Reviewed,
UniProtKB/Swiss-Prot Q68G58 (APEX2_MOUSE)
Last modified
February 9, 2010.
Version 50.
History...
Clusters with 100%,
90%,
50% identity |
Documents (2) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: DNA-(apurinic or apyrimidinic site) lyase 2 EC=4.2.99.18 Alternative name(s): Apurinic-apyrimidinic endonuclease 2 Short name=AP endonuclease 2 APEX nuclease 2 | ||||
| Gene names |
| ||||
| Organism | Mus musculus (Mouse) | ||||
| Taxonomic identifier | 10090 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus |
Protein attributes
| Sequence length | 516 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | May participate in both nuclear and mitochondrial post-replicative base excision repair (BER). In the nucleus functions in the PCNA-dependent BER pathway. Ref.1 |
| Catalytic activity | The C-O-P bond 3' to the apurinic or apyrimidinic site in DNA is broken by a beta-elimination reaction, leaving a 3'-terminal unsaturated sugar and a product with a terminal 5'-phosphate. |
| Subunit structure | Interacts with PCNA. This interaction is increased by misincorporation of uracil in nuclear DNA By similarity. Ref.1 |
| Subcellular location | Nucleus Probable. Mitochondrion Probable. Note: Colocalized partly with PCNA in nuclear foci. Ref.1 |
| Tissue specificity | Highly expressed in the thymus and weakly expressed in the bone marrow, spleen, eye, kidney, lung, brain and uterus. Ref.1 |
| Sequence similarities | Belongs to the DNA repair enzymes AP/exoA family. |
Ontologies
| Keywords | |
|---|---|
| Biological process | DNA damage DNA repair |
| Cellular component | Mitochondrion Nucleus |
| Coding sequence diversity | Alternative splicing |
| Molecular function | Lyase |
| Gene Ontology (GO) | |
| Biological process | DNA repair Inferred from electronic annotation. Source: UniProtKB-KW |
| Cellular component | mitochondrial inner membrane Ref.1 Inferred from direct assay. Source: MGI nucleus Ref.1Inferred from direct assay. Source: MGI |
| Molecular function | DNA binding Inferred from electronic annotation. Source: InterPro DNA-(apurinic or apyrimidinic site) lyase activityInferred from electronic annotation. Source: EC endonuclease activityInferred from electronic annotation. Source: InterPro zinc ion bindingInferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 5 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q68G58-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q68G58-2) The sequence of this isoform differs from the canonical sequence as follows: 79-79: S → SECSCPSP | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: Q68G58-3) The sequence of this isoform differs from the canonical sequence as follows: 213-246: ECFEEDPGRKWMDGLLSNPGDEAGPHIGLFMDSY → VRFPLNHRPQFCSVHPASQNWEFGTRGSFFYGKK 247-516: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 4 (identifier: Q68G58-4) The sequence of this isoform differs from the canonical sequence as follows: 213-266: ECFEEDPGRK...FTCWSVVSGA → LPVAACGHTN...HTASLLRPSY 267-516: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 5 (identifier: Q68G58-5) The sequence of this isoform differs from the canonical sequence as follows: 213-260: ECFEEDPGRK...PKQQRAFTCW → LPVAACGHTN...PLKFTESPCL 261-516: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 516 | 516 | DNA-(apurinic or apyrimidinic site) lyase 2 | PRO_0000200015 | |||||
Natural variations | |||||||||
| Alternative sequence | 79 | 1 | S → SECSCPSP in isoform 2. | VSP_015346 | |||||
| Alternative sequence | 213 – 266 | 54 | ECFEE…VVSGA → LPVAACGHTNLVPEWEAGPV WERTMREIMEGFCDLLHSVR IFHHHTASLLRPSY in isoform 4. | VSP_015347 | |||||
| Alternative sequence | 213 – 260 | 48 | ECFEE…AFTCW → LPVAACGHTNLVPEWEAGPV WERTMREIMEVKTRFCSRPL KFTESPCL in isoform 5. | VSP_015348 | |||||
| Alternative sequence | 213 – 246 | 34 | ECFEE…FMDSY → VRFPLNHRPQFCSVHPASQN WEFGTRGSFFYGKK in isoform 3. | VSP_015349 | |||||
| Alternative sequence | 247 – 516 | 270 | Missing in isoform 3. | VSP_015350 | |||||
| Alternative sequence | 261 – 516 | 256 | Missing in isoform 5. | VSP_015351 | |||||
| Alternative sequence | 267 – 516 | 250 | Missing in isoform 4. | VSP_015352 | |||||
Experimental info | |||||||||
| Sequence conflict | 110 | 1 | G → S in BAC38077. Ref.2 | ||||||
| Sequence conflict | 183 | 1 | A → P in BAB32346. Ref.2 | ||||||
| Sequence conflict | 372 | 1 | C → F in AAH78633. Ref.3 | ||||||
| Sequence conflict | 433 | 1 | V → M in AAH78633. Ref.3 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Characterization of the genomic structure and expression of the mouse Apex2 gene." Ide Y., Tsuchimoto D., Tominaga Y., Iwamoto Y., Nakabeppu Y. Genomics 81:47-57(2003) [PubMed: 12573260] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORM 1), FUNCTION, INTERACTION WITH PCNA, SUBCELLULAR LOCATION, TISSUE SPECIFICITY. Strain: 129/Sv and C57BL/6. Tissue: B-cell. |
| [2] | "The transcriptional landscape of the mammalian genome." Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. Hayashizaki Y.Science 309:1559-1563(2005) [PubMed: 16141072] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1/2/4/5). Strain: NOD. Tissue: Adipose tissue, Head and Thymus. |
| [3] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3). Strain: FVB/N-3. Tissue: Mammary tumor. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AB072498 mRNA. Translation: BAB88654.1. AB085235 Genomic DNA. Translation: BAC11807.1. AK021248 mRNA. Translation: BAB32346.1. AK040145 mRNA. Translation: BAC30522.1. AK050858 mRNA. Translation: BAC34436.1. AK080916 mRNA. Translation: BAC38077.1. AK081677 mRNA. Translation: BAC38287.1. AK088918 mRNA. Translation: BAC40652.1. BC026769 mRNA. Translation: AAH26769.1. BC078633 mRNA. Translation: AAH78633.1. |
| IPI | IPI00225176. IPI00473955. IPI00473962. IPI00474999. IPI00828973. |
| RefSeq | NP_084219.1. |
| UniGene | Mm.440275 |
3D structure databases | |
| SMR | Q68G58. Positions 1-311. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | Q68G58. |
PTM databases | |
| PhosphoSite | Q68G58. |
Proteomic databases | |
| PRIDE | Q68G58. |
Genome annotation databases | |
| Ensembl | ENSMUST00000026303; ENSMUSP00000026303; ENSMUSG00000025269; Mus musculus. [Genome view] ENSMUST00000112720; ENSMUSP00000108340; ENSMUSG00000025269; Mus musculus. [Genome view] ENSMUST00000112721; ENSMUSP00000108341; ENSMUSG00000025269; Mus musculus. [Genome view] ENSMUST00000112727; ENSMUSP00000108347; ENSMUSG00000025269; Mus musculus. [Genome view] |
| GeneID | 77622. |
| KEGG | mmu:77622. |
| UCSC | uc009uoi.1. mouse. uc009uom.1. mouse. uc009uon.1. mouse. |
Organism-specific databases | |
| CTD | 77622. |
| MGI | MGI:1924872. Apex2. |
Phylogenomic databases | |
| HOVERGEN | Q68G58. |
| PhylomeDB | Q68G58. |
Enzyme and pathway databases | |
| BRENDA | 4.2.99.18. 244. |
Gene expression databases | |
| ArrayExpress | Q68G58. |
| Bgee | Q68G58. |
| CleanEx | MM_APEX2. |
| Genevestigator | Q68G58. |
| GermOnline | ENSMUSG00000025269. Mus musculus. |
Family and domain databases | |
| InterPro | IPR020847. AP_endonuclease_F1_BS. IPR005135. Endo/exonuclease/phosphatase. IPR004808. exoDNase_III. [Graphical view] |
| PANTHER | PTHR22748. ExoIII_xth. 1 hit. |
| Pfam | PF03372. Exo_endo_phos. 1 hit. [Graphical view] |
| TIGRFAMs | TIGR00633. xth. 1 hit. |
| PROSITE | PS00726. AP_NUCLEASE_F1_1. 1 hit. PS00727. AP_NUCLEASE_F1_2. False negative. PS00728. AP_NUCLEASE_F1_3. False negative. PS51435. AP_NUCLEASE_F1_4. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| NextBio | 347242. |
| SOURCE | Search... |
Entry information
| Entry name | APEX2_MOUSE | ||||||||
| Accession | Primary (citable) accession number: Q68G58 Secondary accession number(s): Q8BJP7 Q9CS12 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with


