Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q68FE8 (Z280D_MOUSE) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 86. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (2) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Zinc finger protein 280D
Alternative name(s):
Suppressor of hairy wing homolog 4
Gene names
Name:Znf280d
Synonyms:Suhw4, Zfp280d
OrganismMus musculus (Mouse) [Reference proteome]
Taxonomic identifier10090 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus

Protein attributes

Sequence length974 AA.
Sequence statusComplete.
Protein existenceEvidence at transcript level

General annotation (Comments)

Function

May function as a transcription factor.

Subcellular location

Nucleus Potential.

Sequence similarities

Contains 5 C2H2-type zinc fingers.

Ontologies

Keywords
   Biological processTranscription
Transcription regulation
   Cellular componentNucleus
   Coding sequence diversityAlternative splicing
   DomainRepeat
Zinc-finger
   LigandDNA-binding
Metal-binding
Zinc
   PTMPhosphoprotein
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Biological_processregulation of transcription, DNA-templated

Inferred from electronic annotation. Source: UniProtKB-KW

transcription, DNA-templated

Inferred from electronic annotation. Source: UniProtKB-KW

   Cellular_componentnucleus

Inferred from electronic annotation. Source: UniProtKB-SubCell

   Molecular_functionDNA binding

Inferred from electronic annotation. Source: UniProtKB-KW

metal ion binding

Inferred from electronic annotation. Source: UniProtKB-KW

Complete GO annotation...

Alternative products

This entry describes 3 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q68FE8-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q68FE8-2)

The sequence of this isoform differs from the canonical sequence as follows:
     751-787: IKTEAPTKGQEPVSKETARHSRAEGEPGASHSGSKQD → CRSSPEISKHVQGVPGQCPLRWTQVLPVLSFPGMRMN
     788-974: Missing.
Note: No experimental confirmation available.
Isoform 3 (identifier: Q68FE8-3)

The sequence of this isoform differs from the canonical sequence as follows:
     1-270: Missing.
     784-784: S → R
     785-974: Missing.
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 974974Zinc finger protein 280D
PRO_0000227978

Regions

Zinc finger333 – 35523C2H2-type 1
Zinc finger370 – 39324C2H2-type 2
Zinc finger400 – 42425C2H2-type 3; degenerate
Zinc finger430 – 45324C2H2-type 4
Zinc finger459 – 48123C2H2-type 5
Compositional bias32 – 398Poly-Glu

Amino acid modifications

Modified residue5571Phosphoserine By similarity

Natural variations

Alternative sequence1 – 270270Missing in isoform 3.
VSP_017629
Alternative sequence751 – 78737IKTEA…GSKQD → CRSSPEISKHVQGVPGQCPL RWTQVLPVLSFPGMRMN in isoform 2.
VSP_017630
Alternative sequence7841S → R in isoform 3.
VSP_017631
Alternative sequence785 – 974190Missing in isoform 3.
VSP_017632
Alternative sequence788 – 974187Missing in isoform 2.
VSP_017633

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified October 11, 2004. Version 1.
Checksum: 1207D9ADBE551229

FASTA974107,836
        10         20         30         40         50         60 
MVTTYIKSDL QLDGRQFFQP KDNLKMAELF MECEEEELEP WQKKVKEVEE DDDDEPIFVA 

        70         80         90        100        110        120 
EIASSKPAIS NILNRVNPSS HSRGIKNGIL NRGFTASFKP TSQRCLNSAS NPVAALPVNF 

       130        140        150        160        170        180 
HPESRSSDSS VIVQPFSKPG YVTNSPRVLS NNSSELLFDL TQDTGLSHYQ GGPTLSIAGL 

       190        200        210        220        230        240 
NETSFLSKRP SGSDISSVNP KKPKPSENTS GIDASSVISS EKSPSVISLQ VVPSQGANCS 

       250        260        270        280        290        300 
SSQSKNGTTF PRACPKCDIH FNLLDPLKNH MTYCCPDMIN NFLGLTKADN LNSANEAKTL 

       310        320        330        340        350        360 
ESEKGKLIML VNDFYYGKHE GDVLEEQKTH TTFKCFSCLK VLKNNIRFMN HMKHHLELEK 

       370        380        390        400        410        420 
QSSESWEKHT TCQHCYRQFP TPFQLQCHIE STHTPHEFST ICKICELSFE TEQILLQHMK 

       430        440        450        460        470        480 
DNHKPGEMPY ICQVCNYRSS LFSEVESHFR TSHENTKNLL CPFCLKVIKI ATPYMHHYMK 

       490        500        510        520        530        540 
HQKKGIHRCT KCRLQFLTCK EKMDHKTQHH RTFVKPKQLE GLPPGTKVTI RASVGPLQSG 

       550        560        570        580        590        600 
SSVTPSISPS TSTLQLSPPE PDNVTAKNHV KLTTSTPNTT ISDPSKANET KSNGSKSKNK 

       610        620        630        640        650        660 
SKVSNMQKKQ STLSSSNKKS KVNTALRNLR LRRGVHECIE CSSEVKDFAN HFPTYVHCSF 

       670        680        690        700        710        720 
CRYNTSCSKA YVNHMMSFHS NRPSKRYCIF KKHSENLRGI SLVCLNCDFL TDVSGLDNMA 

       730        740        750        760        770        780 
THLSQHETHS CRVLVEQVSV CIPTSERLSE IKTEAPTKGQ EPVSKETARH SRAEGEPGAS 

       790        800        810        820        830        840 
HSGSKQDKVP SSEEGTGCDA SVCEAAAATH CEKDVTVSDT ENVSSSKNIL SHDPDVGTDT 

       850        860        870        880        890        900 
MEKEEKTHHA CQEMELKVDQ SSESTNPTEA ELSSETRQGL QLTSGDVGID QFLRQGDEPK 

       910        920        930        940        950        960 
SVNSDASDPG SVRLEPLTPS EVLEYEATEI LHDGDDPSAN TSDTVSDQTG GSPGGSNPCR 

       970 
AETAVDLADG EERS 

« Hide

Isoform 2 [UniParc].

Checksum: 4DDB27FA5E458020
Show »

FASTA78788,431
Isoform 3 [UniParc].

Checksum: 8365D1F65555F34A
Show »

FASTA51458,512

References

[1]"The transcriptional landscape of the mammalian genome."
Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. expand/collapse author list , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3).
Strain: C57BL/6J and NOD.
Tissue: Spleen.
[2]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Strain: C57BL/6.
Tissue: Brain.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AK045173 mRNA. Translation: BAC32247.1.
AK172652 mRNA. Translation: BAE43113.1.
BC079878 mRNA. Translation: AAH79878.1.
CCDSCCDS40683.1. [Q68FE8-1]
RefSeqNP_666336.3. NM_146224.4. [Q68FE8-1]
XP_006511183.1. XM_006511120.1. [Q68FE8-2]
UniGeneMm.242791.

3D structure databases

ProteinModelPortalQ68FE8.
SMRQ68FE8. Positions 241-275, 326-461, 480-520.
ModBaseSearch...
MobiDBSearch...

PTM databases

PhosphoSiteQ68FE8.

Proteomic databases

MaxQBQ68FE8.
PaxDbQ68FE8.
PRIDEQ68FE8.

Protocols and materials databases

DNASU235469.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENSMUST00000098576; ENSMUSP00000096175; ENSMUSG00000038535. [Q68FE8-1]
ENSMUST00000184517; ENSMUSP00000138970; ENSMUSG00000038535. [Q68FE8-2]
GeneID235469.
KEGGmmu:235469.
UCSCuc009qpo.1. mouse. [Q68FE8-2]
uc009qpp.1. mouse. [Q68FE8-3]
uc009qpq.1. mouse. [Q68FE8-1]

Organism-specific databases

CTD235469.
MGIMGI:2384583. Zfp280d.

Phylogenomic databases

eggNOGNOG239493.
GeneTreeENSGT00530000063300.
HOGENOMHOG000013047.
HOVERGENHBG060885.
InParanoidQ68FE8.
OMAHYQGGPT.
OrthoDBEOG7QVM24.
PhylomeDBQ68FE8.
TreeFamTF331707.

Gene expression databases

BgeeQ68FE8.
GenevestigatorQ68FE8.

Family and domain databases

InterProIPR025243. DUF4195.
IPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
[Graphical view]
PfamPF13836. DUF4195. 1 hit.
[Graphical view]
SMARTSM00355. ZnF_C2H2. 9 hits.
[Graphical view]
PROSITEPS00028. ZINC_FINGER_C2H2_1. 5 hits.
PS50157. ZINC_FINGER_C2H2_2. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSZNF280D. mouse.
NextBio382698.
PROQ68FE8.
SOURCESearch...

Entry information

Entry nameZ280D_MOUSE
AccessionPrimary (citable) accession number: Q68FE8
Secondary accession number(s): Q3T9B1, Q8BI82
Entry history
Integrated into UniProtKB/Swiss-Prot: March 21, 2006
Last sequence update: October 11, 2004
Last modified: July 9, 2014
This is version 86 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Relevant documents

SIMILARITY comments

Index of protein domains and families

MGD cross-references

Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot