Q69ZI1 (SH3R1_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 71.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: E3 ubiquitin-protein ligase SH3RF1 EC=6.3.2.- Alternative name(s): Plenty of SH3s Short name=Protein POSH SH3 domain-containing RING finger protein 1 SH3 multiple domains protein 2 | ||||
| Gene names |
| ||||
| Organism | Mus musculus (Mouse) [Reference proteome] | ||||
| Taxonomic identifier | 10090 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus![]() |
Protein attributes
| Sequence length | 892 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Acts as a scaffold protein, contributes to Rac-induced signal transduction such as JNKs (MAPK8 and MAPK9) activation and induces apoptosis. Within a signaling complex, it probably recruits protein kinases such as MAP3K10 or MAP3K11 which are in turn activated leading to the sequential activation of MAP2K4, MAP2K7 and JNKs (MAPK8 and MAPK9) By similarity. In fibroblasts, induces apoptosis. Ref.1 Might act as an E3 ubiquitin-protein ligase, or as part of E3 complex, which accepts ubiquitin from specific E2 ubiquitin-conjugating enzymes such as UBE2D1 or UBE2N and then transfers it to substrates. In the absence of an external substrate, it can catalyze self-ubiquitination. Stimulates ubiquitination of potassium channel KCNJ1, enhancing it's dynamin-dependent and clathrin-independent endocytosis By similarity. Ref.1 |
| Pathway | |
| Subunit structure | Interacts with HERP1 By similarity. Interacts with Rac; in a GTP-dependent manner. Interacts with MAP3K10 and MAP3K11. Interacts with MAPK8IP; this interaction leads to the PJAC complex (POSH-JIP or SH3RF1/MAPK8IP apoptotic complex) with a 1:1 ratio. Interacts with SIAH1. Probably part of a signaling complex that may contain SH3RF1, MAPK8IP, DLK1, MAP2K4, MAP2K7, MAPK8, MAPK9, AKT1 and AKT2. Ref.1 Ref.5 Ref.6 Ref.7 Ref.8 |
| Subcellular location | Cytoplasm › perinuclear region By similarity. Cell projection › lamellipodium. Golgi apparatus › trans-Golgi network. Note: Co-localizes, with AKT2, in lamellipodia By similarity. Co-localizes, with HERP1, in trans-Golgi network By similarity. Ref.6 |
| Tissue specificity | Ubiquitously expressed. Ref.1 |
| Domain | The RING finger domain is responsible of ubiquitination and proteasomal degradation. |
| Post-translational modification | Phosphorylated at Ser-304 by AKT1 and AKT2. When phosphorylated, it has reduced ability to bind Rac By similarity. Subject to ubiquitination and proteasomal degradation By similarity. |
| Sequence similarities | Belongs to the SH3RF family. Contains 1 RING-type zinc finger. Contains 4 SH3 domains. |
| Sequence caution | The sequence BAD32463.1 differs from that shown. Reason: Erroneous initiation. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| Bnip3l | Q9Z2F7 | 4 | EBI-957380,EBI-1774669 | |
| SIAH1 | Q8IUQ4 | 5 | EBI-957380,EBI-747107 | From a different organism. |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q69ZI1-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q69ZI1-2) The sequence of this isoform differs from the canonical sequence as follows: 160-189: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: Q69ZI1-3) The sequence of this isoform differs from the canonical sequence as follows: 788-828: AAGTAALAQD...ACSSLGPVMN → DRWNSSPSPG...GLLLPGPSHE 829-892: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 4 (identifier: Q69ZI1-4) The sequence of this isoform differs from the canonical sequence as follows: 345-381: ELSGLSCSAPSQVHISTTGLIVTPPPSSPVTTGPAFT → APSQVQGRGQLPKRGLLTSGKILAASFIFALVTSSLL 382-892: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 892 | 892 | E3 ubiquitin-protein ligase SH3RF1 | PRO_0000334152 | |||||
Regions | |||||||||
| Domain | 134 – 193 | 60 | SH3 1 | ||||||
| Domain | 196 – 259 | 64 | SH3 2 | ||||||
| Domain | 452 – 513 | 62 | SH3 3 | ||||||
| Domain | 833 – 892 | 60 | SH3 4 | ||||||
| Zinc finger | 12 – 53 | 42 | RING-type | ||||||
| Region | 447 – 550 | 104 | Interaction with AKT2 | ||||||
| Compositional bias | 84 – 90 | 7 | Poly-Gly | ||||||
| Compositional bias | 397 – 403 | 7 | Poly-Pro | ||||||
| Compositional bias | 406 – 431 | 26 | Ala-rich | ||||||
Amino acid modifications | |||||||||
| Modified residue | 304 | 1 | Phosphoserine By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 160 – 189 | 30 | Missing in isoform 2. | VSP_033624 | |||||
| Alternative sequence | 345 – 381 | 37 | ELSGL…GPAFT → APSQVQGRGQLPKRGLLTSG KILAASFIFALVTSSLL in isoform 4. | VSP_033625 | |||||
| Alternative sequence | 382 – 892 | 511 | Missing in isoform 4. | VSP_033626 | |||||
| Alternative sequence | 788 – 828 | 41 | AAGTA…GPVMN → DRWNSSPSPGCLPPQDKLPG LRSAHCSTTSPGLLLPGPSH E in isoform 3. | VSP_033627 | |||||
| Alternative sequence | 829 – 892 | 64 | Missing in isoform 3. | VSP_033628 | |||||
Experimental info | |||||||||
| Mutagenesis | 470 | 1 | E → Q: Loss of binding to AKT2. Ref.6 | ||||||
| Mutagenesis | 489 | 1 | W → A: Loss of binding to AKT2 and enhanced binding to MAP3K11. Ref.6 | ||||||
| Sequence conflict | 160 | 1 | I → T in AAC40070. Ref.1 | ||||||
| Sequence conflict | 321 | 1 | R → S in BAE28367. Ref.3 | ||||||
| Sequence conflict | 342 | 1 | R → G in BAE28367. Ref.3 | ||||||
| Sequence conflict | 431 | 1 | Missing in BAC32385. Ref.3 | ||||||
| Sequence conflict | 431 | 1 | Missing in AAH60113. Ref.4 | ||||||
| Sequence conflict | 431 | 1 | Missing in AAH60696. Ref.4 | ||||||
| Sequence conflict | 630 | 1 | L → M in BAE28367. Ref.3 | ||||||
| Sequence conflict | 679 | 1 | M → V in BAC32385. Ref.3 | ||||||
| Sequence conflict | 679 | 1 | M → V in AAH60113. Ref.4 | ||||||
| Sequence conflict | 679 | 1 | M → V in AAH60696. Ref.4 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "A new rac target POSH is an SH3-containing scaffold protein involved in the JNK and NF-kappaB signalling pathways." Tapon N., Nagata K., Lamarche N., Hall A. EMBO J. 17:1395-1404(1998) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, TISSUE SPECIFICITY, INTERACTION WITH RAC. |
| [2] | "Prediction of the coding sequences of mouse homologues of KIAA gene: IV. The complete nucleotide sequences of 500 mouse KIAA-homologous cDNAs identified by screening of terminal sequences of cDNA clones randomly sampled from size-fractionated libraries." Okazaki N., Kikuno R., Ohara R., Inamoto S., Koseki H., Hiraoka S., Saga Y., Seino S., Nishimura M., Kaisho T., Hoshino K., Kitamura H., Nagase T., Ohara O., Koga H. DNA Res. 11:205-218(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Embryonic tail. |
| [3] | "The transcriptional landscape of the mammalian genome." Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. Hayashizaki Y.Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3 AND 4), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 200-892 (ISOFORM 1). Strain: C57BL/6J and NOD. Tissue: Corpora quadrigemina and Thymus. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Strain: C57BL/6. Tissue: Brain. |
| [5] | "POSH acts as a scaffold for a multiprotein complex that mediates JNK activation in apoptosis." Xu Z., Kukekov N.V., Greene L.A. EMBO J. 22:252-261(2003) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH MAP3K10; MAP3K11; DLK1; MAP2K4; MAP2K7; MAPK8 AND MAPK9. |
| [6] | "Akt2 negatively regulates assembly of the POSH-MLK-JNK signaling complex." Figueroa C., Tarras S., Taylor J., Vojtek A.B. J. Biol. Chem. 278:47922-47927(2003) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH AKT2, MUTAGENESIS OF GLU-470 AND TRP-489, SUBCELLULAR LOCATION. |
| [7] | "Siah1 interacts with the scaffold protein POSH to promote JNK activation and apoptosis." Xu Z., Sproul A., Wang W., Kukekov N., Greene L.A. J. Biol. Chem. 281:303-312(2006) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH SIAH1. |
| [8] | "Direct interaction of the molecular scaffolds POSH and JIP is required for apoptotic activation of JNKs." Kukekov N.V., Xu Z., Greene L.A. J. Biol. Chem. 281:15517-15524(2006) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH MAPK8IP. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF030131 mRNA. Translation: AAC40070.1. AK173185 mRNA. Translation: BAD32463.1. Different initiation. BC060113 mRNA. Translation: AAH60113.1. BC060696 mRNA. Translation: AAH60696.1. AK088003 mRNA. Translation: BAC40088.1. AK045470 mRNA. Translation: BAC32385.1. AK148137 mRNA. Translation: BAE28367.1. |
| IPI | IPI00399469. IPI00458726. IPI00894976. IPI00895133. |
| PIR | T09071. |
| RefSeq | NP_067481.2. NM_021506.2. |
| UniGene | Mm.27949. |
3D structure databases | |
| HSSP | HSSP built from PDB template 1WI7 based on UniProtKB Q8R551. |
| ProteinModelPortal | Q69ZI1. |
| SMR | Q69ZI1. Positions 5-78, 137-255, 457-512, 839-892. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q69ZI1. 5 interactions. |
PTM databases | |
| PhosphoSite | Q69ZI1. |
Proteomic databases | |
| PaxDb | Q69ZI1. |
| PRIDE | Q69ZI1. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| GeneID | 59009. |
| KEGG | mmu:59009. |
| UCSC | uc009ltw.1. mouse. |
Organism-specific databases | |
| CTD | 57630. |
| MGI | MGI:1913066. Sh3rf1. |
| Rouge | Search... |
Phylogenomic databases | |
| eggNOG | NOG314495. |
| HOGENOM | HOG000045564. |
| HOVERGEN | HBG069552. |
| InParanoid | Q69ZI1. |
| KO | K12171. |
| OrthoDB | EOG4PG61S. |
Enzyme and pathway databases | |
| UniPathway | UPA00143. |
Gene expression databases | |
| Genevestigator | Q69ZI1. |
Family and domain databases | |
| Gene3D | 3.30.40.10. 1 hit. |
| InterPro | IPR000108. p67phox. IPR001452. SH3_domain. IPR001841. Znf_RING. IPR013083. Znf_RING/FYVE/PHD. IPR017907. Znf_RING_CS. [Graphical view] |
| Pfam | PF00018. SH3_1. 4 hits. [Graphical view] |
| PRINTS | PR00499. P67PHOX. PR00452. SH3DOMAIN. |
| SMART | SM00184. RING. 1 hit. SM00326. SH3. 4 hits. [Graphical view] |
| SUPFAM | SSF50044. SH3. 4 hits. |
| PROSITE | PS50002. SH3. 4 hits. PS00518. ZF_RING_1. 1 hit. PS50089. ZF_RING_2. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 314548. |
| SOURCE | Search... |
Entry information
| Entry name | SH3R1_MOUSE | ||||||||
| Accession | Primary (citable) accession number: Q69ZI1 Secondary accession number(s): O70254 Q8C2T5 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| PATHWAY comments Index of metabolic and biosynthesis pathways |
| SIMILARITY comments Index of protein domains and families |

Clusters with
