SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q68FE8

- Z280D_MOUSE

UniProt

Q68FE8 - Z280D_MOUSE

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Zinc finger protein 280D
Gene
Znf280d, Suhw4, Zfp280d
Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 3 out of 5 - Experimental evidence at transcript leveli

Functioni

May function as a transcription factor.

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri333 – 35523C2H2-type 1
Add
BLAST
Zinc fingeri370 – 39324C2H2-type 2
Add
BLAST
Zinc fingeri400 – 42425C2H2-type 3; degenerate
Add
BLAST
Zinc fingeri430 – 45324C2H2-type 4
Add
BLAST
Zinc fingeri459 – 48123C2H2-type 5
Add
BLAST

GO - Molecular functioni

  1. DNA binding Source: UniProtKB-KW
  2. metal ion binding Source: UniProtKB-KW

GO - Biological processi

  1. regulation of transcription, DNA-templated Source: UniProtKB-KW
  2. transcription, DNA-templated Source: UniProtKB-KW
Complete GO annotation...

Keywords - Biological processi

Transcription, Transcription regulation

Keywords - Ligandi

DNA-binding, Metal-binding, Zinc

Names & Taxonomyi

Protein namesi
Recommended name:
Zinc finger protein 280D
Alternative name(s):
Suppressor of hairy wing homolog 4
Gene namesi
Name:Znf280d
Synonyms:Suhw4, Zfp280d
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589: Chromosome 9

Organism-specific databases

MGIiMGI:2384583. Zfp280d.

Subcellular locationi

Nucleus Reviewed prediction

GO - Cellular componenti

  1. nucleus Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 974974Zinc finger protein 280D
PRO_0000227978Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei557 – 5571Phosphoserine By similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ68FE8.
PaxDbiQ68FE8.
PRIDEiQ68FE8.

PTM databases

PhosphoSiteiQ68FE8.

Expressioni

Gene expression databases

BgeeiQ68FE8.
GenevestigatoriQ68FE8.

Structurei

3D structure databases

ProteinModelPortaliQ68FE8.
SMRiQ68FE8. Positions 241-275, 326-461, 480-520.

Family & Domainsi

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi32 – 398Poly-Glu

Sequence similaritiesi

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

eggNOGiNOG239493.
GeneTreeiENSGT00530000063300.
HOGENOMiHOG000013047.
HOVERGENiHBG060885.
InParanoidiQ68FE8.
OMAiHYQGGPT.
OrthoDBiEOG7QVM24.
PhylomeDBiQ68FE8.
TreeFamiTF331707.

Family and domain databases

InterProiIPR025243. DUF4195.
IPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
[Graphical view]
PfamiPF13836. DUF4195. 1 hit.
[Graphical view]
SMARTiSM00355. ZnF_C2H2. 9 hits.
[Graphical view]
PROSITEiPS00028. ZINC_FINGER_C2H2_1. 5 hits.
PS50157. ZINC_FINGER_C2H2_2. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q68FE8-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MVTTYIKSDL QLDGRQFFQP KDNLKMAELF MECEEEELEP WQKKVKEVEE    50
DDDDEPIFVA EIASSKPAIS NILNRVNPSS HSRGIKNGIL NRGFTASFKP 100
TSQRCLNSAS NPVAALPVNF HPESRSSDSS VIVQPFSKPG YVTNSPRVLS 150
NNSSELLFDL TQDTGLSHYQ GGPTLSIAGL NETSFLSKRP SGSDISSVNP 200
KKPKPSENTS GIDASSVISS EKSPSVISLQ VVPSQGANCS SSQSKNGTTF 250
PRACPKCDIH FNLLDPLKNH MTYCCPDMIN NFLGLTKADN LNSANEAKTL 300
ESEKGKLIML VNDFYYGKHE GDVLEEQKTH TTFKCFSCLK VLKNNIRFMN 350
HMKHHLELEK QSSESWEKHT TCQHCYRQFP TPFQLQCHIE STHTPHEFST 400
ICKICELSFE TEQILLQHMK DNHKPGEMPY ICQVCNYRSS LFSEVESHFR 450
TSHENTKNLL CPFCLKVIKI ATPYMHHYMK HQKKGIHRCT KCRLQFLTCK 500
EKMDHKTQHH RTFVKPKQLE GLPPGTKVTI RASVGPLQSG SSVTPSISPS 550
TSTLQLSPPE PDNVTAKNHV KLTTSTPNTT ISDPSKANET KSNGSKSKNK 600
SKVSNMQKKQ STLSSSNKKS KVNTALRNLR LRRGVHECIE CSSEVKDFAN 650
HFPTYVHCSF CRYNTSCSKA YVNHMMSFHS NRPSKRYCIF KKHSENLRGI 700
SLVCLNCDFL TDVSGLDNMA THLSQHETHS CRVLVEQVSV CIPTSERLSE 750
IKTEAPTKGQ EPVSKETARH SRAEGEPGAS HSGSKQDKVP SSEEGTGCDA 800
SVCEAAAATH CEKDVTVSDT ENVSSSKNIL SHDPDVGTDT MEKEEKTHHA 850
CQEMELKVDQ SSESTNPTEA ELSSETRQGL QLTSGDVGID QFLRQGDEPK 900
SVNSDASDPG SVRLEPLTPS EVLEYEATEI LHDGDDPSAN TSDTVSDQTG 950
GSPGGSNPCR AETAVDLADG EERS 974
Length:974
Mass (Da):107,836
Last modified:October 11, 2004 - v1
Checksum:i1207D9ADBE551229
GO
Isoform 2 (identifier: Q68FE8-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     751-787: IKTEAPTKGQEPVSKETARHSRAEGEPGASHSGSKQD → CRSSPEISKHVQGVPGQCPLRWTQVLPVLSFPGMRMN
     788-974: Missing.

Note: No experimental confirmation available.

Show »
Length:787
Mass (Da):88,431
Checksum:i4DDB27FA5E458020
GO
Isoform 3 (identifier: Q68FE8-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-270: Missing.
     784-784: S → R
     785-974: Missing.

Note: No experimental confirmation available.

Show »
Length:514
Mass (Da):58,512
Checksum:i8365D1F65555F34A
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 270270Missing in isoform 3.
VSP_017629Add
BLAST
Alternative sequencei751 – 78737IKTEA…GSKQD → CRSSPEISKHVQGVPGQCPL RWTQVLPVLSFPGMRMN in isoform 2.
VSP_017630Add
BLAST
Alternative sequencei784 – 7841S → R in isoform 3.
VSP_017631
Alternative sequencei785 – 974190Missing in isoform 3.
VSP_017632Add
BLAST
Alternative sequencei788 – 974187Missing in isoform 2.
VSP_017633Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AK045173 mRNA. Translation: BAC32247.1.
AK172652 mRNA. Translation: BAE43113.1.
BC079878 mRNA. Translation: AAH79878.1.
CCDSiCCDS40683.1. [Q68FE8-1]
RefSeqiNP_666336.3. NM_146224.4. [Q68FE8-1]
XP_006511183.1. XM_006511120.1. [Q68FE8-2]
UniGeneiMm.242791.

Genome annotation databases

EnsembliENSMUST00000098576; ENSMUSP00000096175; ENSMUSG00000038535. [Q68FE8-1]
ENSMUST00000184517; ENSMUSP00000138970; ENSMUSG00000038535. [Q68FE8-2]
GeneIDi235469.
KEGGimmu:235469.
UCSCiuc009qpo.1. mouse. [Q68FE8-2]
uc009qpp.1. mouse. [Q68FE8-3]
uc009qpq.1. mouse. [Q68FE8-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AK045173 mRNA. Translation: BAC32247.1 .
AK172652 mRNA. Translation: BAE43113.1 .
BC079878 mRNA. Translation: AAH79878.1 .
CCDSi CCDS40683.1. [Q68FE8-1 ]
RefSeqi NP_666336.3. NM_146224.4. [Q68FE8-1 ]
XP_006511183.1. XM_006511120.1. [Q68FE8-2 ]
UniGenei Mm.242791.

3D structure databases

ProteinModelPortali Q68FE8.
SMRi Q68FE8. Positions 241-275, 326-461, 480-520.
ModBasei Search...
MobiDBi Search...

PTM databases

PhosphoSitei Q68FE8.

Proteomic databases

MaxQBi Q68FE8.
PaxDbi Q68FE8.
PRIDEi Q68FE8.

Protocols and materials databases

DNASUi 235469.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENSMUST00000098576 ; ENSMUSP00000096175 ; ENSMUSG00000038535 . [Q68FE8-1 ]
ENSMUST00000184517 ; ENSMUSP00000138970 ; ENSMUSG00000038535 . [Q68FE8-2 ]
GeneIDi 235469.
KEGGi mmu:235469.
UCSCi uc009qpo.1. mouse. [Q68FE8-2 ]
uc009qpp.1. mouse. [Q68FE8-3 ]
uc009qpq.1. mouse. [Q68FE8-1 ]

Organism-specific databases

CTDi 235469.
MGIi MGI:2384583. Zfp280d.

Phylogenomic databases

eggNOGi NOG239493.
GeneTreei ENSGT00530000063300.
HOGENOMi HOG000013047.
HOVERGENi HBG060885.
InParanoidi Q68FE8.
OMAi HYQGGPT.
OrthoDBi EOG7QVM24.
PhylomeDBi Q68FE8.
TreeFami TF331707.

Miscellaneous databases

ChiTaRSi ZNF280D. mouse.
NextBioi 382698.
PROi Q68FE8.
SOURCEi Search...

Gene expression databases

Bgeei Q68FE8.
Genevestigatori Q68FE8.

Family and domain databases

InterProi IPR025243. DUF4195.
IPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
[Graphical view ]
Pfami PF13836. DUF4195. 1 hit.
[Graphical view ]
SMARTi SM00355. ZnF_C2H2. 9 hits.
[Graphical view ]
PROSITEi PS00028. ZINC_FINGER_C2H2_1. 5 hits.
PS50157. ZINC_FINGER_C2H2_2. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

  1. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3).
    Strain: C57BL/6J and NOD.
    Tissue: Spleen.
  2. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Strain: C57BL/6.
    Tissue: Brain.

Entry informationi

Entry nameiZ280D_MOUSE
AccessioniPrimary (citable) accession number: Q68FE8
Secondary accession number(s): Q3T9B1, Q8BI82
Entry historyi
Integrated into UniProtKB/Swiss-Prot: March 21, 2006
Last sequence update: October 11, 2004
Last modified: July 9, 2014
This is version 86 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi