Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Integrator complex subunit 3

Gene

INTS3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Component of the Integrator complex. The Integrator complex is involved in the small nuclear RNAs (snRNA) U1 and U2 transcription and in their 3'-box-dependent processing. The Integrator complex is associated with the C-terminal domain (CTD) of RNA polymerase II largest subunit (POLR2A) and is recruited to the U1 and U2 snRNAs genes.
Component of the SOSS complex, a multiprotein complex that functions downstream of the MRN complex to promote DNA repair and G2/M checkpoint. The SOSS complex associates with single-stranded DNA at DNA lesions and influences diverse endpoints in the cellular DNA damage response including cell-cycle checkpoint activation, recombinational repair and maintenance of genomic stability. The SOSS complex is required for efficient homologous recombination-dependent repair of double-strand breaks (DSBs) and ATM-dependent signaling pathways. In the SOSS complex, it is required for the assembly of the complex and for stabilization of the complex at DNA damage sites.

GO - Biological processi

  • cellular response to DNA damage stimulus Source: UniProtKB
  • DNA repair Source: UniProtKB
  • mitotic cell cycle checkpoint Source: UniProtKB
  • response to ionizing radiation Source: UniProtKB
  • snRNA processing Source: HGNC
  • snRNA transcription from RNA polymerase II promoter Source: Reactome
Complete GO annotation...

Keywords - Biological processi

DNA damage, DNA repair

Enzyme and pathway databases

ReactomeiR-HSA-6807505. RNA polymerase II transcribes snRNA genes.

Names & Taxonomyi

Protein namesi
Recommended name:
Integrator complex subunit 3
Short name:
Int3
Alternative name(s):
SOSS complex subunit A
Sensor of single-strand DNA complex subunit A
Short name:
SOSS-A
Short name:
Sensor of ssDNA subunit A
Gene namesi
Name:INTS3
Synonyms:C1orf193, C1orf60
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

HGNCiHGNC:26153. INTS3.

Subcellular locationi

GO - Cellular componenti

  • integrator complex Source: HGNC
  • nucleoplasm Source: Reactome
  • nucleus Source: UniProtKB
  • SOSS complex Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi65123.
OpenTargetsiENSG00000143624.
ENSG00000262826.
PharmGKBiPA142672510.

Polymorphism and mutation databases

BioMutaiINTS3.
DMDMi74724494.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002595341 – 1043Integrator complex subunit 3Add BLAST1043

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei1N-acetylmethionineCombined sources1
Modified residuei502PhosphoserineCombined sources1
Modified residuei537PhosphoserineCombined sources1
Modified residuei995PhosphoserineCombined sources1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

EPDiQ68E01.
MaxQBiQ68E01.
PaxDbiQ68E01.
PeptideAtlasiQ68E01.
PRIDEiQ68E01.

PTM databases

iPTMnetiQ68E01.
PhosphoSitePlusiQ68E01.

Expressioni

Gene expression databases

BgeeiENSG00000143624.
ExpressionAtlasiQ68E01. baseline and differential.
GenevisibleiQ68E01. HS.

Interactioni

Subunit structurei

Belongs to the multiprotein complex Integrator, at least composed of INTS1, INTS2, INTS3, INTS4, INTS5, INTS6, INTS7, INTS8, INTS9/RC74, INTS10, CPSF3L/INTS11 and INTS12. Component of the SOSS complex, composed of SOSS-B (SOSS-B1/NABP2 or SOSS-B2/NABP1), SOSS-A/INTS3 and SOSS-C/INIP. SOSS complexes containing SOSS-B1/NABP2 are more abundant than complexes containing SOSS-B2/NABP1. Interacts with SOSS-B1/NABP2, SOSS-B2/NABP1 and SOSS-C/INIP; the interaction is direct. Interacts with NBN/NBS1.3 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
INIPQ9NRY26EBI-2680854,EBI-2881520
NABP1Q96AH05EBI-2680854,EBI-2889252
NABP2Q9BQ157EBI-2680854,EBI-2120336
NBNO609342EBI-2680854,EBI-494844
ZBTB14O438293EBI-2680854,EBI-10176632

Protein-protein interaction databases

BioGridi122401. 62 interactors.
IntActiQ68E01. 18 interactors.
MINTiMINT-4534920.
STRINGi9606.ENSP00000318641.

Structurei

Secondary structure

11043
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi35 – 37Combined sources3
Beta strandi41 – 43Combined sources3
Helixi47 – 63Combined sources17
Helixi69 – 79Combined sources11
Helixi83 – 99Combined sources17
Turni101 – 103Combined sources3
Helixi104 – 114Combined sources11
Helixi120 – 132Combined sources13
Helixi134 – 136Combined sources3
Helixi139 – 154Combined sources16
Helixi160 – 169Combined sources10
Helixi179 – 194Combined sources16
Helixi196 – 199Combined sources4
Helixi203 – 217Combined sources15
Helixi224 – 243Combined sources20
Helixi245 – 248Combined sources4
Helixi249 – 251Combined sources3
Helixi253 – 261Combined sources9
Turni262 – 264Combined sources3
Helixi266 – 277Combined sources12
Helixi279 – 282Combined sources4
Helixi289 – 293Combined sources5
Helixi299 – 304Combined sources6
Helixi308 – 317Combined sources10
Beta strandi320 – 322Combined sources3
Helixi327 – 337Combined sources11
Beta strandi338 – 341Combined sources4
Helixi342 – 345Combined sources4
Helixi346 – 356Combined sources11
Helixi362 – 366Combined sources5
Beta strandi367 – 369Combined sources3
Helixi372 – 381Combined sources10
Helixi386 – 396Combined sources11
Turni397 – 402Combined sources6
Turni405 – 407Combined sources3
Helixi410 – 423Combined sources14
Turni424 – 426Combined sources3
Helixi428 – 444Combined sources17
Helixi447 – 449Combined sources3
Helixi450 – 466Combined sources17
Beta strandi469 – 471Combined sources3
Helixi474 – 477Combined sources4
Helixi484 – 493Combined sources10
Helixi495 – 497Combined sources3

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
4OWTX-ray2.00A35-499[»]
4OWWX-ray2.30A1-501[»]
4OWXX-ray2.30A1-501[»]
ProteinModelPortaliQ68E01.
SMRiQ68E01.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi9 – 34Ala/Gly-richAdd BLAST26

Sequence similaritiesi

Belongs to the Integrator subunit 3 family.Curated

Phylogenomic databases

eggNOGiKOG4262. Eukaryota.
ENOG410XRCW. LUCA.
GeneTreeiENSGT00390000014184.
HOVERGENiHBG081800.
InParanoidiQ68E01.
KOiK13140.
OMAiTWQLFLA.
OrthoDBiEOG091G02QS.
PhylomeDBiQ68E01.
TreeFamiTF323623.

Family and domain databases

InterProiIPR019333. Int_cplx_su3.
[Graphical view]
PfamiPF10189. Ints3. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q68E01-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MELQKGKGAA AAAAASGAAG GGGGGAGAGA PGGGRLLLST SLDAKDELEE
60 70 80 90 100
RLERCMSIVT SMTAGVSERE ANDALNAYVC KGLPQHEEIC LGLFTLILTE
110 120 130 140 150
PAQAQKCYRD LALVSRDGMN IVLNKINQIL MEKYLKLQDT CRTQLVWLVR
160 170 180 190 200
ELVKSGVLGA DGVCMTFMKQ IAGGGDVTAK NIWLAESVLD ILTEQREWVL
210 220 230 240 250
KSSILIAMAV YTYLRLIVDH HGTAQLQALR QKEVDFCISL LRERFMECLM
260 270 280 290 300
IGRDLVRLLQ NVARIPEFEL LWKDIIHNPQ ALSPQFTGIL QLLQSRTSRK
310 320 330 340 350
FLACRLTPDM ETKLLFMTSR VRFGQQKRYQ DWFQRQYLST PDSQSLRCDL
360 370 380 390 400
IRYICGVVHP SNEVLSSDIL PRWAIIGWLL TTCTSNVAAS NAKLALFYDW
410 420 430 440 450
LFFSPDKDSI MNIEPAILVM HHSMKPHPAI TATLLDFMCR IIPNFYPPLE
460 470 480 490 500
GHVRQGVFSS LNHIVEKRVL AHLAPLFDNP KLDKELRAML REKFPEFCSS
510 520 530 540 550
PSPPVEVKIE EPVSMEMDNH MSDKDESCYD NAEAAFSDDE EDLNSKGKKR
560 570 580 590 600
EFRFHPIKET VVEEPVDITP YLDQLDESLR DKVLQLQKGS DTEAQCEVMQ
610 620 630 640 650
EIVDQVLEED FDSEQLSVLA SCLQELFKAH FRGEVLPEEI TEESLEESVG
660 670 680 690 700
KPLYLIFRNL CQMQEDNSSF SLLLDLLSEL YQKQPKIGYH LLYYLRASKA
710 720 730 740 750
AAGKMNLYES FAQATQLGDL HTCLMMDMKA CQEDDVRLLC HLTPSIYTEF
760 770 780 790 800
PDETLRSGEL LNMIVAVIDS AQLQELVCHV MMGNLVMFRK DSVLNILIQS
810 820 830 840 850
LDWETFEQYC AWQLFLAHNI PLETIIPILQ HLKYKEHPEA LSCLLLQLRR
860 870 880 890 900
EKPSEEMVKM VLSRPCHPDD QFTTSILRHW CMKHDELLAE HIKSLLIKNN
910 920 930 940 950
SLPRKRQSLR SSSSKLAQLT LEQILEHLDN LRLNLTNTKQ NFFSQTPILQ
960 970 980 990 1000
ALQHVQASCD EAHKMKFSDL FSLAEEYEDS STKPPKSRRK AALSSPRSRK
1010 1020 1030 1040
NATQPPNAEE ESGSSSASEE EDTKPKPTKR KRKGSSAVGS DSD
Length:1,043
Mass (Da):118,070
Last modified:October 11, 2004 - v1
Checksum:i66A49C646077C3F4
GO
Isoform 2 (identifier: Q68E01-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     173-173: Missing.

Show »
Length:1,042
Mass (Da):118,013
Checksum:i51F57DCE22F577C9
GO
Isoform 3 (identifier: Q68E01-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-207: Missing.
     942-942: F → CMPSTLGVQCRRCCPGPDYAWSQAGGRGRTPGATTHTRDKTTCACCLISSQTSDCFSFPALPFLPLV

Note: No experimental confirmation available.
Show »
Length:902
Mass (Da):103,152
Checksum:i369B918545703C6B
GO
Isoform 4 (identifier: Q68E01-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-488: Missing.

Note: No experimental confirmation available.
Show »
Length:555
Mass (Da):63,586
Checksum:i41F78C0B7C259B51
GO

Sequence cautioni

The sequence AAH25254 differs from that shown. Reason: Erroneous initiation.Curated
The sequence AAH54513 differs from that shown. Reason: Erroneous initiation.Curated
The sequence BAB15174 differs from that shown. Reason: Erroneous initiation.Curated
The sequence BAC11329 differs from that shown. Reason: Erroneous initiation.Curated
The sequence CAH18229 differs from that shown. Intron retention.Curated
The sequence CAH71415 differs from that shown. Reason: Erroneous gene model prediction.Curated
The sequence CAH71417 differs from that shown. Reason: Erroneous gene model prediction.Curated
The sequence CAH71418 differs from that shown. Reason: Erroneous gene model prediction.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti134Y → C in CAE45974 (PubMed:17974005).Curated1
Sequence conflicti300K → E in BAF82714 (PubMed:14702039).Curated1
Sequence conflicti363E → G in CAE45974 (PubMed:17974005).Curated1
Sequence conflicti685P → T in CAE45974 (PubMed:17974005).Curated1
Sequence conflicti803W → R in CAE45876 (PubMed:17974005).Curated1
Sequence conflicti827P → L in BAC11329 (PubMed:14702039).Curated1
Sequence conflicti896L → P in BAG60890 (PubMed:14702039).Curated1
Sequence conflicti952L → P in BAG65611 (PubMed:14702039).Curated1
Sequence conflicti967F → L in CAE45876 (PubMed:17974005).Curated1
Sequence conflicti972S → P in BAB15174 (PubMed:14702039).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0381301 – 488Missing in isoform 4. 1 PublicationAdd BLAST488
Alternative sequenceiVSP_0381311 – 207Missing in isoform 3. 1 PublicationAdd BLAST207
Alternative sequenceiVSP_021446173Missing in isoform 2. 3 Publications1
Alternative sequenceiVSP_038132942F → CMPSTLGVQCRRCCPGPDYA WSQAGGRGRTPGATTHTRDK TTCACCLISSQTSDCFSFPA LPFLPLV in isoform 3. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AL832133 mRNA. Translation: CAH10398.1.
AK290025 mRNA. Translation: BAF82714.1.
AK298746 mRNA. Translation: BAG60890.1.
AK304874 mRNA. Translation: BAG65611.1.
BX640786 mRNA. Translation: CAE45876.1.
BX640950 mRNA. Translation: CAE45974.1.
CR627233 mRNA. Translation: CAH10366.1.
CR749212 mRNA. Translation: CAH18069.1.
CR749376 mRNA. Translation: CAH18229.1. Sequence problems.
AL513523 Genomic DNA. Translation: CAH71415.1. Sequence problems.
AL513523 Genomic DNA. Translation: CAH71416.1.
AL513523 Genomic DNA. Translation: CAH71417.1. Sequence problems.
AL513523 Genomic DNA. Translation: CAH71418.1. Sequence problems.
CH471121 Genomic DNA. Translation: EAW53279.1.
CH471121 Genomic DNA. Translation: EAW53283.1.
BC025254 mRNA. Translation: AAH25254.1. Different initiation.
BC054513 mRNA. Translation: AAH54513.1. Different initiation.
BC073985 mRNA. Translation: AAH73985.1.
BC098431 mRNA. Translation: AAH98431.1.
BC105092 mRNA. Translation: AAI05093.1.
BC105094 mRNA. Translation: AAI05095.1.
BC116458 mRNA. Translation: AAI16459.1.
AK025572 mRNA. Translation: BAB15174.1. Different initiation.
AK074979 mRNA. Translation: BAC11329.1. Different initiation.
BK005722 Genomic DNA. Translation: DAA05722.1.
CCDSiCCDS1052.1. [Q68E01-2]
RefSeqiNP_001311404.1. NM_001324475.1. [Q68E01-2]
NP_075391.3. NM_023015.4. [Q68E01-2]
XP_005245518.1. XM_005245461.2. [Q68E01-4]
UniGeneiHs.438723.
Hs.516522.

Genome annotation databases

EnsembliENST00000318967; ENSP00000318641; ENSG00000143624. [Q68E01-2]
ENST00000435409; ENSP00000404290; ENSG00000143624. [Q68E01-2]
ENST00000512605; ENSP00000425437; ENSG00000143624. [Q68E01-3]
ENST00000571768; ENSP00000458631; ENSG00000262826. [Q68E01-2]
ENST00000576030; ENSP00000460221; ENSG00000262826. [Q68E01-2]
ENST00000576422; ENSP00000459907; ENSG00000262826. [Q68E01-3]
GeneIDi65123.
KEGGihsa:65123.
UCSCiuc001fct.4. human. [Q68E01-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AL832133 mRNA. Translation: CAH10398.1.
AK290025 mRNA. Translation: BAF82714.1.
AK298746 mRNA. Translation: BAG60890.1.
AK304874 mRNA. Translation: BAG65611.1.
BX640786 mRNA. Translation: CAE45876.1.
BX640950 mRNA. Translation: CAE45974.1.
CR627233 mRNA. Translation: CAH10366.1.
CR749212 mRNA. Translation: CAH18069.1.
CR749376 mRNA. Translation: CAH18229.1. Sequence problems.
AL513523 Genomic DNA. Translation: CAH71415.1. Sequence problems.
AL513523 Genomic DNA. Translation: CAH71416.1.
AL513523 Genomic DNA. Translation: CAH71417.1. Sequence problems.
AL513523 Genomic DNA. Translation: CAH71418.1. Sequence problems.
CH471121 Genomic DNA. Translation: EAW53279.1.
CH471121 Genomic DNA. Translation: EAW53283.1.
BC025254 mRNA. Translation: AAH25254.1. Different initiation.
BC054513 mRNA. Translation: AAH54513.1. Different initiation.
BC073985 mRNA. Translation: AAH73985.1.
BC098431 mRNA. Translation: AAH98431.1.
BC105092 mRNA. Translation: AAI05093.1.
BC105094 mRNA. Translation: AAI05095.1.
BC116458 mRNA. Translation: AAI16459.1.
AK025572 mRNA. Translation: BAB15174.1. Different initiation.
AK074979 mRNA. Translation: BAC11329.1. Different initiation.
BK005722 Genomic DNA. Translation: DAA05722.1.
CCDSiCCDS1052.1. [Q68E01-2]
RefSeqiNP_001311404.1. NM_001324475.1. [Q68E01-2]
NP_075391.3. NM_023015.4. [Q68E01-2]
XP_005245518.1. XM_005245461.2. [Q68E01-4]
UniGeneiHs.438723.
Hs.516522.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
4OWTX-ray2.00A35-499[»]
4OWWX-ray2.30A1-501[»]
4OWXX-ray2.30A1-501[»]
ProteinModelPortaliQ68E01.
SMRiQ68E01.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi122401. 62 interactors.
IntActiQ68E01. 18 interactors.
MINTiMINT-4534920.
STRINGi9606.ENSP00000318641.

PTM databases

iPTMnetiQ68E01.
PhosphoSitePlusiQ68E01.

Polymorphism and mutation databases

BioMutaiINTS3.
DMDMi74724494.

Proteomic databases

EPDiQ68E01.
MaxQBiQ68E01.
PaxDbiQ68E01.
PeptideAtlasiQ68E01.
PRIDEiQ68E01.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000318967; ENSP00000318641; ENSG00000143624. [Q68E01-2]
ENST00000435409; ENSP00000404290; ENSG00000143624. [Q68E01-2]
ENST00000512605; ENSP00000425437; ENSG00000143624. [Q68E01-3]
ENST00000571768; ENSP00000458631; ENSG00000262826. [Q68E01-2]
ENST00000576030; ENSP00000460221; ENSG00000262826. [Q68E01-2]
ENST00000576422; ENSP00000459907; ENSG00000262826. [Q68E01-3]
GeneIDi65123.
KEGGihsa:65123.
UCSCiuc001fct.4. human. [Q68E01-1]

Organism-specific databases

CTDi65123.
DisGeNETi65123.
GeneCardsiINTS3.
H-InvDBHIX0001090.
HGNCiHGNC:26153. INTS3.
MIMi611347. gene.
neXtProtiNX_Q68E01.
OpenTargetsiENSG00000143624.
ENSG00000262826.
PharmGKBiPA142672510.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG4262. Eukaryota.
ENOG410XRCW. LUCA.
GeneTreeiENSGT00390000014184.
HOVERGENiHBG081800.
InParanoidiQ68E01.
KOiK13140.
OMAiTWQLFLA.
OrthoDBiEOG091G02QS.
PhylomeDBiQ68E01.
TreeFamiTF323623.

Enzyme and pathway databases

ReactomeiR-HSA-6807505. RNA polymerase II transcribes snRNA genes.

Miscellaneous databases

ChiTaRSiINTS3. human.
GeneWikiiINTS3.
GenomeRNAii65123.
PROiQ68E01.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000143624.
ExpressionAtlasiQ68E01. baseline and differential.
GenevisibleiQ68E01. HS.

Family and domain databases

InterProiIPR019333. Int_cplx_su3.
[Graphical view]
PfamiPF10189. Ints3. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiINT3_HUMAN
AccessioniPrimary (citable) accession number: Q68E01
Secondary accession number(s): A8K1W0
, B4DQC8, B4E3U9, D3DV57, Q4G0E5, Q5VUQ5, Q5VUQ6, Q5VUR0, Q5VUR1, Q68DJ1, Q69YR5, Q6AI57, Q6DKG7, Q6MZQ4, Q6MZZ9, Q8NC46, Q8TB23, Q9H6S9
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 31, 2006
Last sequence update: October 11, 2004
Last modified: November 30, 2016
This is version 113 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.