Reviewed,
UniProtKB/Swiss-Prot Q69ZM6 (STK36_MOUSE)
Last modified
January 19, 2010.
Version 53.
History...
Clusters with 100%,
90%,
50% identity |
Documents (3) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Serine/threonine-protein kinase 36 EC=2.7.11.1 Alternative name(s): Fused homolog | ||||
| Gene names |
| ||||
| Organism | Mus musculus (Mouse) | ||||
| Taxonomic identifier | 10090 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus |
Protein attributes
| Sequence length | 1268 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level. |
General annotation (Comments)
| Function | Serine/threonine protein kinase required for postnatal development, possibly by regulating the homeostasis of cerebral spinal fluid or ciliary function. Controls the activity of the transcriptional regulators GLI1, GLI2 and GLI3 by opposing the effect of SUFU and promoting their nuclear localization. GLI2 requires an additional function of STK36 to become transcriptionally active, but the enzyme does not need to possess an active kinase catalytic site for this to occur By similarity. Ref.4 |
| Catalytic activity | ATP + a protein = ADP + a phosphoprotein. UniProtKB P23647 |
| Cofactor | Magnesium. |
| Subcellular location | Cytoplasm By similarity. Nucleus By similarity. Note: Low levels also present in the nucleus By similarity. |
| Tissue specificity | Weakly expressed in the heart and thymus, present at moderate to high levels in the lungs, pancreas, and kidneys and at higher levels in the brain and cerebellum. Very highly expressed in the testis. Ref.4 |
| Developmental stage | At E13.5 is widely distributed in the forebrain, midbrain, hindbrain, spinal cord, somites, developing limb buds and skin. Ref.3 |
| Disruption phenotype | Mice display profound growth retardation with a communicating form of hydrocephalus, nasal inflammation and early mortality. Ref.4 |
| Sequence similarities | Belongs to the protein kinase superfamily. Ser/Thr protein kinase family. Contains 1 protein kinase domain. |
| Sequence caution | The sequence BAD32420.1 differs from that shown. Reason: Frameshift at position 1174. |
Ontologies
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 Ref.1 (identifier: Q69ZM6-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 2 Ref.2 (identifier: Q69ZM6-2) The sequence of this isoform differs from the canonical sequence as follows: 225-225: V → SCFKNFLQGLLTKDPRQRLSWPDLLHHPFIAGRVTI 426-553: Missing. 827-827: Q → QVQ 984-984: V → VCCHHLSLLQAE | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 Ref.2 (identifier: Q69ZM6-3) The sequence of this isoform differs from the canonical sequence as follows: 225-225: V → SCFKNFLQGLLTKDPRQRLSWPDLLHHPFIAGRVTI 984-984: V → VCCHHLSLLQAE 1002-1007: KQFVNT → SGRSLP 1008-1268: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1268 | 1268 | Serine/threonine-protein kinase 36 | PRO_0000229021 | |||||
Regions | |||||||||
| Domain | 4 – 254 | 251 | Protein kinase | ||||||
| Nucleotide binding | 10 – 18 | 9 | ATP By similarity UniProtKB P23647 | ||||||
Sites | |||||||||
| Active site | 125 | 1 | Proton acceptor By similarity UniProtKB P23647 | ||||||
| Binding site | 33 | 1 | ATP By similarity UniProtKB P23647 | ||||||
Natural variations | |||||||||
| Alternative sequence | 225 | 1 | V → SCFKNFLQGLLTKDPRQRLS WPDLLHHPFIAGRVTI in isoform 2 and isoform 3. Ref.2 | VSP_051984 | |||||
| Alternative sequence | 426 – 553 | 128 | Missing in isoform 2. Ref.2 | VSP_051985 | |||||
| Alternative sequence | 827 | 1 | Q → QVQ in isoform 2. Ref.2 | VSP_051986 | |||||
| Alternative sequence | 984 | 1 | V → VCCHHLSLLQAE in isoform 2 and isoform 3. Ref.2 | VSP_051987 | |||||
| Alternative sequence | 1002 – 1007 | 6 | KQFVNT → SGRSLP in isoform 3. Ref.2 | VSP_051988 | |||||
| Alternative sequence | 1008 – 1268 | 261 | Missing in isoform 3. Ref.2 | VSP_051989 | |||||
Experimental info | |||||||||
| Sequence conflict | 295 | 1 | G → R in BAD32420. Ref.1 | ||||||
| Sequence conflict | 436 | 1 | Y → H in AAH43103. Ref.2 | ||||||
| Sequence conflict | 809 | 1 | Y → C in BAD32420. Ref.1 | ||||||
| Sequence conflict | 837 | 1 | V → A in BAD32420. Ref.1 | ||||||
| Sequence conflict | 844 | 1 | I → T in BAD32420. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Prediction of the coding sequences of mouse homologues of KIAA gene: IV. The complete nucleotide sequences of 500 mouse KIAA-homologous cDNAs identified by screening of terminal sequences of cDNA clones randomly sampled from size-fractionated libraries." Okazaki N., Kikuno R., Ohara R., Inamoto S., Koseki H., Hiraoka S., Saga Y., Seino S., Nishimura M., Kaisho T., Hoshino K., Kitamura H., Nagase T., Ohara O., Koga H. DNA Res. 11:205-218(2004) [PubMed: 15368895] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Fetal brain. |
| [2] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3). Strain: C57BL/6. Tissue: Brain. |
| [3] | "Gli regulation by the opposing activities of fused and suppressor of fused." Murone M., Luoh S.-L., Stone D., Li W., Gurney A., Armanini M., Grey C., Rosenthal A., de Sauvage F.J. Nat. Cell Biol. 2:310-312(2000) [PubMed: 10806483] [Abstract] Cited for: DEVELOPMENTAL STAGE. |
| [4] | "Loss of the serine/threonine kinase fused results in postnatal growth defects and lethality due to progressive hydrocephalus." Merchant M., Evangelista M., Luoh S.-M., Frantz G.D., Chalasani S., Carano R.A., van Hoy M., Ramirez J., Ogasawara A.K., McFarland L.M., Filvaroff E.H., French D.M., de Sauvage F.J. Mol. Cell. Biol. 25:7054-7068(2005) [PubMed: 16055717] [Abstract] Cited for: FUNCTION, TISSUE SPECIFICITY, DISRUPTION PHENOTYPE. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AK173142 Transcribed RNA. Translation: BAD32420.1. Sequence problems. BC043103 mRNA. Translation: AAH43103.1. BC058698 mRNA. Translation: AAH58698.1. |
| IPI | IPI00187463. IPI00461604. IPI00621144. |
| RefSeq | NP_778196.2. |
| UniGene | Mm.310974 |
3D structure databases | |
| SMR | Q69ZM6. Positions 1-207, 1069-1217. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | Q69ZM6. |
Proteomic databases | |
| PRIDE | Q69ZM6. |
Genome annotation databases | |
| Ensembl | ENSMUST00000042446; ENSMUSP00000040924; ENSMUSG00000033276; Mus musculus. [Genome view] ENSMUST00000087183; ENSMUSP00000084430; ENSMUSG00000033276; Mus musculus. [Genome view] ENSMUST00000113699; ENSMUSP00000109329; ENSMUSG00000033276; Mus musculus. [Genome view] |
| GeneID | 269209. |
| KEGG | mmu:269209. |
| UCSC | uc007bmu.1. mouse. |
Organism-specific databases | |
| CTD | 269209. |
| MGI | MGI:1920831. Stk36. |
| Rouge | Search... |
Phylogenomic databases | |
| eggNOG | roNOG07048. |
| HOVERGEN | Q69ZM6. |
| PhylomeDB | Q69ZM6. |
Enzyme and pathway databases | |
| BRENDA | 2.7.11.1. 244. |
Gene expression databases | |
| ArrayExpress | Q69ZM6. |
| Bgee | Q69ZM6. |
| Genevestigator | Q69ZM6. |
| GermOnline | ENSMUSG00000033276. Mus musculus. |
Family and domain databases | |
| InterPro | IPR011989. ARM-like. IPR016024. ARM-type_fold. IPR011009. Kinase-like_dom. IPR000719. Prot_kinase_cat_dom. IPR017441. Protein_kinase_ATP_BS. IPR017442. Se/Thr_prot_kinase-like_dom. IPR008271. Ser/Thr_prot_kinase_AS. IPR002290. Ser/Thr_prot_kinase_dom. [Graphical view] |
| Gene3D | G3DSA:1.25.10.10. ARM-like. 1 hit. |
| Pfam | PF00069. Pkinase. 1 hit. [Graphical view] |
| SMART | SM00220. S_TKc. 1 hit. [Graphical view] |
| PROSITE | PS00107. PROTEIN_KINASE_ATP. 1 hit. PS50011. PROTEIN_KINASE_DOM. 1 hit. PS00108. PROTEIN_KINASE_ST. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| NextBio | 392738. |
| SOURCE | Search... |
Entry information
| Entry name | STK36_MOUSE | ||||||||
| Accession | Primary (citable) accession number: Q69ZM6 Secondary accession number(s): Q6PDI0, Q80XQ6 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| Human and mouse protein kinases Human and mouse protein kinases: classification and index |
| SIMILARITY comments Index of protein domains and families |

Clusters with


