Q69ZM6 (STK36_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
December 14, 2011.
Version 69.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Serine/threonine-protein kinase 36 EC=2.7.11.1 Alternative name(s): Fused homolog | ||||
| Gene names |
| ||||
| Organism | Mus musculus (Mouse) | ||||
| Taxonomic identifier | 10090 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus |
Protein attributes
| Sequence length | 1316 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Serine/threonine protein kinase which plays an important role in the sonic hedgehog (Shh) pathway by regulating the activity of GLI transcription factors. Controls the activity of the transcriptional regulators GLI1, GLI2 and GLI3 by opposing the effect of SUFU and promoting their nuclear localization. GLI2 requires an additional function of STK36 to become transcriptionally active, but the enzyme does not need to possess an active kinase catalytic site for this to occur. Required for postnatal development, possibly by regulating the homeostasis of cerebral spinal fluid or ciliary function. Essential for construction of the central pair apparatus of motile cilia. Ref.1 Ref.6 Ref.7 |
| Catalytic activity | ATP + a protein = ADP + a phosphoprotein. UniProtKB P23647 |
| Cofactor | Magnesium. |
| Subunit structure | Interacts with SPAG16 and KIF27. Ref.7 |
| Subcellular location | Cytoplasm. Nucleus By similarity. Note: Low levels also present in the nucleus By similarity. Ref.7 |
| Tissue specificity | Weakly expressed in the heart and thymus, present at moderate to high levels in the lungs, pancreas, and kidneys and at higher levels in the brain and cerebellum. Very highly expressed in the testis. Ref.1 Ref.6 |
| Developmental stage | At E13.5 is widely distributed in the forebrain, midbrain, hindbrain, spinal cord, somites, developing limb buds and skin. Ref.5 |
| Disruption phenotype | Mice display profound growth retardation with a communicating form of hydrocephalus, nasal inflammation and early mortality. Ref.6 |
| Sequence similarities | Belongs to the protein kinase superfamily. Ser/Thr protein kinase family. Contains 1 protein kinase domain. |
| Sequence caution | The sequence AAH43103.1 differs from that shown. Reason: Contaminating sequence. Sequence of unknown origin in the C-terminal part. The sequence BAD32420.1 differs from that shown. Reason: Frameshift at position 1174. |
Ontologies
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 Ref.2 (identifier: Q69ZM6-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 2 Ref.4 (identifier: Q69ZM6-2) The sequence of this isoform differs from the canonical sequence as follows: 225-260: SCFKNFLQGLLTKDPRQRLSWPDLLHHPFIAGRVTI → V 862-864: QVQ → Q 1021-1032: VCCHHLSLLQAE → V | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 Ref.4 (identifier: Q69ZM6-3) The sequence of this isoform differs from the canonical sequence as follows: 461-588: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1316 | 1316 | Serine/threonine-protein kinase 36 | PRO_0000229021 | |||||
Regions | |||||||||
| Domain | 4 – 254 | 251 | Protein kinase | ||||||
| Nucleotide binding | 10 – 18 | 9 | ATP By similarity UniProtKB P23647 | ||||||
| Compositional bias | 826 – 831 | 6 | Poly-Ala | ||||||
| Compositional bias | 852 – 1162 | 311 | Leu-rich | ||||||
Sites | |||||||||
| Active site | 125 | 1 | Proton acceptor By similarity UniProtKB P23647 | ||||||
| Binding site | 33 | 1 | ATP By similarity UniProtKB P23647 | ||||||
Natural variations | |||||||||
| Alternative sequence | 225 – 260 | 36 | SCFKN…GRVTI → V in isoform 2. | VSP_040760 | |||||
| Alternative sequence | 461 – 588 | 128 | Missing in isoform 3. | VSP_040761 | |||||
| Alternative sequence | 862 – 864 | 3 | QVQ → Q in isoform 2. | VSP_040762 | |||||
| Alternative sequence | 1021 – 1032 | 12 | VCCHH…LLQAE → V in isoform 2. | VSP_040763 | |||||
Experimental info | |||||||||
| Sequence conflict | 330 | 1 | G → R in BAD32420. Ref.2 | ||||||
| Sequence conflict | 471 | 1 | H → Y in BAD32420. Ref.2 | ||||||
| Sequence conflict | 844 | 1 | Y → C in BAD32420. Ref.2 | ||||||
| Sequence conflict | 874 | 1 | V → A in BAD32420. Ref.2 | ||||||
| Sequence conflict | 881 | 1 | I → T in BAD32420. Ref.2 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "A possible role of mouse Fused (STK36) in Hedgehog signaling and Gli transcription factor regulation." Maloveryan A., Finta C., Osterlund T., Kogerman P. J. Cell Commun. Signal. 1:165-173(2007) [PubMed: 18600476] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, TISSUE SPECIFICITY. |
| [2] | "Prediction of the coding sequences of mouse homologues of KIAA gene: IV. The complete nucleotide sequences of 500 mouse KIAA-homologous cDNAs identified by screening of terminal sequences of cDNA clones randomly sampled from size-fractionated libraries." Okazaki N., Kikuno R., Ohara R., Inamoto S., Koseki H., Hiraoka S., Saga Y., Seino S., Nishimura M., Kaisho T., Hoshino K., Kitamura H., Nagase T., Ohara O., Koga H. DNA Res. 11:205-218(2004) [PubMed: 15368895] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Fetal brain. |
| [3] | "Lineage-specific biology revealed by a finished genome assembly of the mouse." Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S., She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W., Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T., Zhou S. Ponting C.P.PLoS Biol. 7:E1000112-E1000112(2009) [PubMed: 19468303] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. Strain: C57BL/6. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3). Strain: C57BL/6. Tissue: Brain. |
| [5] | "Gli regulation by the opposing activities of fused and suppressor of fused." Murone M., Luoh S.-L., Stone D., Li W., Gurney A., Armanini M., Grey C., Rosenthal A., de Sauvage F.J. Nat. Cell Biol. 2:310-312(2000) [PubMed: 10806483] [Abstract] Cited for: DEVELOPMENTAL STAGE. |
| [6] | "Loss of the serine/threonine kinase fused results in postnatal growth defects and lethality due to progressive hydrocephalus." Merchant M., Evangelista M., Luoh S.-M., Frantz G.D., Chalasani S., Carano R.A., van Hoy M., Ramirez J., Ogasawara A.K., McFarland L.M., Filvaroff E.H., French D.M., de Sauvage F.J. Mol. Cell. Biol. 25:7054-7068(2005) [PubMed: 16055717] [Abstract] Cited for: FUNCTION, TISSUE SPECIFICITY, DISRUPTION PHENOTYPE. |
| [7] | "Fused has evolved divergent roles in vertebrate Hedgehog signalling and motile ciliogenesis." Wilson C.W., Nguyen C.T., Chen M.H., Yang J.H., Gacayan R., Huang J., Chen J.N., Chuang P.T. Nature 459:98-102(2009) [PubMed: 19305393] [Abstract] Cited for: FUNCTION, SUBCELLULAR LOCATION, INTERACTION WITH SPAG16 AND KIF27. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AK173142 Transcribed RNA. Translation: BAD32420.1. Sequence problems. AC117610 Genomic DNA. No translation available. BC043103 mRNA. Translation: AAH43103.1. Sequence problems. BC058698 mRNA. Translation: AAH58698.1. |
| IPI | IPI00187463. IPI00461604. IPI00621144. |
| RefSeq | NP_778196.2. NM_175031.3. |
| UniGene | Mm.310974. |
3D structure databases | |
| ProteinModelPortal | Q69ZM6. |
| SMR | Q69ZM6. Positions 2-257, 1110-1309. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | Q69ZM6. |
Proteomic databases | |
| PRIDE | Q69ZM6. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENSMUST00000087183; ENSMUSP00000084430; ENSMUSG00000033276. ENSMUST00000087186; ENSMUSP00000084433; ENSMUSG00000033276. ENSMUST00000113699; ENSMUSP00000109329; ENSMUSG00000033276. |
| GeneID | 269209. |
| KEGG | mmu:269209. |
| UCSC | uc007bmu.1. mouse. uc007bmv.1. mouse. |
Organism-specific databases | |
| CTD | 27148. |
| MGI | MGI:1920831. Stk36. |
| Rouge | Search... |
Phylogenomic databases | |
| eggNOG | roNOG07048. |
| HOVERGEN | HBG094005. |
| OMA | WTLISPQ. |
| OrthoDB | EOG405S07. |
Gene expression databases | |
| ArrayExpress | Q69ZM6. |
| Bgee | Q69ZM6. |
| Genevestigator | Q69ZM6. |
| GermOnline | ENSMUSG00000033276. Mus musculus. |
Family and domain databases | |
| InterPro | IPR011989. ARM-like. IPR016024. ARM-type_fold. IPR011009. Kinase-like_dom. IPR000719. Prot_kinase_cat_dom. IPR017441. Protein_kinase_ATP_BS. IPR017442. Se/Thr_kinase-like_dom. IPR008271. Ser/Thr_kinase_AS. IPR002290. Ser/Thr_kinase_dom. [Graphical view] |
| Gene3D | G3DSA:1.25.10.10. ARM-like. 3 hits. |
| KO | K06228. |
| Pfam | PF00069. Pkinase. 1 hit. [Graphical view] |
| SMART | SM00220. S_TKc. 1 hit. [Graphical view] |
| SUPFAM | SSF48371. ARM-type_fold. 2 hits. SSF56112. Kinase_like. 1 hit. |
| PROSITE | PS00107. PROTEIN_KINASE_ATP. 1 hit. PS50011. PROTEIN_KINASE_DOM. 1 hit. PS00108. PROTEIN_KINASE_ST. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 392738. |
| SOURCE | Search... |
Entry information
| Entry name | STK36_MOUSE | ||||||||
| Accession | Primary (citable) accession number: Q69ZM6 Secondary accession number(s): Q6PDI0, Q80XQ6 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| Human and mouse protein kinases Human and mouse protein kinases: classification and index |
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with