Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

E3 ubiquitin-protein ligase SH3RF1

Gene

Sh3rf1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Acts as a scaffold protein, contributes to Rac-induced signal transduction such as JNKs (MAPK8 and MAPK9) activation and induces apoptosis. Within a signaling complex, it probably recruits protein kinases such as MAP3K10 or MAP3K11 which are in turn activated leading to the sequential activation of MAP2K4, MAP2K7 and JNKs (MAPK8 and MAPK9) (By similarity). In fibroblasts, induces apoptosis.By similarity1 Publication
Might act as an E3 ubiquitin-protein ligase, or as part of E3 complex, which accepts ubiquitin from specific E2 ubiquitin-conjugating enzymes such as UBE2D1 or UBE2N and then transfers it to substrates. In the absence of an external substrate, it can catalyze self-ubiquitination. Stimulates ubiquitination of potassium channel KCNJ1, enhancing it's dynamin-dependent and clathrin-independent endocytosis (By similarity).By similarity

Pathwayi: protein ubiquitination

This protein is involved in the pathway protein ubiquitination, which is part of Protein modification.
View all proteins of this organism that are known to be involved in the pathway protein ubiquitination and in Protein modification.

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri12 – 53RING-typePROSITE-ProRule annotationAdd BLAST42

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Ligase

Keywords - Biological processi

Ubl conjugation pathway

Keywords - Ligandi

Metal-binding, Zinc

Enzyme and pathway databases

UniPathwayiUPA00143.

Names & Taxonomyi

Protein namesi
Recommended name:
E3 ubiquitin-protein ligase SH3RF1 (EC:6.3.2.-)
Alternative name(s):
Plenty of SH3s
Short name:
Protein POSH
SH3 domain-containing RING finger protein 1
SH3 multiple domains protein 2
Gene namesi
Name:Sh3rf1
Synonyms:Kiaa1494, Posh, Sh3md2
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Unplaced

Organism-specific databases

MGIiMGI:1913066. Sh3rf1.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cell projection, Cytoplasm, Golgi apparatus

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi470E → Q: Loss of binding to AKT2. 1 Publication1
Mutagenesisi489W → A: Loss of binding to AKT2 and enhanced binding to MAP3K11. 1 Publication1

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003341521 – 892E3 ubiquitin-protein ligase SH3RF1Add BLAST892

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei304PhosphoserineCombined sources1
Modified residuei539PhosphoserineBy similarity1
Modified residuei741PhosphoserineCombined sources1

Post-translational modificationi

Phosphorylated at Ser-304 by AKT1 and AKT2. When phosphorylated, it has reduced ability to bind Rac (By similarity).By similarity
Subject to ubiquitination and proteasomal degradation.By similarity

Keywords - PTMi

Phosphoprotein, Ubl conjugation

Proteomic databases

PaxDbiQ69ZI1.
PRIDEiQ69ZI1.

PTM databases

iPTMnetiQ69ZI1.
PhosphoSitePlusiQ69ZI1.

Expressioni

Tissue specificityi

Ubiquitously expressed.1 Publication

Interactioni

Subunit structurei

Interacts with HERP1 (By similarity). Interacts with Rac; in a GTP-dependent manner. Interacts with MAP3K10 and MAP3K11. Interacts with MAPK8IP; this interaction leads to the PJAC complex (POSH-JIP or SH3RF1/MAPK8IP apoptotic complex) with a 1:1 ratio. Interacts with SIAH1. Probably part of a signaling complex that may contain SH3RF1, MAPK8IP, DLK1, MAP2K4, MAP2K7, MAPK8, MAPK9, AKT1 and AKT2.By similarity5 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
Bnip3lQ9Z2F74EBI-957380,EBI-1774669
SIAH1Q8IUQ45EBI-957380,EBI-747107From a different organism.

Protein-protein interaction databases

BioGridi208480. 1 interactor.
IntActiQ69ZI1. 5 interactors.
STRINGi10090.ENSMUSP00000034060.

Structurei

3D structure databases

ProteinModelPortaliQ69ZI1.
SMRiQ69ZI1.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini134 – 193SH3 1PROSITE-ProRule annotationAdd BLAST60
Domaini196 – 259SH3 2PROSITE-ProRule annotationAdd BLAST64
Domaini452 – 513SH3 3PROSITE-ProRule annotationAdd BLAST62
Domaini833 – 892SH3 4PROSITE-ProRule annotationAdd BLAST60

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni447 – 550Interaction with AKT21 PublicationAdd BLAST104

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi84 – 90Poly-Gly7
Compositional biasi397 – 403Poly-Pro7
Compositional biasi406 – 431Ala-richAdd BLAST26

Domaini

The RING finger domain is responsible of ubiquitination and proteasomal degradation.

Sequence similaritiesi

Belongs to the SH3RF family.Curated
Contains 1 RING-type zinc finger.PROSITE-ProRule annotation
Contains 4 SH3 domains.PROSITE-ProRule annotation

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri12 – 53RING-typePROSITE-ProRule annotationAdd BLAST42

Keywords - Domaini

Repeat, SH3 domain, Zinc-finger

Phylogenomic databases

eggNOGiENOG410ITG6. Eukaryota.
ENOG410XS5R. LUCA.
HOGENOMiHOG000045564.
HOVERGENiHBG069552.
InParanoidiQ69ZI1.
KOiK12171.
PhylomeDBiQ69ZI1.

Family and domain databases

Gene3Di3.30.40.10. 1 hit.
InterProiIPR028502. POSH1.
IPR001452. SH3_domain.
IPR018957. Znf_C3HC4_RING-type.
IPR001841. Znf_RING.
IPR013083. Znf_RING/FYVE/PHD.
IPR017907. Znf_RING_CS.
[Graphical view]
PANTHERiPTHR10663:SF153. PTHR10663:SF153. 5 hits.
PfamiPF00018. SH3_1. 1 hit.
PF14604. SH3_9. 3 hits.
PF00097. zf-C3HC4. 1 hit.
[Graphical view]
PRINTSiPR00452. SH3DOMAIN.
SMARTiSM00184. RING. 1 hit.
SM00326. SH3. 4 hits.
[Graphical view]
SUPFAMiSSF50044. SSF50044. 4 hits.
PROSITEiPS50002. SH3. 4 hits.
PS00518. ZF_RING_1. 1 hit.
PS50089. ZF_RING_2. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q69ZI1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MDESALLDLL ECPVCLERLD ASAKVLPCQH TFCKRCLLGI VGSRNELRCP
60 70 80 90 100
ECRTLVGSGV DELPSNILLV RLLDGIKQRP WKPGPGGGGG TTCTNTLRAQ
110 120 130 140 150
GSTVVNCGSK DLQSSQCGQQ PRVQAWSPPV RGIPQLPCAK ALYNYEGKEP
160 170 180 190 200
GDLKFSKGDI IILRRQVDEN WYHGEVSGVH GFFPTNFVQI IKPLPQPPPQ
210 220 230 240 250
CKALYDFEVK DKEADKDCLP FAKDDVLTVI RRVDENWAEG MLADKIGIFP
260 270 280 290 300
ISYVEFNSAA KQLIEWDKPP VPGVDTAECP SATAQSTSAS KHPDTKKNTR
310 320 330 340 350
KRHSFTSLTM ANKSSQGSQN RHSMEISPPV LISSSNPTAA ARISELSGLS
360 370 380 390 400
CSAPSQVHIS TTGLIVTPPP SSPVTTGPAF TFPSDVPYQA ALGSMNPPLP
410 420 430 440 450
PPPLLAATVL ASTPSGATAA VAAAAAAAAA AGMGPRPVMG SSEQIAHLRP
460 470 480 490 500
QTRPSVYVAI YPYTPRKEDE LELRKGEMFL VFERCQDGWY KGTSMHTSKI
510 520 530 540 550
GVFPGNYVAP VTRAVTNASQ AKVSMSTAGQ ASRGVTMVSP STAGGPTQKP
560 570 580 590 600
QGNGVAGNPS VVPTAVVSAA HIQTSPQAKV LLHMSGQMTV NQARNAVRTV
610 620 630 640 650
AAHSQERPTA AVTPIQVQNA ACLGPASVGL PHHSLASQPL PPMAGPAAHG
660 670 680 690 700
AAVSISRTNA PMACAAGASL ASPNMTSAML ETEPSGRTVT ILPGLPTSPE
710 720 730 740 750
SAASACGNSS AGKPDKDSKK EKKGLLKLLS GASTKRKPRV SPPASPTLDV
760 770 780 790 800
ELGAGEAPLQ GAVGPELPLG GSHGRVGSCP TDGDGPVAAG TAALAQDAFH
810 820 830 840 850
RKTSSLDSAV PIAPPPRQAC SSLGPVMNEA RPVVCERHRV VVSYPPQSEA
860 870 880 890
ELELKEGDIV FVHKKREDGW FKGTLQRNGK TGLFPGSFVE NI
Length:892
Mass (Da):93,447
Last modified:May 20, 2008 - v2
Checksum:iD92071116F4D6EBE
GO
Isoform 2 (identifier: Q69ZI1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     160-189: Missing.

Note: No experimental confirmation available.
Show »
Length:862
Mass (Da):89,906
Checksum:iD2B2F85D18812B47
GO
Isoform 3 (identifier: Q69ZI1-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     788-828: AAGTAALAQD...ACSSLGPVMN → DRWNSSPSPG...GLLLPGPSHE
     829-892: Missing.

Note: No experimental confirmation available.
Show »
Length:828
Mass (Da):86,342
Checksum:iC670E8A5CF0EB1D4
GO
Isoform 4 (identifier: Q69ZI1-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     345-381: ELSGLSCSAPSQVHISTTGLIVTPPPSSPVTTGPAFT → APSQVQGRGQLPKRGLLTSGKILAASFIFALVTSSLL
     382-892: Missing.

Note: No experimental confirmation available.
Show »
Length:381
Mass (Da):41,433
Checksum:i991E47F760D876CB
GO

Sequence cautioni

The sequence BAD32463 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti160I → T in AAC40070 (PubMed:9482736).Curated1
Sequence conflicti321R → S in BAE28367 (PubMed:16141072).Curated1
Sequence conflicti342R → G in BAE28367 (PubMed:16141072).Curated1
Sequence conflicti431Missing in BAC32385 (PubMed:16141072).Curated1
Sequence conflicti431Missing in AAH60113 (PubMed:15489334).Curated1
Sequence conflicti431Missing in AAH60696 (PubMed:15489334).Curated1
Sequence conflicti630L → M in BAE28367 (PubMed:16141072).Curated1
Sequence conflicti679M → V in BAC32385 (PubMed:16141072).Curated1
Sequence conflicti679M → V in AAH60113 (PubMed:15489334).Curated1
Sequence conflicti679M → V in AAH60696 (PubMed:15489334).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_033624160 – 189Missing in isoform 2. 1 PublicationAdd BLAST30
Alternative sequenceiVSP_033625345 – 381ELSGL…GPAFT → APSQVQGRGQLPKRGLLTSG KILAASFIFALVTSSLL in isoform 4. 1 PublicationAdd BLAST37
Alternative sequenceiVSP_033626382 – 892Missing in isoform 4. 1 PublicationAdd BLAST511
Alternative sequenceiVSP_033627788 – 828AAGTA…GPVMN → DRWNSSPSPGCLPPQDKLPG LRSAHCSTTSPGLLLPGPSH E in isoform 3. 1 PublicationAdd BLAST41
Alternative sequenceiVSP_033628829 – 892Missing in isoform 3. 1 PublicationAdd BLAST64

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF030131 mRNA. Translation: AAC40070.1.
AK173185 mRNA. Translation: BAD32463.1. Different initiation.
BC060113 mRNA. Translation: AAH60113.1.
BC060696 mRNA. Translation: AAH60696.1.
AK088003 mRNA. Translation: BAC40088.1.
AK045470 mRNA. Translation: BAC32385.1.
AK148137 mRNA. Translation: BAE28367.1.
PIRiT09071.
RefSeqiNP_067481.2. NM_021506.2.
UniGeneiMm.27949.

Genome annotation databases

GeneIDi59009.
KEGGimmu:59009.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF030131 mRNA. Translation: AAC40070.1.
AK173185 mRNA. Translation: BAD32463.1. Different initiation.
BC060113 mRNA. Translation: AAH60113.1.
BC060696 mRNA. Translation: AAH60696.1.
AK088003 mRNA. Translation: BAC40088.1.
AK045470 mRNA. Translation: BAC32385.1.
AK148137 mRNA. Translation: BAE28367.1.
PIRiT09071.
RefSeqiNP_067481.2. NM_021506.2.
UniGeneiMm.27949.

3D structure databases

ProteinModelPortaliQ69ZI1.
SMRiQ69ZI1.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi208480. 1 interactor.
IntActiQ69ZI1. 5 interactors.
STRINGi10090.ENSMUSP00000034060.

PTM databases

iPTMnetiQ69ZI1.
PhosphoSitePlusiQ69ZI1.

Proteomic databases

PaxDbiQ69ZI1.
PRIDEiQ69ZI1.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

GeneIDi59009.
KEGGimmu:59009.

Organism-specific databases

CTDi57630.
MGIiMGI:1913066. Sh3rf1.
RougeiSearch...

Phylogenomic databases

eggNOGiENOG410ITG6. Eukaryota.
ENOG410XS5R. LUCA.
HOGENOMiHOG000045564.
HOVERGENiHBG069552.
InParanoidiQ69ZI1.
KOiK12171.
PhylomeDBiQ69ZI1.

Enzyme and pathway databases

UniPathwayiUPA00143.

Miscellaneous databases

ChiTaRSiSh3rf1. mouse.
PROiQ69ZI1.
SOURCEiSearch...

Family and domain databases

Gene3Di3.30.40.10. 1 hit.
InterProiIPR028502. POSH1.
IPR001452. SH3_domain.
IPR018957. Znf_C3HC4_RING-type.
IPR001841. Znf_RING.
IPR013083. Znf_RING/FYVE/PHD.
IPR017907. Znf_RING_CS.
[Graphical view]
PANTHERiPTHR10663:SF153. PTHR10663:SF153. 5 hits.
PfamiPF00018. SH3_1. 1 hit.
PF14604. SH3_9. 3 hits.
PF00097. zf-C3HC4. 1 hit.
[Graphical view]
PRINTSiPR00452. SH3DOMAIN.
SMARTiSM00184. RING. 1 hit.
SM00326. SH3. 4 hits.
[Graphical view]
SUPFAMiSSF50044. SSF50044. 4 hits.
PROSITEiPS50002. SH3. 4 hits.
PS00518. ZF_RING_1. 1 hit.
PS50089. ZF_RING_2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiSH3R1_MOUSE
AccessioniPrimary (citable) accession number: Q69ZI1
Secondary accession number(s): O70254
, Q3UG42, Q6P9M8, Q8BR66, Q8C2T5
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 20, 2008
Last sequence update: May 20, 2008
Last modified: November 2, 2016
This is version 97 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.