorylated at Ser-121 upon DNA damage, probably by ATM or ATR By similarity. |
| Miscellaneous | Mice overexpressing Pnkd infused with angiotensin II develop greater cardiac hypertrophy as well as increased cardiac inflammation and fibrosis, compared with angiotensin II-infused normal mice. In these mice, Pnkd overexpression promote nuclear factor kappa B activation. |
| Sequence similarities | Belongs to the metallo-beta-lactamase superfamily. Glyoxalase II family. |
| Sequence caution | The sequence BAC30873.1 differs from that shown. Reason: Erroneous initiation. The sequence BAD32403.1 differs from that shown. Reason: Erroneous initiation. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cytoplasm Membrane Mitochondrion Nucleus |
| Coding sequence diversity | Alternative splicing |
| Ligand | Metal-binding Zinc |
| Molecular function | Hydrolase |
| PTM | Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Cellular component | membrane Inferred from electronic annotation. Source: UniProtKB-SubCell mitochondrionInferred from direct assay. Source: MGI nucleusInferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular function | hydroxyacylglutathione hydrolase activity Inferred from electronic annotation. Source: InterPro zinc ion bindingInferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q69ZP3-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q69ZP3-2) The sequence of this isoform differs from the canonical sequence as follows: 80-142: YSLYTRTWLG...YLIIDTQAGL → AIGFPCGILF...FPEVGSGAQT 143-385: Missing. | ||||||
| Note: Contains a phosphoserine at position 121 (By similarity). | ||||||
| Isoform 3 (identifier: Q69ZP3-3) The sequence of this isoform differs from the canonical sequence as follows: 79-79: W → WAIGFPCGILFFVLTKQEVDKDRLKQMKARQNMRVSNTGE | ||||||
| Isoform 4 (identifier: Q69ZP3-4) The sequence of this isoform differs from the canonical sequence as follows: 1-79: MAAVVAATAL...NPMKAVGLAW → MAWQGWLAPW...RSQRLLFRIG |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 385 | 385 | Probable hydrolase PNKD | PRO_0000299550 | |||||
Regions | |||||||||
| Region | 291 – 293 | 3 | Substrate By similarity | ||||||
| Region | 376 – 379 | 4 | Substrate By similarity | ||||||
Sites | |||||||||
| Metal binding | 172 | 1 | Zinc 1 By similarity | ||||||
| Metal binding | 174 | 1 | Zinc 1 By similarity | ||||||
| Metal binding | 176 | 1 | Zinc 2 By similarity | ||||||
| Metal binding | 177 | 1 | Zinc 2 By similarity | ||||||
| Metal binding | 229 | 1 | Zinc 1 By similarity | ||||||
| Metal binding | 253 | 1 | Zinc 1 By similarity | ||||||
| Metal binding | 253 | 1 | Zinc 2 By similarity | ||||||
| Metal binding | 291 | 1 | Zinc 2 By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 79 | 79 | MAAVV…VGLAW → MAWQGWLAPWLWVSGCWLLF FAFVLLLSPRSCQEQRGFRG LLMTRSQRLLFRIG in isoform 4. | VSP_027741 | |||||
| Alternative sequence | 79 | 1 | W → WAIGFPCGILFFVLTKQEVD KDRLKQMKARQNMRVSNTGE in isoform 3. | VSP_027742 | |||||
| Alternative sequence | 80 – 142 | 63 | YSLYT…TQAGL → AIGFPCGILFFVLTKQEVDK DRLKQMKARQNMRVSNTGEY ESQRYRASPQQAQFPEVGSG AQT in isoform 2. | VSP_027743 | |||||
| Alternative sequence | 143 – 385 | 243 | Missing in isoform 2. | VSP_027744 | |||||
Experimental info | |||||||||
| Sequence conflict | 17 | 1 | N → H in AAL25717. Ref.3 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Transactivating effect of hepatitis C virus core protein: a suppression subtractive hybridization study." Liu M., Liu Y., Cheng J., Zhang S.-L., Wang L., Shao Q., Zhang J., Yang Q. World J. Gastroenterol. 10:1746-1749(2004) [PubMed: 15188498] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORM 2), INDUCTION. |
| [2] | "Isolation of full-length cDNA clones from mouse brain cDNA library made by oligo-capping method." Osada N., Kusuda J., Tanuma R., Ito A., Hirata M., Sugano S., Hashimoto K. Submitted (APR-2000) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4). Strain: C57BL/6. Tissue: Brain. |
| [3] | "Cloning of FKSG19, a novel gene expressed in ovarian tumour tissue." Wang Y.-G., Gong L. Submitted (OCT-2000) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2). |
| [4] | "Cloning and functional analysis of Mus musculus myofibrillogenesis regulator 1 (MR-1)." Hu Y., Li T., Wang Y. Submitted (MAY-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2). Strain: C57BL/6J. Tissue: Spleen. |
| [5] | "Prediction of the coding sequences of mouse homologues of KIAA gene: IV. The complete nucleotide sequences of 500 mouse KIAA-homologous cDNAs identified by screening of terminal sequences of cDNA clones randomly sampled from size-fractionated libraries." Okazaki N., Kikuno R., Ohara R., Inamoto S., Koseki H., Hiraoka S., Saga Y., Seino S., Nishimura M., Kaisho T., Hoshino K., Kitamura H., Nagase T., Ohara O., Koga H. DNA Res. 11:205-218(2004) [PubMed: 15368895] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Pancreatic islet. |
| [6] | "The transcriptional landscape of the mammalian genome." Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. Hayashizaki Y.Science 309:1559-1563(2005) [PubMed: 16141072] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (PARTIAL ISOFORM 4). Strain: C57BL/6J. Tissue: Aorta and Tongue. |
| [7] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3). Strain: C57BL/6 and FVB/N. Tissue: Brain and Mammary tumor. |
| [8] | "The gene for paroxysmal non-kinesigenic dyskinesia encodes an enzyme in a stress response pathway." Lee H.-Y., Xu Y., Huang Y., Ahn A.H., Auburger G.W., Pandolfo M., Kwiecinski H., Grimes D.A., Lang A.E., Nielsen J.E., Averyanov Y., Servidei S., Friedman A., Van Bogaert P., Abramowicz M.J., Bruno M.K., Sorensen B.F., Tang L., Fu Y.-H., Ptacek L.J. Hum. Mol. Genet. 13:3161-3170(2004) [PubMed: 15496428] [Abstract] Cited for: TISSUE SPECIFICITY. |
| [9] | "Overexpression of myofibrillogenesis regulator-1 aggravates cardiac hypertrophy induced by angiotensin II in mice." Li H.-L., She Z.-G., Li T.-B., Wang A.-B., Yang Q., Wei Y.-S., Wang Y.-G., Liu D.-P. Hypertension 49:1399-1408(2007) [PubMed: 17420335] [Abstract] Cited for: TRANSGENIC MICE, FUNCTION. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AY039041 mRNA. Translation: AAK83447.1. AY039042 Genomic DNA. Translation: AAK83448.1. AB041609 mRNA. Translation: BAA95092.1. AF318058 mRNA. Translation: AAL25717.1. AY299972 mRNA. Translation: AAP58373.1. AK173125 mRNA. Translation: BAD32403.1. Different initiation. AK009545 mRNA. Translation: BAB26351.1. AK012976 mRNA. Translation: BAB28577.2. AK041238 mRNA. Translation: BAC30873.1. Different initiation. AK166548 mRNA. Translation: BAE38846.1. BC008274 mRNA. Translation: AAH08274.1. BC058945 mRNA. Translation: AAH58945.1. BC116236 mRNA. Translation: AAI16237.1. BC116237 mRNA. Translation: AAI16238.1. |
| IPI | IPI00121559. IPI00187405. IPI00453946. IPI00464245. |
| RefSeq | NP_001034598.1. NM_001039509.1. NP_064383.1. NM_019999.2. NP_079856.2. NM_025580.2. |
| UniGene | Mm.384726. |
3D structure databases | |
| HSSP | HSSP built from PDB template 1QH5 based on UniProtKB Q16775. |
| ProteinModelPortal | Q69ZP3. |
| SMR | Q69ZP3. Positions 119-384. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | Q69ZP3. |
Proteomic databases | |
| PRIDE | Q69ZP3. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENSMUST00000027370; ENSMUSP00000027370; ENSMUSG00000026179. ENSMUST00000087225; ENSMUSP00000084477; ENSMUSG00000026179. ENSMUST00000087226; ENSMUSP00000084478; ENSMUSG00000026179. ENSMUST00000113805; ENSMUSP00000109436; ENSMUSG00000026179. |
| GeneID | 56695. |
| KEGG | mmu:56695. |
| UCSC | uc007bls.1. mouse. uc007blt.1. mouse. uc007blu.1. mouse. uc007blw.1. mouse. |
Organism-specific databases | |
| CTD | 25953. |
| MGI | MGI:1930773. Pnkd. |
| Rouge | Search... |
Phylogenomic databases | |
| eggNOG | maNOG16824. |
| GeneTree | ENSGT00530000063033. |
| HOVERGEN | HBG001152. |
| OMA | HQDCRVY. |
| OrthoDB | EOG412M5W. |
Gene expression databases | |
| ArrayExpress | Q69ZP3. |
| Bgee | Q69ZP3. |
| CleanEx | MM_MR1. MM_PNKD. |
| Genevestigator | Q69ZP3. |
Family and domain databases | |
| InterPro | IPR001279. Beta-lactamas-like. IPR017782. Hydroxyacylglutathione_Hdrlase. [Graphical view] |
| PANTHER | PTHR11935:SF7. PTHR11935:SF7. 1 hit. |
| Pfam | PF00753. Lactamase_B. 1 hit. [Graphical view] |
| SMART | SM00849. Lactamase_B. 1 hit. [Graphical view] |
| TIGRFAMs | TIGR03413. GSH_gloB. 1 hit. |
| ProtoNet | Search... |
Other | |
| NextBio | 313119. |
| SOURCE | Search... |
Entry information
| Entry name | PNKD_MOUSE | ||||||||
| Accession | Primary (citable) accession number: Q69ZP3 Secondary accession number(s): Q3TLE6 Q9JJA3 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with