Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Probable hydrolase PNKD

Gene

Pnkd

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Probable hydrolase that plays an aggravative role in the development of cardiac hypertrophy via activation of the NF-kappa-B signaling pathway.1 Publication

Miscellaneous

Mice overexpressing Pnkd infused with angiotensin II develop greater cardiac hypertrophy as well as increased cardiac inflammation and fibrosis, compared with angiotensin II-infused normal mice. In these mice, Pnkd overexpression promote nuclear factor kappa B activation.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Metal bindingi172Zinc 1By similarity1
Metal bindingi174Zinc 1By similarity1
Metal bindingi176Zinc 2By similarity1
Metal bindingi177Zinc 2By similarity1
Metal bindingi229Zinc 1By similarity1
Metal bindingi253Zinc 1By similarity1
Metal bindingi253Zinc 2By similarity1
Metal bindingi291Zinc 2By similarity1

GO - Molecular functioni

GO - Biological processi

  • methylglyoxal catabolic process to D-lactate via S-lactoyl-glutathione Source: InterPro
  • negative regulation of neurotransmitter secretion Source: MGI
  • neuromuscular process controlling posture Source: MGI
  • regulation of dopamine metabolic process Source: MGI
  • regulation of synaptic transmission, dopaminergic Source: MGI

Keywordsi

Molecular functionHydrolase
LigandMetal-binding, Zinc

Names & Taxonomyi

Protein namesi
Recommended name:
Probable hydrolase PNKD (EC:3.-.-.-)
Alternative name(s):
Myofibrillogenesis regulator 1
Short name:
MR-1
Paroxysmal nonkinesiogenic dyskinesia protein
Gene namesi
Name:Pnkd
Synonyms:Brp17, Kiaa1184, Mr1, Tahccp2
ORF Names:Fksg19, MNCb-5687
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 1

Organism-specific databases

MGIiMGI:1930773. Pnkd.

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Membrane, Mitochondrion, Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002995501 – 385Probable hydrolase PNKDAdd BLAST385

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Isoform 2 (identifier: Q69ZP3-2)
Modified residuei121PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiQ69ZP3.
PeptideAtlasiQ69ZP3.
PRIDEiQ69ZP3.

PTM databases

iPTMnetiQ69ZP3.
PhosphoSitePlusiQ69ZP3.

Expressioni

Tissue specificityi

Expressed in many discrete areas of the brain.1 Publication

Inductioni

By Hepatitis C virus core protein.1 Publication

Gene expression databases

BgeeiENSMUSG00000026179.
CleanExiMM_MR1.
MM_PNKD.
ExpressionAtlasiQ69ZP3. baseline and differential.
GenevisibleiQ69ZP3. MM.

Interactioni

Subunit structurei

Isoform 2 interacts with the sarcomeric proteins, MRLC2, MYOM1 and ENO3.By similarity

Protein-protein interaction databases

IntActiQ69ZP3. 1 interactor.
MINTiQ69ZP3.
STRINGi10090.ENSMUSP00000027370.

Structurei

3D structure databases

ProteinModelPortaliQ69ZP3.
SMRiQ69ZP3.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni291 – 293Substrate bindingBy similarity3
Regioni376 – 379Substrate bindingBy similarity4

Sequence similaritiesi

Phylogenomic databases

eggNOGiKOG0813. Eukaryota.
COG0491. LUCA.
GeneTreeiENSGT00530000063033.
HOVERGENiHBG001152.
InParanoidiQ69ZP3.
OMAiHTVGHMI.
OrthoDBiEOG091G08UZ.
PhylomeDBiQ69ZP3.
TreeFamiTF105273.

Family and domain databases

CDDicd07723. hydroxyacylglutathione_hydrola. 1 hit.
Gene3Di3.60.15.10. 1 hit.
HAMAPiMF_01374. Glyoxalase_2. 1 hit.
InterProiView protein in InterPro
IPR035680. Clx_II_MBL.
IPR032282. HAGH_C.
IPR017782. Hydroxyacylglutathione_Hdrlase.
IPR001279. Metallo-B-lactamas.
IPR036866. RibonucZ/Hydroxyglut_hydro.
PfamiView protein in Pfam
PF16123. HAGH_C. 1 hit.
PF00753. Lactamase_B. 1 hit.
SMARTiView protein in SMART
SM00849. Lactamase_B. 1 hit.
SUPFAMiSSF56281. SSF56281. 1 hit.
TIGRFAMsiTIGR03413. GSH_gloB. 1 hit.

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q69ZP3-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAAVVAATAL KGRGARNARV LRGILSGATA NKASQNRTRA LQSHSSPECK
60 70 80 90 100
EEPEPLSPEL EYIPRKRGKN PMKAVGLAWY SLYTRTWLGY LFYRQQLRRA
110 120 130 140 150
RNRYPKGHSK TQPRLFNGVK VLPIPVLSDN YSYLIIDTQA GLAVAVDPSD
160 170 180 190 200
PRAVQASIEK ERVNLVAILC THKHWDHSGG NRDLSRRHRD CRVYGSPQDG
210 220 230 240 250
IPYLTHPLCH QDVVSVGRLQ IRALATPGHT QGHLVYLLDG EPYKGPSCLF
260 270 280 290 300
SGDLLFLSGC GRTFEGTAET MLSSLDTVLD LGDDTLLWPG HEYAEENLGF
310 320 330 340 350
AGVVEPENLA RERKMQWVQR QRMERKSTCP STLGEERAYN PFLRTHCLEL
360 370 380
QEALGPGPGP TSDDGCSRAQ LLEELRRLKD MHKSK
Length:385
Mass (Da):43,017
Last modified:September 11, 2007 - v2
Checksum:i2327D63BFDDA849A
GO
Isoform 2 (identifier: Q69ZP3-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     80-142: YSLYTRTWLG...YLIIDTQAGL → AIGFPCGILF...FPEVGSGAQT
     143-385: Missing.

Show »
Length:142
Mass (Da):15,586
Checksum:i5F4F298C8322D810
GO
Isoform 3 (identifier: Q69ZP3-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     79-79: W → WAIGFPCGILFFVLTKQEVDKDRLKQMKARQNMRVSNTGE

Show »
Length:424
Mass (Da):47,469
Checksum:i0D67C6EB5DF5851B
GO
Isoform 4 (identifier: Q69ZP3-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-79: MAAVVAATAL...NPMKAVGLAW → MAWQGWLAPW...RSQRLLFRIG

Show »
Length:360
Mass (Da):40,982
Checksum:i2850E188CA7AF41C
GO

Sequence cautioni

The sequence BAC30873 differs from that shown. Reason: Erroneous initiation.Curated
The sequence BAD32403 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti17N → H in AAL25717 (Ref. 3) Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0277411 – 79MAAVV…VGLAW → MAWQGWLAPWLWVSGCWLLF FAFVLLLSPRSCQEQRGFRG LLMTRSQRLLFRIG in isoform 4. 1 PublicationAdd BLAST79
Alternative sequenceiVSP_02774279W → WAIGFPCGILFFVLTKQEVD KDRLKQMKARQNMRVSNTGE in isoform 3. 1 Publication1
Alternative sequenceiVSP_02774380 – 142YSLYT…TQAGL → AIGFPCGILFFVLTKQEVDK DRLKQMKARQNMRVSNTGEY ESQRYRASPQQAQFPEVGSG AQT in isoform 2. 5 PublicationsAdd BLAST63
Alternative sequenceiVSP_027744143 – 385Missing in isoform 2. 5 PublicationsAdd BLAST243

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY039041 mRNA. Translation: AAK83447.1.
AY039042 Genomic DNA. Translation: AAK83448.1.
AB041609 mRNA. Translation: BAA95092.1.
AF318058 mRNA. Translation: AAL25717.1.
AY299972 mRNA. Translation: AAP58373.1.
AK173125 mRNA. Translation: BAD32403.1. Different initiation.
AK009545 mRNA. Translation: BAB26351.1.
AK012976 mRNA. Translation: BAB28577.2.
AK041238 mRNA. Translation: BAC30873.1. Different initiation.
AK166548 mRNA. Translation: BAE38846.1.
BC008274 mRNA. Translation: AAH08274.1.
BC058945 mRNA. Translation: AAH58945.1.
BC116236 mRNA. Translation: AAI16237.1.
BC116237 mRNA. Translation: AAI16238.1.
CCDSiCCDS15045.1. [Q69ZP3-4]
CCDS35613.1. [Q69ZP3-1]
CCDS35614.1. [Q69ZP3-2]
RefSeqiNP_001034598.1. NM_001039509.1. [Q69ZP3-1]
NP_064383.1. NM_019999.2. [Q69ZP3-4]
NP_079856.2. NM_025580.2.
UniGeneiMm.384726.

Genome annotation databases

EnsembliENSMUST00000027370; ENSMUSP00000027370; ENSMUSG00000026179. [Q69ZP3-1]
ENSMUST00000087225; ENSMUSP00000084477; ENSMUSG00000026179. [Q69ZP3-4]
ENSMUST00000087226; ENSMUSP00000084478; ENSMUSG00000026179. [Q69ZP3-3]
GeneIDi56695.
KEGGimmu:56695.
UCSCiuc007bls.1. mouse. [Q69ZP3-2]
uc007blt.1. mouse. [Q69ZP3-1]
uc007blu.1. mouse. [Q69ZP3-3]
uc007blw.1. mouse. [Q69ZP3-4]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiPNKD_MOUSE
AccessioniPrimary (citable) accession number: Q69ZP3
Secondary accession number(s): Q3TLE6
, Q6PD45, Q8BRV8, Q920D4, Q9CSF5, Q9D765, Q9JJA3
Entry historyiIntegrated into UniProtKB/Swiss-Prot: September 11, 2007
Last sequence update: September 11, 2007
Last modified: February 28, 2018
This is version 98 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome