Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Zinc finger protein 280D

Gene

Znf280d

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at transcript leveli

Functioni

May function as a transcription factor.

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri333 – 35523C2H2-type 1PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri370 – 39324C2H2-type 2PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri400 – 42425C2H2-type 3; degeneratePROSITE-ProRule annotationAdd
BLAST
Zinc fingeri430 – 45324C2H2-type 4PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri459 – 48123C2H2-type 5PROSITE-ProRule annotationAdd
BLAST

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Transcription, Transcription regulation

Keywords - Ligandi

DNA-binding, Metal-binding, Zinc

Names & Taxonomyi

Protein namesi
Recommended name:
Zinc finger protein 280D
Alternative name(s):
Suppressor of hairy wing homolog 4
Gene namesi
Name:Znf280d
Synonyms:Suhw4, Zfp280d
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589 Componenti: Chromosome 9

Organism-specific databases

MGIiMGI:2384583. Zfp280d.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 974974Zinc finger protein 280DPRO_0000227978Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei557 – 5571PhosphoserineBy similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ68FE8.
PaxDbiQ68FE8.
PRIDEiQ68FE8.

PTM databases

PhosphoSiteiQ68FE8.

Expressioni

Gene expression databases

BgeeiQ68FE8.
ExpressionAtlasiQ68FE8. baseline and differential.
GenevisibleiQ68FE8. MM.

Interactioni

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000096175.

Structurei

3D structure databases

ProteinModelPortaliQ68FE8.
SMRiQ68FE8. Positions 241-275, 326-518.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi32 – 398Poly-Glu

Sequence similaritiesi

Contains 5 C2H2-type zinc fingers.PROSITE-ProRule annotation

Zinc finger

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri333 – 35523C2H2-type 1PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri370 – 39324C2H2-type 2PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri400 – 42425C2H2-type 3; degeneratePROSITE-ProRule annotationAdd
BLAST
Zinc fingeri430 – 45324C2H2-type 4PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri459 – 48123C2H2-type 5PROSITE-ProRule annotationAdd
BLAST

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

eggNOGiNOG239493.
GeneTreeiENSGT00530000063300.
HOGENOMiHOG000013047.
HOVERGENiHBG060885.
InParanoidiQ68FE8.
OMAiETHTCQV.
OrthoDBiEOG7QVM24.
PhylomeDBiQ68FE8.
TreeFamiTF331707.

Family and domain databases

InterProiIPR025243. DUF4195.
IPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
[Graphical view]
PfamiPF13836. DUF4195. 1 hit.
[Graphical view]
SMARTiSM00355. ZnF_C2H2. 9 hits.
[Graphical view]
PROSITEiPS00028. ZINC_FINGER_C2H2_1. 5 hits.
PS50157. ZINC_FINGER_C2H2_2. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q68FE8-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MVTTYIKSDL QLDGRQFFQP KDNLKMAELF MECEEEELEP WQKKVKEVEE
60 70 80 90 100
DDDDEPIFVA EIASSKPAIS NILNRVNPSS HSRGIKNGIL NRGFTASFKP
110 120 130 140 150
TSQRCLNSAS NPVAALPVNF HPESRSSDSS VIVQPFSKPG YVTNSPRVLS
160 170 180 190 200
NNSSELLFDL TQDTGLSHYQ GGPTLSIAGL NETSFLSKRP SGSDISSVNP
210 220 230 240 250
KKPKPSENTS GIDASSVISS EKSPSVISLQ VVPSQGANCS SSQSKNGTTF
260 270 280 290 300
PRACPKCDIH FNLLDPLKNH MTYCCPDMIN NFLGLTKADN LNSANEAKTL
310 320 330 340 350
ESEKGKLIML VNDFYYGKHE GDVLEEQKTH TTFKCFSCLK VLKNNIRFMN
360 370 380 390 400
HMKHHLELEK QSSESWEKHT TCQHCYRQFP TPFQLQCHIE STHTPHEFST
410 420 430 440 450
ICKICELSFE TEQILLQHMK DNHKPGEMPY ICQVCNYRSS LFSEVESHFR
460 470 480 490 500
TSHENTKNLL CPFCLKVIKI ATPYMHHYMK HQKKGIHRCT KCRLQFLTCK
510 520 530 540 550
EKMDHKTQHH RTFVKPKQLE GLPPGTKVTI RASVGPLQSG SSVTPSISPS
560 570 580 590 600
TSTLQLSPPE PDNVTAKNHV KLTTSTPNTT ISDPSKANET KSNGSKSKNK
610 620 630 640 650
SKVSNMQKKQ STLSSSNKKS KVNTALRNLR LRRGVHECIE CSSEVKDFAN
660 670 680 690 700
HFPTYVHCSF CRYNTSCSKA YVNHMMSFHS NRPSKRYCIF KKHSENLRGI
710 720 730 740 750
SLVCLNCDFL TDVSGLDNMA THLSQHETHS CRVLVEQVSV CIPTSERLSE
760 770 780 790 800
IKTEAPTKGQ EPVSKETARH SRAEGEPGAS HSGSKQDKVP SSEEGTGCDA
810 820 830 840 850
SVCEAAAATH CEKDVTVSDT ENVSSSKNIL SHDPDVGTDT MEKEEKTHHA
860 870 880 890 900
CQEMELKVDQ SSESTNPTEA ELSSETRQGL QLTSGDVGID QFLRQGDEPK
910 920 930 940 950
SVNSDASDPG SVRLEPLTPS EVLEYEATEI LHDGDDPSAN TSDTVSDQTG
960 970
GSPGGSNPCR AETAVDLADG EERS
Length:974
Mass (Da):107,836
Last modified:October 11, 2004 - v1
Checksum:i1207D9ADBE551229
GO
Isoform 2 (identifier: Q68FE8-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     751-787: IKTEAPTKGQEPVSKETARHSRAEGEPGASHSGSKQD → CRSSPEISKHVQGVPGQCPLRWTQVLPVLSFPGMRMN
     788-974: Missing.

Note: No experimental confirmation available.
Show »
Length:787
Mass (Da):88,431
Checksum:i4DDB27FA5E458020
GO
Isoform 3 (identifier: Q68FE8-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-270: Missing.
     784-784: S → R
     785-974: Missing.

Note: No experimental confirmation available.
Show »
Length:514
Mass (Da):58,512
Checksum:i8365D1F65555F34A
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 270270Missing in isoform 3. 1 PublicationVSP_017629Add
BLAST
Alternative sequencei751 – 78737IKTEA…GSKQD → CRSSPEISKHVQGVPGQCPL RWTQVLPVLSFPGMRMN in isoform 2. 1 PublicationVSP_017630Add
BLAST
Alternative sequencei784 – 7841S → R in isoform 3. 1 PublicationVSP_017631
Alternative sequencei785 – 974190Missing in isoform 3. 1 PublicationVSP_017632Add
BLAST
Alternative sequencei788 – 974187Missing in isoform 2. 1 PublicationVSP_017633Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK045173 mRNA. Translation: BAC32247.1.
AK172652 mRNA. Translation: BAE43113.1.
BC079878 mRNA. Translation: AAH79878.1.
CCDSiCCDS40683.1. [Q68FE8-1]
RefSeqiNP_666336.3. NM_146224.4. [Q68FE8-1]
XP_006511183.1. XM_006511120.1. [Q68FE8-2]
UniGeneiMm.242791.

Genome annotation databases

EnsembliENSMUST00000098576; ENSMUSP00000096175; ENSMUSG00000038535. [Q68FE8-1]
ENSMUST00000184517; ENSMUSP00000138970; ENSMUSG00000038535. [Q68FE8-2]
GeneIDi235469.
KEGGimmu:235469.
UCSCiuc009qpo.1. mouse. [Q68FE8-2]
uc009qpp.1. mouse. [Q68FE8-3]
uc009qpq.1. mouse. [Q68FE8-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK045173 mRNA. Translation: BAC32247.1.
AK172652 mRNA. Translation: BAE43113.1.
BC079878 mRNA. Translation: AAH79878.1.
CCDSiCCDS40683.1. [Q68FE8-1]
RefSeqiNP_666336.3. NM_146224.4. [Q68FE8-1]
XP_006511183.1. XM_006511120.1. [Q68FE8-2]
UniGeneiMm.242791.

3D structure databases

ProteinModelPortaliQ68FE8.
SMRiQ68FE8. Positions 241-275, 326-518.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000096175.

PTM databases

PhosphoSiteiQ68FE8.

Proteomic databases

MaxQBiQ68FE8.
PaxDbiQ68FE8.
PRIDEiQ68FE8.

Protocols and materials databases

DNASUi235469.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000098576; ENSMUSP00000096175; ENSMUSG00000038535. [Q68FE8-1]
ENSMUST00000184517; ENSMUSP00000138970; ENSMUSG00000038535. [Q68FE8-2]
GeneIDi235469.
KEGGimmu:235469.
UCSCiuc009qpo.1. mouse. [Q68FE8-2]
uc009qpp.1. mouse. [Q68FE8-3]
uc009qpq.1. mouse. [Q68FE8-1]

Organism-specific databases

CTDi235469.
MGIiMGI:2384583. Zfp280d.

Phylogenomic databases

eggNOGiNOG239493.
GeneTreeiENSGT00530000063300.
HOGENOMiHOG000013047.
HOVERGENiHBG060885.
InParanoidiQ68FE8.
OMAiETHTCQV.
OrthoDBiEOG7QVM24.
PhylomeDBiQ68FE8.
TreeFamiTF331707.

Miscellaneous databases

NextBioi382698.
PROiQ68FE8.
SOURCEiSearch...

Gene expression databases

BgeeiQ68FE8.
ExpressionAtlasiQ68FE8. baseline and differential.
GenevisibleiQ68FE8. MM.

Family and domain databases

InterProiIPR025243. DUF4195.
IPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
[Graphical view]
PfamiPF13836. DUF4195. 1 hit.
[Graphical view]
SMARTiSM00355. ZnF_C2H2. 9 hits.
[Graphical view]
PROSITEiPS00028. ZINC_FINGER_C2H2_1. 5 hits.
PS50157. ZINC_FINGER_C2H2_2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

  1. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3).
    Strain: C57BL/6J and NOD.
    Tissue: Spleen.
  2. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Strain: C57BL/6.
    Tissue: Brain.

Entry informationi

Entry nameiZ280D_MOUSE
AccessioniPrimary (citable) accession number: Q68FE8
Secondary accession number(s): Q3T9B1, Q8BI82
Entry historyi
Integrated into UniProtKB/Swiss-Prot: March 21, 2006
Last sequence update: October 11, 2004
Last modified: June 24, 2015
This is version 93 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.