Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q69ZI1

- SH3R1_MOUSE

UniProt

Q69ZI1 - SH3R1_MOUSE

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

E3 ubiquitin-protein ligase SH3RF1

Gene

Sh3rf1

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Acts as a scaffold protein, contributes to Rac-induced signal transduction such as JNKs (MAPK8 and MAPK9) activation and induces apoptosis. Within a signaling complex, it probably recruits protein kinases such as MAP3K10 or MAP3K11 which are in turn activated leading to the sequential activation of MAP2K4, MAP2K7 and JNKs (MAPK8 and MAPK9) (By similarity). In fibroblasts, induces apoptosis.By similarity1 Publication
Might act as an E3 ubiquitin-protein ligase, or as part of E3 complex, which accepts ubiquitin from specific E2 ubiquitin-conjugating enzymes such as UBE2D1 or UBE2N and then transfers it to substrates. In the absence of an external substrate, it can catalyze self-ubiquitination. Stimulates ubiquitination of potassium channel KCNJ1, enhancing it's dynamin-dependent and clathrin-independent endocytosis (By similarity).By similarity

Pathwayi

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri12 – 5342RING-typePROSITE-ProRule annotationAdd
BLAST

GO - Molecular functioni

  1. ligase activity Source: UniProtKB-KW
  2. zinc ion binding Source: InterPro

GO - Biological processi

  1. apoptotic process Source: InterPro
  2. protein ubiquitination Source: UniProtKB-UniPathway
  3. regulation of JNK cascade Source: InterPro
Complete GO annotation...

Keywords - Molecular functioni

Ligase

Keywords - Biological processi

Ubl conjugation pathway

Keywords - Ligandi

Metal-binding, Zinc

Enzyme and pathway databases

UniPathwayiUPA00143.

Names & Taxonomyi

Protein namesi
Recommended name:
E3 ubiquitin-protein ligase SH3RF1 (EC:6.3.2.-)
Alternative name(s):
Plenty of SH3s
Short name:
Protein POSH
SH3 domain-containing RING finger protein 1
SH3 multiple domains protein 2
Gene namesi
Name:Sh3rf1
Synonyms:Kiaa1494, Posh, Sh3md2
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589: Unplaced

Organism-specific databases

MGIiMGI:1913066. Sh3rf1.

Subcellular locationi

Cytoplasmperinuclear region By similarity. Cell projectionlamellipodium 1 Publication. Golgi apparatustrans-Golgi network 1 Publication
Note: Colocalizes, with AKT2, in lamellipodia. Colocalizes, with HERP1, in trans-Golgi network.By similarity

GO - Cellular componenti

  1. cell projection Source: UniProtKB-KW
  2. Golgi apparatus Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Cell projection, Cytoplasm, Golgi apparatus

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi470 – 4701E → Q: Loss of binding to AKT2. 1 Publication
Mutagenesisi489 – 4891W → A: Loss of binding to AKT2 and enhanced binding to MAP3K11. 1 Publication

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 892892E3 ubiquitin-protein ligase SH3RF1PRO_0000334152Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei304 – 3041PhosphoserineBy similarity

Post-translational modificationi

Phosphorylated at Ser-304 by AKT1 and AKT2. When phosphorylated, it has reduced ability to bind Rac (By similarity).By similarity
Subject to ubiquitination and proteasomal degradation.By similarity

Keywords - PTMi

Phosphoprotein, Ubl conjugation

Proteomic databases

MaxQBiQ69ZI1.
PaxDbiQ69ZI1.
PRIDEiQ69ZI1.

PTM databases

PhosphoSiteiQ69ZI1.

Expressioni

Tissue specificityi

Ubiquitously expressed.1 Publication

Gene expression databases

GenevestigatoriQ69ZI1.

Interactioni

Subunit structurei

Interacts with HERP1 (By similarity). Interacts with Rac; in a GTP-dependent manner. Interacts with MAP3K10 and MAP3K11. Interacts with MAPK8IP; this interaction leads to the PJAC complex (POSH-JIP or SH3RF1/MAPK8IP apoptotic complex) with a 1:1 ratio. Interacts with SIAH1. Probably part of a signaling complex that may contain SH3RF1, MAPK8IP, DLK1, MAP2K4, MAP2K7, MAPK8, MAPK9, AKT1 and AKT2.By similarity5 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
Bnip3lQ9Z2F74EBI-957380,EBI-1774669
SIAH1Q8IUQ45EBI-957380,EBI-747107From a different organism.

Protein-protein interaction databases

BioGridi208480. 1 interaction.
IntActiQ69ZI1. 5 interactions.

Structurei

3D structure databases

ProteinModelPortaliQ69ZI1.
SMRiQ69ZI1. Positions 137-255, 457-512, 839-892.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini134 – 19360SH3 1PROSITE-ProRule annotationAdd
BLAST
Domaini196 – 25964SH3 2PROSITE-ProRule annotationAdd
BLAST
Domaini452 – 51362SH3 3PROSITE-ProRule annotationAdd
BLAST
Domaini833 – 89260SH3 4PROSITE-ProRule annotationAdd
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni447 – 550104Interaction with AKT2Add
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi84 – 907Poly-Gly
Compositional biasi397 – 4037Poly-Pro
Compositional biasi406 – 43126Ala-richAdd
BLAST

Domaini

The RING finger domain is responsible of ubiquitination and proteasomal degradation.

Sequence similaritiesi

Belongs to the SH3RF family.Curated
Contains 1 RING-type zinc finger.PROSITE-ProRule annotation
Contains 4 SH3 domains.PROSITE-ProRule annotation

Zinc finger

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri12 – 5342RING-typePROSITE-ProRule annotationAdd
BLAST

Keywords - Domaini

Repeat, SH3 domain, Zinc-finger

Phylogenomic databases

eggNOGiNOG314495.
HOGENOMiHOG000045564.
HOVERGENiHBG069552.
InParanoidiQ69ZI1.
KOiK12171.
PhylomeDBiQ69ZI1.

Family and domain databases

Gene3Di3.30.40.10. 1 hit.
InterProiIPR028502. POSH1.
IPR001452. SH3_domain.
IPR018957. Znf_C3HC4_RING-type.
IPR001841. Znf_RING.
IPR013083. Znf_RING/FYVE/PHD.
IPR017907. Znf_RING_CS.
[Graphical view]
PANTHERiPTHR10661:SF8. PTHR10661:SF8. 1 hit.
PfamiPF14604. SH3_9. 4 hits.
PF00097. zf-C3HC4. 1 hit.
[Graphical view]
PRINTSiPR00452. SH3DOMAIN.
SMARTiSM00184. RING. 1 hit.
SM00326. SH3. 4 hits.
[Graphical view]
SUPFAMiSSF50044. SSF50044. 4 hits.
PROSITEiPS50002. SH3. 4 hits.
PS00518. ZF_RING_1. 1 hit.
PS50089. ZF_RING_2. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q69ZI1-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MDESALLDLL ECPVCLERLD ASAKVLPCQH TFCKRCLLGI VGSRNELRCP
60 70 80 90 100
ECRTLVGSGV DELPSNILLV RLLDGIKQRP WKPGPGGGGG TTCTNTLRAQ
110 120 130 140 150
GSTVVNCGSK DLQSSQCGQQ PRVQAWSPPV RGIPQLPCAK ALYNYEGKEP
160 170 180 190 200
GDLKFSKGDI IILRRQVDEN WYHGEVSGVH GFFPTNFVQI IKPLPQPPPQ
210 220 230 240 250
CKALYDFEVK DKEADKDCLP FAKDDVLTVI RRVDENWAEG MLADKIGIFP
260 270 280 290 300
ISYVEFNSAA KQLIEWDKPP VPGVDTAECP SATAQSTSAS KHPDTKKNTR
310 320 330 340 350
KRHSFTSLTM ANKSSQGSQN RHSMEISPPV LISSSNPTAA ARISELSGLS
360 370 380 390 400
CSAPSQVHIS TTGLIVTPPP SSPVTTGPAF TFPSDVPYQA ALGSMNPPLP
410 420 430 440 450
PPPLLAATVL ASTPSGATAA VAAAAAAAAA AGMGPRPVMG SSEQIAHLRP
460 470 480 490 500
QTRPSVYVAI YPYTPRKEDE LELRKGEMFL VFERCQDGWY KGTSMHTSKI
510 520 530 540 550
GVFPGNYVAP VTRAVTNASQ AKVSMSTAGQ ASRGVTMVSP STAGGPTQKP
560 570 580 590 600
QGNGVAGNPS VVPTAVVSAA HIQTSPQAKV LLHMSGQMTV NQARNAVRTV
610 620 630 640 650
AAHSQERPTA AVTPIQVQNA ACLGPASVGL PHHSLASQPL PPMAGPAAHG
660 670 680 690 700
AAVSISRTNA PMACAAGASL ASPNMTSAML ETEPSGRTVT ILPGLPTSPE
710 720 730 740 750
SAASACGNSS AGKPDKDSKK EKKGLLKLLS GASTKRKPRV SPPASPTLDV
760 770 780 790 800
ELGAGEAPLQ GAVGPELPLG GSHGRVGSCP TDGDGPVAAG TAALAQDAFH
810 820 830 840 850
RKTSSLDSAV PIAPPPRQAC SSLGPVMNEA RPVVCERHRV VVSYPPQSEA
860 870 880 890
ELELKEGDIV FVHKKREDGW FKGTLQRNGK TGLFPGSFVE NI
Length:892
Mass (Da):93,447
Last modified:May 20, 2008 - v2
Checksum:iD92071116F4D6EBE
GO
Isoform 2 (identifier: Q69ZI1-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     160-189: Missing.

Note: No experimental confirmation available.

Show »
Length:862
Mass (Da):89,906
Checksum:iD2B2F85D18812B47
GO
Isoform 3 (identifier: Q69ZI1-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     788-828: AAGTAALAQD...ACSSLGPVMN → DRWNSSPSPG...GLLLPGPSHE
     829-892: Missing.

Note: No experimental confirmation available.

Show »
Length:828
Mass (Da):86,342
Checksum:iC670E8A5CF0EB1D4
GO
Isoform 4 (identifier: Q69ZI1-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     345-381: ELSGLSCSAPSQVHISTTGLIVTPPPSSPVTTGPAFT → APSQVQGRGQLPKRGLLTSGKILAASFIFALVTSSLL
     382-892: Missing.

Note: No experimental confirmation available.

Show »
Length:381
Mass (Da):41,433
Checksum:i991E47F760D876CB
GO

Sequence cautioni

The sequence BAD32463.1 differs from that shown. Reason: Erroneous initiation. Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti160 – 1601I → T in AAC40070. (PubMed:9482736)Curated
Sequence conflicti321 – 3211R → S in BAE28367. (PubMed:16141072)Curated
Sequence conflicti342 – 3421R → G in BAE28367. (PubMed:16141072)Curated
Sequence conflicti431 – 4311Missing in BAC32385. (PubMed:16141072)Curated
Sequence conflicti431 – 4311Missing in AAH60113. (PubMed:15489334)Curated
Sequence conflicti431 – 4311Missing in AAH60696. (PubMed:15489334)Curated
Sequence conflicti630 – 6301L → M in BAE28367. (PubMed:16141072)Curated
Sequence conflicti679 – 6791M → V in BAC32385. (PubMed:16141072)Curated
Sequence conflicti679 – 6791M → V in AAH60113. (PubMed:15489334)Curated
Sequence conflicti679 – 6791M → V in AAH60696. (PubMed:15489334)Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei160 – 18930Missing in isoform 2. 1 PublicationVSP_033624Add
BLAST
Alternative sequencei345 – 38137ELSGL…GPAFT → APSQVQGRGQLPKRGLLTSG KILAASFIFALVTSSLL in isoform 4. 1 PublicationVSP_033625Add
BLAST
Alternative sequencei382 – 892511Missing in isoform 4. 1 PublicationVSP_033626Add
BLAST
Alternative sequencei788 – 82841AAGTA…GPVMN → DRWNSSPSPGCLPPQDKLPG LRSAHCSTTSPGLLLPGPSH E in isoform 3. 1 PublicationVSP_033627Add
BLAST
Alternative sequencei829 – 89264Missing in isoform 3. 1 PublicationVSP_033628Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF030131 mRNA. Translation: AAC40070.1.
AK173185 mRNA. Translation: BAD32463.1. Different initiation.
BC060113 mRNA. Translation: AAH60113.1.
BC060696 mRNA. Translation: AAH60696.1.
AK088003 mRNA. Translation: BAC40088.1.
AK045470 mRNA. Translation: BAC32385.1.
AK148137 mRNA. Translation: BAE28367.1.
PIRiT09071.
RefSeqiNP_067481.2. NM_021506.2.
UniGeneiMm.27949.

Genome annotation databases

GeneIDi59009.
KEGGimmu:59009.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF030131 mRNA. Translation: AAC40070.1 .
AK173185 mRNA. Translation: BAD32463.1 . Different initiation.
BC060113 mRNA. Translation: AAH60113.1 .
BC060696 mRNA. Translation: AAH60696.1 .
AK088003 mRNA. Translation: BAC40088.1 .
AK045470 mRNA. Translation: BAC32385.1 .
AK148137 mRNA. Translation: BAE28367.1 .
PIRi T09071.
RefSeqi NP_067481.2. NM_021506.2.
UniGenei Mm.27949.

3D structure databases

ProteinModelPortali Q69ZI1.
SMRi Q69ZI1. Positions 137-255, 457-512, 839-892.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 208480. 1 interaction.
IntActi Q69ZI1. 5 interactions.

PTM databases

PhosphoSitei Q69ZI1.

Proteomic databases

MaxQBi Q69ZI1.
PaxDbi Q69ZI1.
PRIDEi Q69ZI1.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

GeneIDi 59009.
KEGGi mmu:59009.

Organism-specific databases

CTDi 57630.
MGIi MGI:1913066. Sh3rf1.
Rougei Search...

Phylogenomic databases

eggNOGi NOG314495.
HOGENOMi HOG000045564.
HOVERGENi HBG069552.
InParanoidi Q69ZI1.
KOi K12171.
PhylomeDBi Q69ZI1.

Enzyme and pathway databases

UniPathwayi UPA00143 .

Miscellaneous databases

ChiTaRSi Sh3rf1. mouse.
NextBioi 314548.
PROi Q69ZI1.
SOURCEi Search...

Gene expression databases

Genevestigatori Q69ZI1.

Family and domain databases

Gene3Di 3.30.40.10. 1 hit.
InterProi IPR028502. POSH1.
IPR001452. SH3_domain.
IPR018957. Znf_C3HC4_RING-type.
IPR001841. Znf_RING.
IPR013083. Znf_RING/FYVE/PHD.
IPR017907. Znf_RING_CS.
[Graphical view ]
PANTHERi PTHR10661:SF8. PTHR10661:SF8. 1 hit.
Pfami PF14604. SH3_9. 4 hits.
PF00097. zf-C3HC4. 1 hit.
[Graphical view ]
PRINTSi PR00452. SH3DOMAIN.
SMARTi SM00184. RING. 1 hit.
SM00326. SH3. 4 hits.
[Graphical view ]
SUPFAMi SSF50044. SSF50044. 4 hits.
PROSITEi PS50002. SH3. 4 hits.
PS00518. ZF_RING_1. 1 hit.
PS50089. ZF_RING_2. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "A new rac target POSH is an SH3-containing scaffold protein involved in the JNK and NF-kappaB signalling pathways."
    Tapon N., Nagata K., Lamarche N., Hall A.
    EMBO J. 17:1395-1404(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, TISSUE SPECIFICITY, INTERACTION WITH RAC.
  2. "Prediction of the coding sequences of mouse homologues of KIAA gene: IV. The complete nucleotide sequences of 500 mouse KIAA-homologous cDNAs identified by screening of terminal sequences of cDNA clones randomly sampled from size-fractionated libraries."
    Okazaki N., Kikuno R., Ohara R., Inamoto S., Koseki H., Hiraoka S., Saga Y., Seino S., Nishimura M., Kaisho T., Hoshino K., Kitamura H., Nagase T., Ohara O., Koga H.
    DNA Res. 11:205-218(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Embryonic tail.
  3. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3 AND 4), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 200-892 (ISOFORM 1).
    Strain: C57BL/6J and NOD.
    Tissue: Corpora quadrigemina and Thymus.
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Strain: C57BL/6.
    Tissue: Brain.
  5. "POSH acts as a scaffold for a multiprotein complex that mediates JNK activation in apoptosis."
    Xu Z., Kukekov N.V., Greene L.A.
    EMBO J. 22:252-261(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH MAP3K10; MAP3K11; DLK1; MAP2K4; MAP2K7; MAPK8 AND MAPK9.
  6. "Akt2 negatively regulates assembly of the POSH-MLK-JNK signaling complex."
    Figueroa C., Tarras S., Taylor J., Vojtek A.B.
    J. Biol. Chem. 278:47922-47927(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH AKT2, MUTAGENESIS OF GLU-470 AND TRP-489, SUBCELLULAR LOCATION.
  7. "Siah1 interacts with the scaffold protein POSH to promote JNK activation and apoptosis."
    Xu Z., Sproul A., Wang W., Kukekov N., Greene L.A.
    J. Biol. Chem. 281:303-312(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH SIAH1.
  8. "Direct interaction of the molecular scaffolds POSH and JIP is required for apoptotic activation of JNKs."
    Kukekov N.V., Xu Z., Greene L.A.
    J. Biol. Chem. 281:15517-15524(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH MAPK8IP.

Entry informationi

Entry nameiSH3R1_MOUSE
AccessioniPrimary (citable) accession number: Q69ZI1
Secondary accession number(s): O70254
, Q3UG42, Q6P9M8, Q8BR66, Q8C2T5
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 20, 2008
Last sequence update: May 20, 2008
Last modified: November 26, 2014
This is version 84 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3