Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Protein sel-1 homolog 3

Gene

SEL1L3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Names & Taxonomyi

Protein namesi
Recommended name:
Protein sel-1 homolog 3
Alternative name(s):
Suppressor of lin-12-like protein 3
Short name:
Sel-1L3
Gene namesi
Name:SEL1L3
Synonyms:KIAA0746
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 4

Organism-specific databases

HGNCiHGNC:29108. SEL1L3.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transmembranei1057 – 107721HelicalSequence analysisAdd
BLAST

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA165664479.

Polymorphism and mutation databases

BioMutaiSEL1L3.
DMDMi172045726.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 11321132Protein sel-1 homolog 3PRO_0000321894Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi201 – 2011N-linked (GlcNAc...)Sequence analysis
Glycosylationi382 – 3821N-linked (GlcNAc...)Sequence analysis
Glycosylationi527 – 5271N-linked (GlcNAc...)Sequence analysis
Modified residuei608 – 6081PhosphoserineCombined sources
Glycosylationi937 – 9371N-linked (GlcNAc...)Sequence analysis

Keywords - PTMi

Glycoprotein, Phosphoprotein

Proteomic databases

EPDiQ68CR1.
MaxQBiQ68CR1.
PaxDbiQ68CR1.
PeptideAtlasiQ68CR1.
PRIDEiQ68CR1.

PTM databases

iPTMnetiQ68CR1.
PhosphoSiteiQ68CR1.

Expressioni

Gene expression databases

BgeeiQ68CR1.
CleanExiHS_SERINC2.
ExpressionAtlasiQ68CR1. baseline and differential.
GenevisibleiQ68CR1. HS.

Organism-specific databases

HPAiHPA040045.
HPA058792.

Interactioni

Protein-protein interaction databases

BioGridi116836. 6 interactions.
IntActiQ68CR1. 1 interaction.
MINTiMINT-1413942.
STRINGi9606.ENSP00000382767.

Structurei

3D structure databases

ProteinModelPortaliQ68CR1.
SMRiQ68CR1. Positions 576-997.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Repeati575 – 60935Sel1-like 1Add
BLAST
Repeati611 – 64737Sel1-like 2Add
BLAST
Repeati694 – 73037Sel1-like 3Add
BLAST
Repeati732 – 76736Sel1-like 4Add
BLAST
Repeati768 – 80033Sel1-like 5Add
BLAST
Repeati801 – 83939Sel1-like 6Add
BLAST
Repeati840 – 87738Sel1-like 7Add
BLAST
Repeati952 – 98837Sel1-like 8Add
BLAST

Sequence similaritiesi

Contains 8 Sel1-like repeats.Curated

Keywords - Domaini

Repeat, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG1550. Eukaryota.
COG0790. LUCA.
GeneTreeiENSGT00530000063170.
HOGENOMiHOG000113157.
HOVERGENiHBG108021.
InParanoidiQ68CR1.
OMAiVDGLHQI.
OrthoDBiEOG7W6WJW.
PhylomeDBiQ68CR1.
TreeFamiTF315257.

Family and domain databases

Gene3Di1.25.40.10. 2 hits.
InterProiIPR013320. ConA-like_dom.
IPR006597. Sel1-like.
IPR011990. TPR-like_helical_dom.
[Graphical view]
PfamiPF08238. Sel1. 6 hits.
[Graphical view]
SMARTiSM00671. SEL1. 8 hits.
[Graphical view]
SUPFAMiSSF49899. SSF49899. 1 hit.

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q68CR1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MQRRGAGLGW PRQQQQQPPP LAVGPRAAAM VPSGGVPQGL GGRSACALLL
60 70 80 90 100
LCYLNVVPSL GRQTSLTTSV IPKAEQSVAY KDFIYFTVFE GNVRNVSEVS
110 120 130 140 150
VEYLCSQPCV VNLEAVVSSE FRSSIPVYKK RWKNEKHLHT SRTQIVHVKF
160 170 180 190 200
PSIMVYRDDY FIRHSISVSA VIVRAWITHK YSGRDWNVKW EENLLHAVAK
210 220 230 240 250
NYTLLQTIPP FERPFKDHQV CLEWNMGYIW NLRANRIPQC PLENDVVALL
260 270 280 290 300
GFPYASSGEN TGIVKKFPRF RNRELEATRR QRMDYPVFTV SLWLYLLHYC
310 320 330 340 350
KANLCGILYF VDSNEMYGTP SVFLTEEGYL HIQMHLVKGE DLAVKTKFII
360 370 380 390 400
PLKEWFRLDI SFNGGQIVVT TSIGQDLKSY HNQTISFRED FHYNDTAGYF
410 420 430 440 450
IIGGSRYVAG IEGFFGPLKY YRLRSLHPAQ IFNPLLEKQL AEQIKLYYER
460 470 480 490 500
CAEVQEIVSV YASAAKHGGE RQEACHLHNS YLDLQRRYGR PSMCRAFPWE
510 520 530 540 550
KELKDKHPSL FQALLEMDLL TVPRNQNESV SEIGGKIFEK AVKRLSSIDG
560 570 580 590 600
LHQISSIVPF LTDSSCCGYH KASYYLAVFY ETGLNVPRDQ LQGMLYSLVG
610 620 630 640 650
GQGSERLSSM NLGYKHYQGI DNYPLDWELS YAYYSNIATK TPLDQHTLQG
660 670 680 690 700
DQAYVETIRL KDDEILKVQT KEDGDVFMWL KHEATRGNAA AQQRLAQMLF
710 720 730 740 750
WGQQGVAKNP EAAIEWYAKG ALETEDPALI YDYAIVLFKG QGVKKNRRLA
760 770 780 790 800
LELMKKAASK GLHQAVNGLG WYYHKFKKNY AKAAKYWLKA EEMGNPDASY
810 820 830 840 850
NLGVLHLDGI FPGVPGRNQT LAGEYFHKAA QGGHMEGTLW CSLYYITGNL
860 870 880 890 900
ETFPRDPEKA VVWAKHVAEK NGYLGHVIRK GLNAYLEGSW HEALLYYVLA
910 920 930 940 950
AETGIEVSQT NLAHICEERP DLARRYLGVN CVWRYYNFSV FQIDAPSFAY
960 970 980 990 1000
LKMGDLYYYG HQNQSQDLEL SVQMYAQAAL DGDSQGFFNL ALLIEEGTII
1010 1020 1030 1040 1050
PHHILDFLEI DSTLHSNNIS ILQELYERCW SHSNEESFSP CSLAWLYLHL
1060 1070 1080 1090 1100
RLLWGAILHS ALIYFLGTFL LSILIAWTVQ YFQSVSASDP PPRPSQASPD
1110 1120 1130
TATSTASPAV TPAADASDQD QPTVTNNPEP RG
Length:1,132
Mass (Da):128,567
Last modified:February 26, 2008 - v2
Checksum:iDC7C852EC88FE274
GO
Isoform 2 (identifier: Q68CR1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-53: MQRRGAGLGWPRQQQQQPPPLAVGPRAAAMVPSGGVPQGLGGRSACALLLLCY → MAPRPKKQPDKNPLHGRE

Note: No experimental confirmation available.
Show »
Length:1,097
Mass (Da):125,198
Checksum:i66C51F89DA7049E5
GO
Isoform 3 (identifier: Q68CR1-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-153: Missing.

Show »
Length:979
Mass (Da):111,762
Checksum:i5DE8F5A4CF1CFA3B
GO

Sequence cautioni

The sequence AAH29422.1 differs from that shown.Potential poly-A sequence.Curated
The sequence AAH60867.1 differs from that shown. Reason: Frameshift at position 65. Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti152 – 1521S → G in AAH60867 (PubMed:15489334).Curated
Sequence conflicti825 – 8251Y → I in AAH60867 (PubMed:15489334).Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti107 – 1071Q → R.
Corresponds to variant rs16877661 [ dbSNP | Ensembl ].
VAR_053965
Natural varianti401 – 4011I → V.
Corresponds to variant rs16877591 [ dbSNP | Ensembl ].
VAR_039369
Natural varianti554 – 5541I → V.
Corresponds to variant rs16877591 [ dbSNP | Ensembl ].
VAR_053966
Natural varianti1054 – 10541W → C.
Corresponds to variant rs2286866 [ dbSNP | Ensembl ].
VAR_053967
Natural varianti1122 – 11221P → S.
Corresponds to variant rs7671168 [ dbSNP | Ensembl ].
VAR_053968

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 153153Missing in isoform 3. 1 PublicationVSP_031811Add
BLAST
Alternative sequencei1 – 5353MQRRG…LLLCY → MAPRPKKQPDKNPLHGRE in isoform 2. 1 PublicationVSP_031812Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK289687 mRNA. Translation: BAF82376.1.
CR749817 mRNA. Translation: CAH18677.1.
AC092436 Genomic DNA. No translation available.
AC133961 Genomic DNA. No translation available.
CH471069 Genomic DNA. Translation: EAW92843.1.
BC009945 mRNA. Translation: AAH09945.2.
BC029422 mRNA. Translation: AAH29422.1. Sequence problems.
BC060867 mRNA. Translation: AAH60867.1. Frameshift.
AB018289 mRNA. Translation: BAA34466.1.
CCDSiCCDS47037.1. [Q68CR1-1]
CCDS75113.1. [Q68CR1-2]
CCDS77907.1. [Q68CR1-3]
RefSeqiNP_001284521.1. NM_001297592.1. [Q68CR1-2]
NP_001284523.1. NM_001297594.1. [Q68CR1-3]
NP_056002.2. NM_015187.4. [Q68CR1-1]
UniGeneiHs.479384.

Genome annotation databases

EnsembliENST00000264868; ENSP00000264868; ENSG00000091490. [Q68CR1-2]
ENST00000399878; ENSP00000382767; ENSG00000091490. [Q68CR1-1]
ENST00000502949; ENSP00000425438; ENSG00000091490. [Q68CR1-3]
GeneIDi23231.
KEGGihsa:23231.
UCSCiuc003gru.5. human. [Q68CR1-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK289687 mRNA. Translation: BAF82376.1.
CR749817 mRNA. Translation: CAH18677.1.
AC092436 Genomic DNA. No translation available.
AC133961 Genomic DNA. No translation available.
CH471069 Genomic DNA. Translation: EAW92843.1.
BC009945 mRNA. Translation: AAH09945.2.
BC029422 mRNA. Translation: AAH29422.1. Sequence problems.
BC060867 mRNA. Translation: AAH60867.1. Frameshift.
AB018289 mRNA. Translation: BAA34466.1.
CCDSiCCDS47037.1. [Q68CR1-1]
CCDS75113.1. [Q68CR1-2]
CCDS77907.1. [Q68CR1-3]
RefSeqiNP_001284521.1. NM_001297592.1. [Q68CR1-2]
NP_001284523.1. NM_001297594.1. [Q68CR1-3]
NP_056002.2. NM_015187.4. [Q68CR1-1]
UniGeneiHs.479384.

3D structure databases

ProteinModelPortaliQ68CR1.
SMRiQ68CR1. Positions 576-997.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi116836. 6 interactions.
IntActiQ68CR1. 1 interaction.
MINTiMINT-1413942.
STRINGi9606.ENSP00000382767.

PTM databases

iPTMnetiQ68CR1.
PhosphoSiteiQ68CR1.

Polymorphism and mutation databases

BioMutaiSEL1L3.
DMDMi172045726.

Proteomic databases

EPDiQ68CR1.
MaxQBiQ68CR1.
PaxDbiQ68CR1.
PeptideAtlasiQ68CR1.
PRIDEiQ68CR1.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000264868; ENSP00000264868; ENSG00000091490. [Q68CR1-2]
ENST00000399878; ENSP00000382767; ENSG00000091490. [Q68CR1-1]
ENST00000502949; ENSP00000425438; ENSG00000091490. [Q68CR1-3]
GeneIDi23231.
KEGGihsa:23231.
UCSCiuc003gru.5. human. [Q68CR1-1]

Organism-specific databases

CTDi23231.
GeneCardsiSEL1L3.
H-InvDBHIX0004145.
HGNCiHGNC:29108. SEL1L3.
HPAiHPA040045.
HPA058792.
neXtProtiNX_Q68CR1.
PharmGKBiPA165664479.
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1550. Eukaryota.
COG0790. LUCA.
GeneTreeiENSGT00530000063170.
HOGENOMiHOG000113157.
HOVERGENiHBG108021.
InParanoidiQ68CR1.
OMAiVDGLHQI.
OrthoDBiEOG7W6WJW.
PhylomeDBiQ68CR1.
TreeFamiTF315257.

Miscellaneous databases

ChiTaRSiSEL1L3. human.
GenomeRNAii23231.
PROiQ68CR1.

Gene expression databases

BgeeiQ68CR1.
CleanExiHS_SERINC2.
ExpressionAtlasiQ68CR1. baseline and differential.
GenevisibleiQ68CR1. HS.

Family and domain databases

Gene3Di1.25.40.10. 2 hits.
InterProiIPR013320. ConA-like_dom.
IPR006597. Sel1-like.
IPR011990. TPR-like_helical_dom.
[Graphical view]
PfamiPF08238. Sel1. 6 hits.
[Graphical view]
SMARTiSM00671. SEL1. 8 hits.
[Graphical view]
SUPFAMiSSF49899. SSF49899. 1 hit.
ProtoNetiSearch...

Publicationsi

  1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
    Tissue: Amygdala.
  2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Colon carcinoma.
  3. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
    Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
    , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
    Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 6-1132 (ISOFORM 1).
    Tissue: Muscle, Placenta and Prostate.
  6. "Prediction of the coding sequences of unidentified human genes. XI. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
    Nagase T., Ishikawa K., Suyama M., Kikuno R., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O.
    DNA Res. 5:277-286(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 104-1132 (ISOFORMS 1/2).
    Tissue: Brain.
  7. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-608, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.

Entry informationi

Entry nameiSE1L3_HUMAN
AccessioniPrimary (citable) accession number: Q68CR1
Secondary accession number(s): A0PJH6
, A8K0X2, O94847, Q6P999, Q96G59
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 26, 2008
Last sequence update: February 26, 2008
Last modified: July 6, 2016
This is version 93 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 4
    Human chromosome 4: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.