Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Serine/threonine-protein kinase 36

Gene

Stk36

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Serine/threonine protein kinase which plays an important role in the sonic hedgehog (Shh) pathway by regulating the activity of GLI transcription factors. Controls the activity of the transcriptional regulators GLI1, GLI2 and GLI3 by opposing the effect of SUFU and promoting their nuclear localization. GLI2 requires an additional function of STK36 to become transcriptionally active, but the enzyme does not need to possess an active kinase catalytic site for this to occur. Required for postnatal development, possibly by regulating the homeostasis of cerebral spinal fluid or ciliary function. Essential for construction of the central pair apparatus of motile cilia.3 Publications

Catalytic activityi

ATP + a protein = ADP + a phosphoprotein.By similarity

Cofactori

Mg2+Curated

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Binding sitei33ATPPROSITE-ProRule annotationBy similarity1
Active sitei125Proton acceptorPROSITE-ProRule annotationBy similarity1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Nucleotide bindingi10 – 18ATPPROSITE-ProRule annotationBy similarity9

GO - Molecular functioni

GO - Biological processi

  • brain development Source: MGI
  • cilium assembly Source: UniProtKB
  • epithelial cilium movement Source: MGI
  • positive regulation of hh target transcription factor activity Source: UniProtKB
  • positive regulation of smoothened signaling pathway Source: UniProtKB
  • post-embryonic development Source: UniProtKB
  • regulation of sequence-specific DNA binding transcription factor activity Source: UniProtKB
Complete GO annotation...

Keywords - Molecular functioni

Developmental protein, Kinase, Serine/threonine-protein kinase, Transferase

Keywords - Biological processi

Cilium biogenesis/degradation

Keywords - Ligandi

ATP-binding, Magnesium, Metal-binding, Nucleotide-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Serine/threonine-protein kinase 36 (EC:2.7.11.1)
Alternative name(s):
Fused homolog
Gene namesi
Name:Stk36Imported
Synonyms:Kiaa1278
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 1

Organism-specific databases

MGIiMGI:1920831. Stk36.

Subcellular locationi

GO - Cellular componenti

  • cytoplasm Source: UniProtKB
  • nucleus Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Disruption phenotypei

Mice display profound growth retardation with a communicating form of hydrocephalus, nasal inflammation and early mortality.1 Publication

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002290211 – 1316Serine/threonine-protein kinase 36Add BLAST1316

Proteomic databases

PaxDbiQ69ZM6.
PRIDEiQ69ZM6.

PTM databases

PhosphoSitePlusiQ69ZM6.

Expressioni

Tissue specificityi

Weakly expressed in the heart and thymus, present at moderate to high levels in the lungs, pancreas, and kidneys and at higher levels in the brain and cerebellum. Very highly expressed in the testis.2 Publications

Developmental stagei

At E13.5 is widely distributed in the forebrain, midbrain, hindbrain, spinal cord, somites, developing limb buds and skin.1 Publication

Gene expression databases

BgeeiENSMUSG00000033276.
ExpressionAtlasiQ69ZM6. baseline and differential.
GenevisibleiQ69ZM6. MM.

Interactioni

Subunit structurei

Interacts with SPAG16 and KIF27.1 Publication

GO - Molecular functioni

Protein-protein interaction databases

DIPiDIP-59751N.
STRINGi10090.ENSMUSP00000084430.

Structurei

3D structure databases

ProteinModelPortaliQ69ZM6.
SMRiQ69ZM6.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini4 – 254Protein kinasePROSITE-ProRule annotationAdd BLAST251

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi826 – 831Poly-Ala6
Compositional biasi852 – 1162Leu-richAdd BLAST311

Sequence similaritiesi

Belongs to the protein kinase superfamily. Ser/Thr protein kinase family.PROSITE-ProRule annotation
Contains 1 protein kinase domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiKOG0597. Eukaryota.
ENOG410XRQ6. LUCA.
GeneTreeiENSGT00860000133711.
HOGENOMiHOG000015284.
HOVERGENiHBG094005.
InParanoidiQ69ZM6.
KOiK06228.
OMAiMACGDPQ.
OrthoDBiEOG091G04G9.
PhylomeDBiQ69ZM6.
TreeFamiTF105340.

Family and domain databases

Gene3Di1.25.10.10. 1 hit.
InterProiIPR011989. ARM-like.
IPR016024. ARM-type_fold.
IPR011009. Kinase-like_dom.
IPR000719. Prot_kinase_dom.
IPR017441. Protein_kinase_ATP_BS.
IPR008271. Ser/Thr_kinase_AS.
[Graphical view]
PfamiPF00069. Pkinase. 1 hit.
[Graphical view]
SMARTiSM00220. S_TKc. 1 hit.
[Graphical view]
SUPFAMiSSF48371. SSF48371. 6 hits.
SSF56112. SSF56112. 1 hit.
PROSITEiPS00107. PROTEIN_KINASE_ATP. 1 hit.
PS50011. PROTEIN_KINASE_DOM. 1 hit.
PS00108. PROTEIN_KINASE_ST. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 11 Publication (identifier: Q69ZM6-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MEKYHVLEMI GEGSFGRVYK GRKKYSAQVV ALKFIPKLGR SEKELRNLQR
60 70 80 90 100
EIEIMRGLWH PNIVHMLDSF ETDKEVVVVT DYAEGELFQI LEDDGKLPED
110 120 130 140 150
QVQAIAAQLV SALYYLHSHR ILHRDMKPQN ILLAKGGGIK LCDFGFARAM
160 170 180 190 200
STNTMVLTSI KGTPLYMSPE LVEERPYDHT ADLWSVGCIL YELAVGTPPF
210 220 230 240 250
YTTSIFQLVS LILKDPVRWP STISSCFKNF LQGLLTKDPR QRLSWPDLLH
260 270 280 290 300
HPFIAGRVTI ITEPAGSDLG TPFTSRLPPE LQVLKDEQAH RLAPKGNQSR
310 320 330 340 350
ILRQACKLMA EEAKQKEDQN AGSALEQEDG LCKVTPSTAP VPGLKATPQE
360 370 380 390 400
SSLLAGILAS EMKNNWEDWG AGEAPRTSRE NHINLECEQG FPEPRPEAMG
410 420 430 440 450
RQSTDVVDPE NEEPDSDDEW QRLLETSEPG PVQLKSPLTL LCNPDFCQRI
460 470 480 490 500
QSQLRGTGEQ ILKGVLDGVS HLLPVLRILS SLLSSCNDSV LLYSFCQEAG
510 520 530 540 550
LPELPLSLLR YSQESSSIQQ QPWYGALLRD LVAVVQAYFS CTFNLERSQT
560 570 580 590 600
GDSLQVFQEA ASLFLDLLGK LLAQSDDSEQ TFRRDSLMCF AVLCEAVDGN
610 620 630 640 650
SWAVSKAFYS SLLTTQRAVL DGLLHGLTVP QLPFHTPPGA PQVSQPLREQ
660 670 680 690 700
SEDVPGAISS ALAAMCTAPV GLPSCWDAKE QVSWHLANQL TEDSSQLRPS
710 720 730 740 750
LISGLRHHVL CLHLLKVLYA CCYISERLCH ILGQEPLALE SLLMLVQGKV
760 770 780 790 800
KVADWEESTE VALYLLSLLV FRLQDLPSGM EKLGSEVATL FTHSHVVSLV
810 820 830 840 850
NAAACLLGQL GQQGVTFDLQ PREWIAAAAH ALSAPAEVRL TPPYSCGFYD
860 870 880 890 900
GLLILLLQLL MQVQGKPGLI RDVVGSEVWT ILWHRFSMAL RLPEEVSAQE
910 920 930 940 950
DDLLLSSPSS LEPDWTLISP QGMAALLSLA MAIFTQESQL CLSHLSQHGS
960 970 980 990 1000
VLMLTLKHLL SPSFLHHLSQ APQGPEFLPV VVLSVCKLLC FPFALDVDAD
1010 1020 1030 1040 1050
LLVGVLADLR ASEVVVCLLQ VCCHHLSLLQ AELPIGLLTR LALTDSASLK
1060 1070 1080 1090 1100
QFVNTVATSS RAIISFLSVV LLSDQPLMIS DLLSLLTHTA RILSPSHLSF
1110 1120 1130 1140 1150
IQELLSGSDE SYRPLRSLLG HSENTVRVRA YGLLGHLLQH SMALRGALQS
1160 1170 1180 1190 1200
QSGLLNLLLL GLGDKDPAVR RSASFAVGNA AYQAGPLGPA LAAAVPSMTQ
1210 1220 1230 1240 1250
LLGDAQDGIR RNAASALGNL GPEGLGKELL KCQVPQRLLE MACGDPQPTV
1260 1270 1280 1290 1300
KEAALIALRS LQQESCIHQV LVSLGASEKL ALLSLGNQLL PNSSNRPASV
1310
RHCRKLIQLL RPTHST
Note: No experimental confirmation available.1 Publication
Length:1,316
Mass (Da):144,180
Last modified:April 5, 2011 - v3
Checksum:i30ED81B0E9694270
GO
Isoform 21 Publication (identifier: Q69ZM6-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     225-260: SCFKNFLQGLLTKDPRQRLSWPDLLHHPFIAGRVTI → V
     862-864: QVQ → Q
     1021-1032: VCCHHLSLLQAE → V

Note: No experimental confirmation available.Curated
Show »
Length:1,268
Mass (Da):138,629
Checksum:i9CF4121DE0DB7FE4
GO
Isoform 31 Publication (identifier: Q69ZM6-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     461-588: Missing.

Note: No experimental confirmation available.Curated
Show »
Length:1,188
Mass (Da):129,980
Checksum:iBE70EF05C8AF9931
GO

Sequence cautioni

The sequence AAH43103 differs from that shown. Contaminating sequence. Sequence of unknown origin in the C-terminal part.Curated
The sequence BAD32420 differs from that shown. Reason: Frameshift at position 1174.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti330G → R in BAD32420 (PubMed:15368895).Curated1
Sequence conflicti471H → Y in BAD32420 (PubMed:15368895).Curated1
Sequence conflicti844Y → C in BAD32420 (PubMed:15368895).Curated1
Sequence conflicti874V → A in BAD32420 (PubMed:15368895).Curated1
Sequence conflicti881I → T in BAD32420 (PubMed:15368895).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_040760225 – 260SCFKN…GRVTI → V in isoform 2. 1 PublicationAdd BLAST36
Alternative sequenceiVSP_040761461 – 588Missing in isoform 3. 1 PublicationAdd BLAST128
Alternative sequenceiVSP_040762862 – 864QVQ → Q in isoform 2. 1 Publication3
Alternative sequenceiVSP_0407631021 – 1032VCCHH…LLQAE → V in isoform 2. 1 PublicationAdd BLAST12

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK173142 Transcribed RNA. Translation: BAD32420.1. Sequence problems.
AC117610 Genomic DNA. No translation available.
BC043103 mRNA. Translation: AAH43103.1. Sequence problems.
BC058698 mRNA. Translation: AAH58698.1.
CCDSiCCDS35619.1. [Q69ZM6-1]
RefSeqiNP_778196.2. NM_175031.3. [Q69ZM6-1]
UniGeneiMm.310974.

Genome annotation databases

EnsembliENSMUST00000087183; ENSMUSP00000084430; ENSMUSG00000033276. [Q69ZM6-1]
ENSMUST00000087186; ENSMUSP00000084433; ENSMUSG00000033276. [Q69ZM6-3]
GeneIDi269209.
KEGGimmu:269209.
UCSCiuc007bmu.1. mouse. [Q69ZM6-1]
uc011wnc.1. mouse. [Q69ZM6-3]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK173142 Transcribed RNA. Translation: BAD32420.1. Sequence problems.
AC117610 Genomic DNA. No translation available.
BC043103 mRNA. Translation: AAH43103.1. Sequence problems.
BC058698 mRNA. Translation: AAH58698.1.
CCDSiCCDS35619.1. [Q69ZM6-1]
RefSeqiNP_778196.2. NM_175031.3. [Q69ZM6-1]
UniGeneiMm.310974.

3D structure databases

ProteinModelPortaliQ69ZM6.
SMRiQ69ZM6.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

DIPiDIP-59751N.
STRINGi10090.ENSMUSP00000084430.

PTM databases

PhosphoSitePlusiQ69ZM6.

Proteomic databases

PaxDbiQ69ZM6.
PRIDEiQ69ZM6.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000087183; ENSMUSP00000084430; ENSMUSG00000033276. [Q69ZM6-1]
ENSMUST00000087186; ENSMUSP00000084433; ENSMUSG00000033276. [Q69ZM6-3]
GeneIDi269209.
KEGGimmu:269209.
UCSCiuc007bmu.1. mouse. [Q69ZM6-1]
uc011wnc.1. mouse. [Q69ZM6-3]

Organism-specific databases

CTDi27148.
MGIiMGI:1920831. Stk36.
RougeiSearch...

Phylogenomic databases

eggNOGiKOG0597. Eukaryota.
ENOG410XRQ6. LUCA.
GeneTreeiENSGT00860000133711.
HOGENOMiHOG000015284.
HOVERGENiHBG094005.
InParanoidiQ69ZM6.
KOiK06228.
OMAiMACGDPQ.
OrthoDBiEOG091G04G9.
PhylomeDBiQ69ZM6.
TreeFamiTF105340.

Miscellaneous databases

PROiQ69ZM6.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000033276.
ExpressionAtlasiQ69ZM6. baseline and differential.
GenevisibleiQ69ZM6. MM.

Family and domain databases

Gene3Di1.25.10.10. 1 hit.
InterProiIPR011989. ARM-like.
IPR016024. ARM-type_fold.
IPR011009. Kinase-like_dom.
IPR000719. Prot_kinase_dom.
IPR017441. Protein_kinase_ATP_BS.
IPR008271. Ser/Thr_kinase_AS.
[Graphical view]
PfamiPF00069. Pkinase. 1 hit.
[Graphical view]
SMARTiSM00220. S_TKc. 1 hit.
[Graphical view]
SUPFAMiSSF48371. SSF48371. 6 hits.
SSF56112. SSF56112. 1 hit.
PROSITEiPS00107. PROTEIN_KINASE_ATP. 1 hit.
PS50011. PROTEIN_KINASE_DOM. 1 hit.
PS00108. PROTEIN_KINASE_ST. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiSTK36_MOUSE
AccessioniPrimary (citable) accession number: Q69ZM6
Secondary accession number(s): Q6PDI0, Q80XQ6
Entry historyi
Integrated into UniProtKB/Swiss-Prot: March 21, 2006
Last sequence update: April 5, 2011
Last modified: November 30, 2016
This is version 110 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. Human and mouse protein kinases
    Human and mouse protein kinases: classification and index
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.