Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q68FE8

- Z280D_MOUSE

UniProt

Q68FE8 - Z280D_MOUSE

Protein

Zinc finger protein 280D

Gene

Znf280d

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 3 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 87 (01 Oct 2014)
      Sequence version 1 (11 Oct 2004)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    May function as a transcription factor.

    Regions

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Zinc fingeri333 – 35523C2H2-type 1PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri370 – 39324C2H2-type 2PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri400 – 42425C2H2-type 3; degeneratePROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri430 – 45324C2H2-type 4PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri459 – 48123C2H2-type 5PROSITE-ProRule annotationAdd
    BLAST

    GO - Molecular functioni

    1. DNA binding Source: UniProtKB-KW
    2. metal ion binding Source: UniProtKB-KW

    GO - Biological processi

    1. regulation of transcription, DNA-templated Source: UniProtKB-KW
    2. transcription, DNA-templated Source: UniProtKB-KW

    Keywords - Biological processi

    Transcription, Transcription regulation

    Keywords - Ligandi

    DNA-binding, Metal-binding, Zinc

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Zinc finger protein 280D
    Alternative name(s):
    Suppressor of hairy wing homolog 4
    Gene namesi
    Name:Znf280d
    Synonyms:Suhw4, Zfp280d
    OrganismiMus musculus (Mouse)
    Taxonomic identifieri10090 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
    ProteomesiUP000000589: Chromosome 9

    Organism-specific databases

    MGIiMGI:2384583. Zfp280d.

    Subcellular locationi

    Nucleus Curated

    GO - Cellular componenti

    1. nucleus Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Nucleus

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 974974Zinc finger protein 280DPRO_0000227978Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei557 – 5571PhosphoserineBy similarity

    Keywords - PTMi

    Phosphoprotein

    Proteomic databases

    MaxQBiQ68FE8.
    PaxDbiQ68FE8.
    PRIDEiQ68FE8.

    PTM databases

    PhosphoSiteiQ68FE8.

    Expressioni

    Gene expression databases

    BgeeiQ68FE8.
    GenevestigatoriQ68FE8.

    Structurei

    3D structure databases

    ProteinModelPortaliQ68FE8.
    SMRiQ68FE8. Positions 241-275, 326-461, 480-520.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi32 – 398Poly-Glu

    Sequence similaritiesi

    Contains 5 C2H2-type zinc fingers.PROSITE-ProRule annotation

    Zinc finger

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Zinc fingeri333 – 35523C2H2-type 1PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri370 – 39324C2H2-type 2PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri400 – 42425C2H2-type 3; degeneratePROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri430 – 45324C2H2-type 4PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri459 – 48123C2H2-type 5PROSITE-ProRule annotationAdd
    BLAST

    Keywords - Domaini

    Repeat, Zinc-finger

    Phylogenomic databases

    eggNOGiNOG239493.
    GeneTreeiENSGT00530000063300.
    HOGENOMiHOG000013047.
    HOVERGENiHBG060885.
    InParanoidiQ68FE8.
    OMAiHYQGGPT.
    OrthoDBiEOG7QVM24.
    PhylomeDBiQ68FE8.
    TreeFamiTF331707.

    Family and domain databases

    InterProiIPR025243. DUF4195.
    IPR007087. Znf_C2H2.
    IPR015880. Znf_C2H2-like.
    [Graphical view]
    PfamiPF13836. DUF4195. 1 hit.
    [Graphical view]
    SMARTiSM00355. ZnF_C2H2. 9 hits.
    [Graphical view]
    PROSITEiPS00028. ZINC_FINGER_C2H2_1. 5 hits.
    PS50157. ZINC_FINGER_C2H2_2. 1 hit.
    [Graphical view]

    Sequences (3)i

    Sequence statusi: Complete.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q68FE8-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MVTTYIKSDL QLDGRQFFQP KDNLKMAELF MECEEEELEP WQKKVKEVEE    50
    DDDDEPIFVA EIASSKPAIS NILNRVNPSS HSRGIKNGIL NRGFTASFKP 100
    TSQRCLNSAS NPVAALPVNF HPESRSSDSS VIVQPFSKPG YVTNSPRVLS 150
    NNSSELLFDL TQDTGLSHYQ GGPTLSIAGL NETSFLSKRP SGSDISSVNP 200
    KKPKPSENTS GIDASSVISS EKSPSVISLQ VVPSQGANCS SSQSKNGTTF 250
    PRACPKCDIH FNLLDPLKNH MTYCCPDMIN NFLGLTKADN LNSANEAKTL 300
    ESEKGKLIML VNDFYYGKHE GDVLEEQKTH TTFKCFSCLK VLKNNIRFMN 350
    HMKHHLELEK QSSESWEKHT TCQHCYRQFP TPFQLQCHIE STHTPHEFST 400
    ICKICELSFE TEQILLQHMK DNHKPGEMPY ICQVCNYRSS LFSEVESHFR 450
    TSHENTKNLL CPFCLKVIKI ATPYMHHYMK HQKKGIHRCT KCRLQFLTCK 500
    EKMDHKTQHH RTFVKPKQLE GLPPGTKVTI RASVGPLQSG SSVTPSISPS 550
    TSTLQLSPPE PDNVTAKNHV KLTTSTPNTT ISDPSKANET KSNGSKSKNK 600
    SKVSNMQKKQ STLSSSNKKS KVNTALRNLR LRRGVHECIE CSSEVKDFAN 650
    HFPTYVHCSF CRYNTSCSKA YVNHMMSFHS NRPSKRYCIF KKHSENLRGI 700
    SLVCLNCDFL TDVSGLDNMA THLSQHETHS CRVLVEQVSV CIPTSERLSE 750
    IKTEAPTKGQ EPVSKETARH SRAEGEPGAS HSGSKQDKVP SSEEGTGCDA 800
    SVCEAAAATH CEKDVTVSDT ENVSSSKNIL SHDPDVGTDT MEKEEKTHHA 850
    CQEMELKVDQ SSESTNPTEA ELSSETRQGL QLTSGDVGID QFLRQGDEPK 900
    SVNSDASDPG SVRLEPLTPS EVLEYEATEI LHDGDDPSAN TSDTVSDQTG 950
    GSPGGSNPCR AETAVDLADG EERS 974
    Length:974
    Mass (Da):107,836
    Last modified:October 11, 2004 - v1
    Checksum:i1207D9ADBE551229
    GO
    Isoform 2 (identifier: Q68FE8-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         751-787: IKTEAPTKGQEPVSKETARHSRAEGEPGASHSGSKQD → CRSSPEISKHVQGVPGQCPLRWTQVLPVLSFPGMRMN
         788-974: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:787
    Mass (Da):88,431
    Checksum:i4DDB27FA5E458020
    GO
    Isoform 3 (identifier: Q68FE8-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-270: Missing.
         784-784: S → R
         785-974: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:514
    Mass (Da):58,512
    Checksum:i8365D1F65555F34A
    GO

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 270270Missing in isoform 3. 1 PublicationVSP_017629Add
    BLAST
    Alternative sequencei751 – 78737IKTEA…GSKQD → CRSSPEISKHVQGVPGQCPL RWTQVLPVLSFPGMRMN in isoform 2. 1 PublicationVSP_017630Add
    BLAST
    Alternative sequencei784 – 7841S → R in isoform 3. 1 PublicationVSP_017631
    Alternative sequencei785 – 974190Missing in isoform 3. 1 PublicationVSP_017632Add
    BLAST
    Alternative sequencei788 – 974187Missing in isoform 2. 1 PublicationVSP_017633Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK045173 mRNA. Translation: BAC32247.1.
    AK172652 mRNA. Translation: BAE43113.1.
    BC079878 mRNA. Translation: AAH79878.1.
    CCDSiCCDS40683.1. [Q68FE8-1]
    RefSeqiNP_666336.3. NM_146224.4. [Q68FE8-1]
    XP_006511183.1. XM_006511120.1. [Q68FE8-2]
    UniGeneiMm.242791.

    Genome annotation databases

    EnsembliENSMUST00000098576; ENSMUSP00000096175; ENSMUSG00000038535. [Q68FE8-1]
    ENSMUST00000184517; ENSMUSP00000138970; ENSMUSG00000038535. [Q68FE8-2]
    GeneIDi235469.
    KEGGimmu:235469.
    UCSCiuc009qpo.1. mouse. [Q68FE8-2]
    uc009qpp.1. mouse. [Q68FE8-3]
    uc009qpq.1. mouse. [Q68FE8-1]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK045173 mRNA. Translation: BAC32247.1 .
    AK172652 mRNA. Translation: BAE43113.1 .
    BC079878 mRNA. Translation: AAH79878.1 .
    CCDSi CCDS40683.1. [Q68FE8-1 ]
    RefSeqi NP_666336.3. NM_146224.4. [Q68FE8-1 ]
    XP_006511183.1. XM_006511120.1. [Q68FE8-2 ]
    UniGenei Mm.242791.

    3D structure databases

    ProteinModelPortali Q68FE8.
    SMRi Q68FE8. Positions 241-275, 326-461, 480-520.
    ModBasei Search...
    MobiDBi Search...

    PTM databases

    PhosphoSitei Q68FE8.

    Proteomic databases

    MaxQBi Q68FE8.
    PaxDbi Q68FE8.
    PRIDEi Q68FE8.

    Protocols and materials databases

    DNASUi 235469.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENSMUST00000098576 ; ENSMUSP00000096175 ; ENSMUSG00000038535 . [Q68FE8-1 ]
    ENSMUST00000184517 ; ENSMUSP00000138970 ; ENSMUSG00000038535 . [Q68FE8-2 ]
    GeneIDi 235469.
    KEGGi mmu:235469.
    UCSCi uc009qpo.1. mouse. [Q68FE8-2 ]
    uc009qpp.1. mouse. [Q68FE8-3 ]
    uc009qpq.1. mouse. [Q68FE8-1 ]

    Organism-specific databases

    CTDi 235469.
    MGIi MGI:2384583. Zfp280d.

    Phylogenomic databases

    eggNOGi NOG239493.
    GeneTreei ENSGT00530000063300.
    HOGENOMi HOG000013047.
    HOVERGENi HBG060885.
    InParanoidi Q68FE8.
    OMAi HYQGGPT.
    OrthoDBi EOG7QVM24.
    PhylomeDBi Q68FE8.
    TreeFami TF331707.

    Miscellaneous databases

    ChiTaRSi ZNF280D. mouse.
    NextBioi 382698.
    PROi Q68FE8.
    SOURCEi Search...

    Gene expression databases

    Bgeei Q68FE8.
    Genevestigatori Q68FE8.

    Family and domain databases

    InterProi IPR025243. DUF4195.
    IPR007087. Znf_C2H2.
    IPR015880. Znf_C2H2-like.
    [Graphical view ]
    Pfami PF13836. DUF4195. 1 hit.
    [Graphical view ]
    SMARTi SM00355. ZnF_C2H2. 9 hits.
    [Graphical view ]
    PROSITEi PS00028. ZINC_FINGER_C2H2_1. 5 hits.
    PS50157. ZINC_FINGER_C2H2_2. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "The transcriptional landscape of the mammalian genome."
      Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
      , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
      Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3).
      Strain: C57BL/6J and NOD.
      Tissue: Spleen.
    2. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Strain: C57BL/6.
      Tissue: Brain.

    Entry informationi

    Entry nameiZ280D_MOUSE
    AccessioniPrimary (citable) accession number: Q68FE8
    Secondary accession number(s): Q3T9B1, Q8BI82
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: March 21, 2006
    Last sequence update: October 11, 2004
    Last modified: October 1, 2014
    This is version 87 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. MGD cross-references
      Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
    2. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3