Q68G58 (APEX2_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 29, 2013.
Version 75.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: DNA-(apurinic or apyrimidinic site) lyase 2 EC=3.1.-.- EC=4.2.99.18 Alternative name(s): APEX nuclease 2 Apurinic-apyrimidinic endonuclease 2 Short name=AP endonuclease 2 | ||||
| Gene names |
| ||||
| Organism | Mus musculus (Mouse) [Reference proteome] | ||||
| Taxonomic identifier | 10090 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus![]() |
Protein attributes
| Sequence length | 516 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Function as a weak apurinic/apyrimidinic (AP) endodeoxyribonuclease in the DNA base excision repair (BER) pathway of DNA lesions induced by oxidative and alkylating agents. Initiates repair of AP sites in DNA by catalyzing hydrolytic incision of the phosphodiester backbone immediately adjacent to the damage, generating a single-strand break with 5'-deoxyribose phosphate and 3'-hydroxyl ends. Displays also double-stranded DNA 3'-5' exonuclease, 3'-phosphodiesterase activities. Shows robust 3'-5' exonuclease activity on 3'-recessed heteroduplex DNA and is able to remove mismatched nucleotides preferentially. Shows fairly strong 3'-phosphodiesterase activity involved in the removal of 3'-damaged termini formed in DNA by oxidative agents. In the nucleus functions in the PCNA-dependent BER pathway. Required for somatic hypermutation (SHM) and DNA cleavage step of class switch recombination (CSR) of immunoglobulin genes. Required for proper cell cycle progression during proliferation of peripheral lymphocytes. Ref.1 Ref.4 Ref.5 Ref.6 |
| Catalytic activity | The C-O-P bond 3' to the apurinic or apyrimidinic site in DNA is broken by a beta-elimination reaction, leaving a 3'-terminal unsaturated sugar and a product with a terminal 5'-phosphate. |
| Cofactor | Magnesium. Can also utilize manganese. Probably binds two magnesium or manganese ions per subunit By similarity. |
| Enzyme regulation | 3'-5' exonuclease activity is activated by sodium and manganese. 3'-5' exonuclease and 3'-phosphodiesterase activities are stimulated in presence of PCNA By similarity. |
| Subunit structure | Interacts with PCNA. This interaction is increased by misincorporation of uracil in nuclear DNA By similarity. Ref.1 |
| Subcellular location | Nucleus. Cytoplasm. Mitochondrion Probable. Note: Together with PCNA, is redistributed in discrete nuclear foci in presence of oxidative DNA damaging agents. Ref.1 Ref.5 |
| Tissue specificity | Expressed in lymphocytes, thymocytes and splenocytes (at protein level). Highly expressed in the thymus and weakly expressed in the bone marrow, spleen, eye, kidney, lung, brain and uterus. Ref.1 Ref.4 |
| Induction | Up-regulated in both the nucleus and the cytosol of B cells stimulated to switch. Ref.5 |
| Disruption phenotype | Mice show abnormalities in proliferating haemopoietic organs, such as dyshematopoiesis, defect in lymphopoiesis, and delayed S-phase and G2/M-phase arrest. Ref.4 Ref.5 |
| Sequence similarities | Belongs to the DNA repair enzymes AP/ExoA family. |
Ontologies
Alternative products
| This entry describes 5 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q68G58-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q68G58-2) The sequence of this isoform differs from the canonical sequence as follows: 79-79: S → SECSCPSP | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: Q68G58-3) The sequence of this isoform differs from the canonical sequence as follows: 213-246: ECFEEDPGRKWMDGLLSNPGDEAGPHIGLFMDSY → VRFPLNHRPQFCSVHPASQNWEFGTRGSFFYGKK 247-516: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 4 (identifier: Q68G58-4) The sequence of this isoform differs from the canonical sequence as follows: 213-266: ECFEEDPGRK...FTCWSVVSGA → LPVAACGHTN...HTASLLRPSY 267-516: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 5 (identifier: Q68G58-5) The sequence of this isoform differs from the canonical sequence as follows: 213-260: ECFEEDPGRK...PKQQRAFTCW → LPVAACGHTN...PLKFTESPCL 261-516: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 516 | 516 | DNA-(apurinic or apyrimidinic site) lyase 2 | PRO_0000200015 | |||||
Regions | |||||||||
| Region | 389 – 396 | 8 | Required for the colocalization with PCNA in nuclear foci in presence of oxidative-induced DNA damaging agents By similarity | ||||||
Sites | |||||||||
| Active site | 155 | 1 | By similarity | ||||||
| Active site | 196 | 1 | Proton donor/acceptor By similarity | ||||||
| Metal binding | 8 | 1 | Magnesium 1 By similarity | ||||||
| Metal binding | 47 | 1 | Magnesium 1 By similarity | ||||||
| Metal binding | 196 | 1 | Magnesium 2 By similarity | ||||||
| Metal binding | 198 | 1 | Magnesium 2 By similarity | ||||||
| Metal binding | 302 | 1 | Magnesium 1 By similarity | ||||||
| Site | 198 | 1 | Transition state stabilizer By similarity | ||||||
| Site | 276 | 1 | Important for catalytic activity By similarity | ||||||
| Site | 303 | 1 | Interaction with DNA substrate By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 79 | 1 | S → SECSCPSP in isoform 2. | VSP_015346 | |||||
| Alternative sequence | 213 – 266 | 54 | ECFEE…VVSGA → LPVAACGHTNLVPEWEAGPV WERTMREIMEGFCDLLHSVR IFHHHTASLLRPSY in isoform 4. | VSP_015347 | |||||
| Alternative sequence | 213 – 260 | 48 | ECFEE…AFTCW → LPVAACGHTNLVPEWEAGPV WERTMREIMEVKTRFCSRPL KFTESPCL in isoform 5. | VSP_015348 | |||||
| Alternative sequence | 213 – 246 | 34 | ECFEE…FMDSY → VRFPLNHRPQFCSVHPASQN WEFGTRGSFFYGKK in isoform 3. | VSP_015349 | |||||
| Alternative sequence | 247 – 516 | 270 | Missing in isoform 3. | VSP_015350 | |||||
| Alternative sequence | 261 – 516 | 256 | Missing in isoform 5. | VSP_015351 | |||||
| Alternative sequence | 267 – 516 | 250 | Missing in isoform 4. | VSP_015352 | |||||
Experimental info | |||||||||
| Sequence conflict | 110 | 1 | G → S in BAC38077. Ref.2 | ||||||
| Sequence conflict | 183 | 1 | A → P in BAB32346. Ref.2 | ||||||
| Sequence conflict | 372 | 1 | C → F in AAH78633. Ref.3 | ||||||
| Sequence conflict | 433 | 1 | V → M in AAH78633. Ref.3 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Characterization of the genomic structure and expression of the mouse Apex2 gene." Ide Y., Tsuchimoto D., Tominaga Y., Iwamoto Y., Nakabeppu Y. Genomics 81:47-57(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORM 1), FUNCTION, INTERACTION WITH PCNA, SUBCELLULAR LOCATION, TISSUE SPECIFICITY. Strain: 129/Sv and C57BL/6. Tissue: B-cell. |
| [2] | "The transcriptional landscape of the mammalian genome." Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. Hayashizaki Y.Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1/2/4/5). Strain: NOD. Tissue: Adipose tissue, Head and Thymus. |
| [3] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3). Strain: FVB/N-3. Tissue: Mammary tumor. |
| [4] | "Growth retardation and dyslymphopoiesis accompanied by G2/M arrest in APEX2-null mice." Ide Y., Tsuchimoto D., Tominaga Y., Nakashima M., Watanabe T., Sakumi K., Ohno M., Nakabeppu Y. Blood 104:4097-4103(2004) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, DISRUPTION PHENOTYPE, TISSUE SPECIFICITY. |
| [5] | "APE1- and APE2-dependent DNA breaks in immunoglobulin class switch recombination." Guikema J.E., Linehan E.K., Tsuchimoto D., Nakabeppu Y., Strauss P.R., Stavnezer J., Schrader C.E. J. Exp. Med. 204:3017-3026(2007) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, INDUCTION, DISRUPTION PHENOTYPE, SUBCELLULAR LOCATION. |
| [6] | "Apex2 is required for efficient somatic hypermutation but not for class switch recombination of immunoglobulin genes." Sabouri Z., Okazaki I.M., Shinkura R., Begum N., Nagaoka H., Tsuchimoto D., Nakabeppu Y., Honjo T. Int. Immunol. 21:947-955(2009) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AB072498 mRNA. Translation: BAB88654.1. AB085235 Genomic DNA. Translation: BAC11807.1. AK021248 mRNA. Translation: BAB32346.1. AK040145 mRNA. Translation: BAC30522.1. AK050858 mRNA. Translation: BAC34436.1. AK080916 mRNA. Translation: BAC38077.1. AK081677 mRNA. Translation: BAC38287.1. AK088918 mRNA. Translation: BAC40652.1. BC026769 mRNA. Translation: AAH26769.1. BC078633 mRNA. Translation: AAH78633.1. |
| IPI | IPI00225176. IPI00473955. IPI00473962. IPI00474999. IPI00828973. |
| RefSeq | NP_084219.1. NM_029943.1. |
| UniGene | Mm.440275. |
3D structure databases | |
| ProteinModelPortal | Q68G58. |
| SMR | Q68G58. Positions 1-307. |
| ModBase | Search... |
PTM databases | |
| PhosphoSite | Q68G58. |
Proteomic databases | |
| PaxDb | Q68G58. |
| PRIDE | Q68G58. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENSMUST00000112725; ENSMUSP00000108345; ENSMUSG00000025269. ENSMUST00000112727; ENSMUSP00000108347; ENSMUSG00000025269. |
| GeneID | 77622. |
| KEGG | mmu:77622. |
Organism-specific databases | |
| CTD | 27301. |
| MGI | MGI:1924872. Apex2. |
Phylogenomic databases | |
| eggNOG | COG0708. |
| GeneTree | ENSGT00530000063540. |
| HOVERGEN | HBG054715. |
| KO | K10772. |
| OrthoDB | EOG4NS3BQ. |
Gene expression databases | |
| ArrayExpress | Q68G58. |
| Bgee | Q68G58. |
| CleanEx | MM_APEX2. |
| Genevestigator | Q68G58. |
| GermOnline | ENSMUSG00000025269. Mus musculus. |
Family and domain databases | |
| Gene3D | 3.60.10.10. 1 hit. |
| InterPro | IPR020847. AP_endonuclease_F1_BS. IPR005135. Endo/exonuclease/phosphatase. IPR004808. ExoDNase_III. IPR010666. Znf_GRF. [Graphical view] |
| PANTHER | PTHR22748. PTHR22748. 1 hit. |
| Pfam | PF03372. Exo_endo_phos. 1 hit. PF06839. zf-GRF. 1 hit. [Graphical view] |
| SUPFAM | SSF56219. Exo_endo_phos. 1 hit. |
| TIGRFAMs | TIGR00633. xth. 1 hit. |
| PROSITE | PS00726. AP_NUCLEASE_F1_1. 1 hit. PS00727. AP_NUCLEASE_F1_2. False negative. PS00728. AP_NUCLEASE_F1_3. False negative. PS51435. AP_NUCLEASE_F1_4. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 347242. |
| SOURCE | Search... |
Entry information
| Entry name | APEX2_MOUSE | ||||||||
| Accession | Primary (citable) accession number: Q68G58 Secondary accession number(s): Q8BJP7 Q9CS12 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
