Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

NACHT, LRR and PYD domains-containing protein 9C

Gene

Nlrp9c

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at transcript leveli

Functioni

May be involved in inflammation.Curated

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Nucleotide bindingi149 – 156ATPPROSITE-ProRule annotation8

GO - Molecular functioni

GO - Biological processi

Keywordsi

Biological processImmunity, Inflammatory response, Innate immunity
LigandATP-binding, Nucleotide-binding

Names & Taxonomyi

Protein namesi
Recommended name:
NACHT, LRR and PYD domains-containing protein 9C
Alternative name(s):
NALP-zeta
Gene namesi
Name:Nlrp9c
Synonyms:Nalp9c
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 7

Organism-specific databases

MGIiMGI:3028627. Nlrp9c.

Subcellular locationi

Keywords - Cellular componenti

Cytoplasm

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002863371 – 1004NACHT, LRR and PYD domains-containing protein 9CAdd BLAST1004

Proteomic databases

PaxDbiQ66X01.
PRIDEiQ66X01.

Expressioni

Tissue specificityi

Oocyte specific.1 Publication

Gene expression databases

BgeeiENSMUSG00000040614.
CleanExiMM_NLRP9C.
GenevisibleiQ66X01. MM.

Interactioni

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000083106.

Structurei

3D structure databases

ProteinModelPortaliQ66X01.
SMRiQ66X01.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini1 – 92PyrinPROSITE-ProRule annotationAdd BLAST92
Domaini143 – 465NACHTPROSITE-ProRule annotationAdd BLAST323
Repeati750 – 770LRR 1Add BLAST21
Repeati779 – 800LRR 2Add BLAST22
Repeati807 – 828LRR 3Add BLAST22
Repeati836 – 857LRR 4Add BLAST22
Repeati864 – 884LRR 5Add BLAST21

Sequence similaritiesi

Belongs to the NLRP family.Curated

Keywords - Domaini

Leucine-rich repeat, Repeat

Phylogenomic databases

eggNOGiKOG4308. Eukaryota.
ENOG410ZBX3. LUCA.
GeneTreeiENSGT00900000140813.
HOGENOMiHOG000294064.
HOVERGENiHBG063656.
InParanoidiQ66X01.
OMAiMFRISTE.
OrthoDBiEOG091G01CG.
PhylomeDBiQ66X01.

Family and domain databases

InterProiView protein in InterPro
IPR004020. DAPIN.
IPR011029. DEATH-like_dom_sf.
IPR001611. Leu-rich_rpt.
IPR007111. NACHT_NTPase.
IPR027417. P-loop_NTPase.
PfamiView protein in Pfam
PF13516. LRR_6. 3 hits.
PF02758. PYRIN. 1 hit.
SMARTiView protein in SMART
SM01289. PYRIN. 1 hit.
SUPFAMiSSF47986. SSF47986. 1 hit.
SSF52540. SSF52540. 1 hit.
PROSITEiView protein in PROSITE
PS50824. DAPIN. 1 hit.
PS50837. NACHT. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q66X01-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MVDSSSYGLL QYFQKLSDEE FQRFKELLQK EQEKFKLKPL SWTKIKNTSK
60 70 80 90 100
EDLVTQLYTH YPRQVWDMVL NLFLQVNRKD LSTMAQIERR DKQNKYKEFM
110 120 130 140 150
KNLFQYIWTS ETNTYMPDRS YNTIIDRQYK ALLDIFDSES DPATAVVLGT
160 170 180 190 200
RGKGKTVFLR KAMLDWASGV LLQNRFQYVF FFSVFSLNNT TELSLAELIS
210 220 230 240 250
SKLPECSETL DDILSNPKRI LFVLDGFDYL KFDLELRTNL CNDWRKRLPT
260 270 280 290 300
QNVLSSLLQK IMLPECSLLL ELGESSCSKI IPLLQNPREI IMSGLSEQSI
310 320 330 340 350
YFYCVSFFKI QLGVEVFKDL KKNEPLFTLC SNPSMLWMIC SSLMWGHYSR
360 370 380 390 400
EEVISSSEST SAIHTIFIMS AFKSIFGLGS SKYKRFKLKT LCTLAVEGMW
410 420 430 440 450
KQVYVFDSED LRRNKISESD KTVWLKMKFL QIQGNNIMFY HSTLQWYFAT
460 470 480 490 500
LFYFLKQDKD TYHPVIGSLP QLLGEIYAHK QNQWTHAQTF FFGIATKHVI
510 520 530 540 550
TLLKPCFGNI SFKTIRQEII RYLKSLSQPE CNEKLVHPKK LFFCLIENQE
560 570 580 590 600
ERFVSQVMNL FEEITVDISD SDDLGAAEYS LLRASKLKNL HLHIQKKVFS
610 620 630 640 650
EIHDPEYGSL ENFKLDQKFS AINWTMLSIL FCNLHVLDLG SCHFNKKVIE
660 670 680 690 700
VLCNSLSPTP NMPLTVFKLQ RLLCSFMTNF GDGSLFCTFL QIPQLKYLNL
710 720 730 740 750
YGTDLSNDVV EMLCSALKCS TCRVEELLLG KCDISSEACG IMATFLINSK
760 770 780 790 800
VKHLSLVENP LKNKGVMFLC KMLKDPSCVL ESLMLSYCCL TFIACGHLYE
810 820 830 840 850
ALLSNKHLSL LDLGSNFLED IGVNLLCEAL KYPNCTLKEL WLPGCYLTSE
860 870 880 890 900
CCEEISAVLT CNKNLKTLKL GNNNIQDTGV KRLCEALCHP KCKVQCLGLD
910 920 930 940 950
MCELSNDCCE DLALALITCN TLKSLNLDWN ALHHSGLVML CEALNHKKCK
960 970 980 990 1000
LNMLGLDKSS FSEESQTFLQ AVEKKNNNLN VLHFPWVEDE LKKRGVRLVW

NSKN
Length:1,004
Mass (Da):115,722
Last modified:October 11, 2004 - v1
Checksum:i99ACBCE759C85F75
GO
Isoform 2 (identifier: Q66X01-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     619-673: Missing.
     843-899: Missing.
     956-1004: LDKSSFSEES...GVRLVWNSKN → QVTFIRTRINAVRLLVLRQQYHALKDQDPVIEE

Show »
Length:876
Mass (Da):101,444
Checksum:i70725FCEE9F44E71
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti479H → Y in BAE26430 (PubMed:16141072).Curated1
Sequence conflicti968F → S in BAE26430 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_025027619 – 673Missing in isoform 2. 1 PublicationAdd BLAST55
Alternative sequenceiVSP_025028843 – 899Missing in isoform 2. 1 PublicationAdd BLAST57
Alternative sequenceiVSP_025029956 – 1004LDKSS…WNSKN → QVTFIRTRINAVRLLVLRQQ YHALKDQDPVIEE in isoform 2. 1 PublicationAdd BLAST49

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY596203 mRNA. Translation: AAU06324.1.
AY360472 mRNA. Translation: AAQ64010.1.
AK145425 mRNA. Translation: BAE26430.1.
CCDSiCCDS39843.1. [Q66X01-1]
RefSeqiNP_001036077.1. NM_001042612.1. [Q66X01-1]
UniGeneiMm.212174.
Mm.487767.

Genome annotation databases

EnsembliENSMUST00000041845; ENSMUSP00000036041; ENSMUSG00000040614. [Q66X01-2]
ENSMUST00000085944; ENSMUSP00000083106; ENSMUSG00000040614. [Q66X01-1]
GeneIDi330490.
KEGGimmu:330490.
UCSCiuc009fuj.1. mouse. [Q66X01-1]
uc012fgb.2. mouse. [Q66X01-2]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiNLR9C_MOUSE
AccessioniPrimary (citable) accession number: Q66X01
Secondary accession number(s): Q3ULL8, Q6UTW8
Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 1, 2007
Last sequence update: October 11, 2004
Last modified: November 22, 2017
This is version 102 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families