Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Microtubule-associated protein 1S

Gene

MAP1S

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Microtubule-associated protein that mediates aggregation of mitochondria resulting in cell death and genomic destruction (MAGD). Plays a role in anchoring the microtubule organizing center to the centrosomes. Binds to DNA. Plays a role in apoptosis. Involved in the formation of microtubule bundles (By similarity).By similarity2 Publications

GO - Molecular functioni

  • actin filament binding Source: HGNC
  • beta-tubulin binding Source: HGNC
  • DNA binding Source: HGNC
  • microtubule binding Source: HGNC
  • tubulin binding Source: HGNC

GO - Biological processi

  • apoptotic process Source: UniProtKB-KW
  • autophagy Source: BHF-UCL
  • brain development Source: HGNC
  • microtubule bundle formation Source: HGNC
  • mitochondrion transport along microtubule Source: HGNC
  • nervous system development Source: HGNC
  • neuron projection morphogenesis Source: HGNC
  • regulation of chromatin disassembly Source: BHF-UCL
Complete GO annotation...

Keywords - Biological processi

Apoptosis

Keywords - Ligandi

DNA-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Microtubule-associated protein 1S
Short name:
MAP-1S
Alternative name(s):
BPY2-interacting protein 1
Microtubule-associated protein 8
Variable charge Y chromosome 2-interacting protein 1
Short name:
VCY2-interacting protein 1
Short name:
VCY2IP-1
Cleaved into the following 2 chains:
Gene namesi
Name:MAP1S
Synonyms:BPY2IP1, C19orf5, MAP8, VCY2IP1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 19

Organism-specific databases

HGNCiHGNC:15715. MAP1S.

Subcellular locationi

  • Nucleus
  • Cytoplasmcytosol
  • Cytoplasmcytoskeleton
  • Cytoplasmcytoskeletonspindle

  • Note: Detected in filopodia-like protrusions and synapses (By similarity). Detected in perinuclear punctate network corresponding to mitochondrial aggregates and in the nucleus in cells exhibiting apoptosis. Associated specifically with microtubules stabilized by paclitaxel and colocalizes with RASSF1 isoform A. In interphase cells, shows a diffuse cytoplasmic staining with partial localization to the microtubules. During the different stages of mitosis detected at the spindle microtubules.By similarity

GO - Cellular componenti

  • cell junction Source: HPA
  • cell projection Source: UniProtKB
  • cytoplasm Source: HPA
  • cytosol Source: HGNC
  • dendrite Source: HGNC
  • microtubule Source: UniProtKB
  • neuronal cell body Source: HGNC
  • nucleolus Source: HPA
  • nucleus Source: HGNC
  • perinuclear region of cytoplasm Source: HGNC
  • spindle Source: UniProtKB-SubCell
  • synapse Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton, Microtubule, Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi55201.
OpenTargetsiENSG00000130479.
PharmGKBiPA38031.

Polymorphism and mutation databases

BioMutaiMAP1S.
DMDMi160410004.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003113791 – 1059Microtubule-associated protein 1SAdd BLAST1059
ChainiPRO_00003113801 – 829MAP1S heavy chainAdd BLAST829
ChainiPRO_0000311381830 – 1059MAP1S light chainAdd BLAST230

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei321PhosphoserineCombined sources1
Modified residuei472PhosphoserineCombined sources1
Modified residuei582PhosphoserineCombined sources1
Modified residuei638PhosphothreonineCombined sources1
Modified residuei640PhosphoserineCombined sources1
Modified residuei655PhosphoserineCombined sources1
Modified residuei657PhosphoserineCombined sources1
Modified residuei731PhosphoserineBy similarity1
Modified residuei759PhosphoserineCombined sources1
Modified residuei809PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ66K74.
MaxQBiQ66K74.
PaxDbiQ66K74.
PeptideAtlasiQ66K74.
PRIDEiQ66K74.

PTM databases

iPTMnetiQ66K74.
PhosphoSitePlusiQ66K74.

Expressioni

Tissue specificityi

Expressed in neurons (at protein level). Expressed in spermatocytes, spermatids and spermatozoa. Expressed in the cerebral cortex. Highly expressed in testis. Moderately expressed in the brain, colon, heart, kidney, liver, lung, placenta, small intestine, spleen and stomach. Weakly expressed in muscle.3 Publications

Gene expression databases

BgeeiENSG00000130479.
ExpressionAtlasiQ66K74. baseline and differential.
GenevisibleiQ66K74. HS.

Organism-specific databases

HPAiHPA050934.
HPA054637.

Interactioni

Subunit structurei

Heterodimer of a heavy and a light chain. Interacts with microtubules and actin. Both MAP1S heavy and light chains interact with microtubules. MAP1S light chain interacts with actin. Interacts (via C-terminus) with GAN (via Kelch domains) (By similarity). Interacts with ESR1, LRPPRC, RASSF1 isoform A and isoform C, microtubules and VCY2. Interacts with WDR47 (via N-terminus of light chain).By similarity9 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
BPY2BO145993EBI-2133734,EBI-2133713
SOCS3O145436EBI-2133734,EBI-714146

GO - Molecular functioni

  • actin filament binding Source: HGNC
  • beta-tubulin binding Source: HGNC
  • microtubule binding Source: HGNC
  • tubulin binding Source: HGNC

Protein-protein interaction databases

BioGridi120498. 38 interactors.
IntActiQ66K74. 20 interactors.
STRINGi9606.ENSP00000325313.

Structurei

3D structure databases

ProteinModelPortaliQ66K74.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni1 – 797Necessary for the microtubule-organizing center localizationAdd BLAST797
Regioni666 – 1059Necessary for interaction with RASSF1 isoform A and isoform CAdd BLAST394
Regioni714 – 966Necessary for association with microtubulesAdd BLAST253
Regioni960 – 1059Necessary for association with actinBy similarityAdd BLAST100
Regioni967 – 991Necessary for the mitochondrial aggregation and genome destructionAdd BLAST25

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi560 – 850Pro-richAdd BLAST291

Domaini

The N-terminus of the heavy chain associates with the C-terminus of the light chain to form the heterodimer complex (By similarity). Its C-terminal part of the heavy chain interacts with ESR1.By similarity

Sequence similaritiesi

Belongs to the MAP1 family.Curated

Phylogenomic databases

eggNOGiKOG3592. Eukaryota.
ENOG410XRYM. LUCA.
GeneTreeiENSGT00550000074593.
HOVERGENiHBG108117.
InParanoidiQ66K74.
KOiK10429.
OMAiPCEFEHR.
OrthoDBiEOG091G12OH.
PhylomeDBiQ66K74.
TreeFamiTF350229.

Family and domain databases

Gene3Di3.60.15.10. 2 hits.
InterProiIPR026074. MAP1.
IPR001279. Metallo-B-lactamas.
[Graphical view]
PANTHERiPTHR13843. PTHR13843. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q66K74-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAAVAGSGAA AAPSSLLLVV GSEFGSPGLL TYVLEELERG IRSWDVDPGV
60 70 80 90 100
CNLDEQLKVF VSRHSATFSS IVKGQRSLHH RGDNLETLVL LNPSDKSLYD
110 120 130 140 150
ELRNLLLDPA SHKLLVLAGP CLEETGELLL QTGGFSPHHF LQVLKDREIR
160 170 180 190 200
DILATTPPPV QPPILTITCP TFGDWAQLAP AVPGLQGALR LQLRLNPPAQ
210 220 230 240 250
LPNSEGLCEF LEYVAESLEP PSPFELLEPP TSGGFLRLGR PCCYIFPGGL
260 270 280 290 300
GDAAFFAVNG FTVLVNGGSN PKSSFWKLVR HLDRVDAVLV THPGADSLPG
310 320 330 340 350
LNSLLRRKLA ERSEVAAGGG SWDDRLRRLI SPNLGVVFFN ACEAASRLAR
360 370 380 390 400
GEDEAELALS LLAQLGITPL PLSRGPVPAK PTVLFEKMGV GRLDMYVLHP
410 420 430 440 450
PSAGAERTLA SVCALLVWHP AGPGEKVVRV LFPGCTPPAC LLDGLVRLQH
460 470 480 490 500
LRFLREPVVT PQDLEGPGRA ESKESVGSRD SSKREGLLAT HPRPGQERPG
510 520 530 540 550
VARKEPARAE APRKTEKEAK TPRELKKDPK PSVSRTQPRE VRRAASSVPN
560 570 580 590 600
LKKTNAQAAP KPRKAPSTSH SGFPPVANGP RSPPSLRCGE ASPPSAACGS
610 620 630 640 650
PASQLVATPS LELGPIPAGE EKALELPLAA SSIPRPRTPS PESHRSPAEG
660 670 680 690 700
SERLSLSPLR GGEAGPDASP TVTTPTVTTP SLPAEVGSPH STEVDESLSV
710 720 730 740 750
SFEQVLPPSA PTSEAGLSLP LRGPRARRSA SPHDVDLCLV SPCEFEHRKA
760 770 780 790 800
VPMAPAPASP GSSNDSSARS QERAGGLGAE ETPPTSVSES LPTLSDSDPV
810 820 830 840 850
PLAPGAADSD EDTEGFGVPR HDPLPDPLKV PPPLPDPSSI CMVDPEMLPP
860 870 880 890 900
KTARQTENVS RTRKPLARPN SRAAAPKATP VAAAKTKGLA GGDRASRPLS
910 920 930 940 950
ARSEPSEKGG RAPLSRKSST PKTATRGPSG SASSRPGVSA TPPKSPVYLD
960 970 980 990 1000
LAYLPSGSSA HLVDEEFFQR VRALCYVISG QDQRKEEGMR AVLDALLASK
1010 1020 1030 1040 1050
QHWDRDLQVT LIPTFDSVAM HTWYAETHAR HQALGITVLG SNSMVSMQDD

AFPACKVEF
Length:1,059
Mass (Da):112,211
Last modified:November 13, 2007 - v2
Checksum:i30AB33FFE26DDF91
GO
Isoform 2 (identifier: Q66K74-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-39: MAAVAGSGAAAAPSSLLLVVGSEFGSPGLLTYVLEELER → MAGMIDRFSPANT

Note: No experimental confirmation available.
Show »
Length:1,033
Mass (Da):109,788
Checksum:i0CCD0392292B2B08
GO

Sequence cautioni

The sequence AAH07253 differs from that shown. Contaminating sequence. At the N-terminus.Curated
The sequence AAH07253 differs from that shown. Reason: Erroneous initiation.Curated
The sequence AAH67115 differs from that shown. Reason: Erroneous initiation.Curated
The sequence BAA91743 differs from that shown. Reason: Erroneous initiation.Curated
The sequence BAB14415 differs from that shown. Reason: Erroneous initiation.Curated
The sequence BAB55242 differs from that shown. Reason: Frameshift at position 851.Curated
The sequence BAB93493 differs from that shown. Reason: Erroneous initiation.Curated
The sequence CAD38911 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti120P → L in CAD29574 (PubMed:14627543).Curated1
Sequence conflicti120P → L in BAB55242 (PubMed:14702039).Curated1
Sequence conflicti178L → P in CAD29574 (PubMed:14627543).Curated1
Sequence conflicti178L → P in BAB55242 (PubMed:14702039).Curated1
Sequence conflicti440C → Y in CAD38911 (PubMed:17974005).Curated1
Sequence conflicti521T → A in BAB93493 (Ref. 7) Curated1
Sequence conflicti526K → R in CAD29574 (PubMed:14627543).Curated1
Sequence conflicti526K → R in BAB55242 (PubMed:14702039).Curated1
Sequence conflicti967F → L in BAB14415 (PubMed:14702039).Curated1
Sequence conflicti1043S → G in BAA91743 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_050023372L → V.Corresponds to variant rs17710707dbSNPEnsembl.1
Natural variantiVAR_037236411S → C.1 PublicationCorresponds to variant rs17710707dbSNPEnsembl.1
Natural variantiVAR_037237538P → Q.Corresponds to variant rs7252905dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0560431 – 39MAAVA…EELER → MAGMIDRFSPANT in isoform 2. 1 PublicationAdd BLAST39

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ440784 mRNA. Translation: CAD29574.1.
DQ387861 mRNA. Translation: ABD47682.1.
AK027623 mRNA. Translation: BAB55242.1. Frameshift.
AK001531 mRNA. Translation: BAA91743.1. Different initiation.
AK023118 mRNA. Translation: BAB14415.1. Different initiation.
AK294936 mRNA. Translation: BAG58014.1.
AL834233 mRNA. Translation: CAD38911.1. Different initiation.
AC008761 Genomic DNA. No translation available.
BC006358 mRNA. Translation: AAH06358.2.
BC007253 mRNA. Translation: AAH07253.1. Different initiation.
BC008806 mRNA. Translation: AAH08806.2.
BC067115 mRNA. Translation: AAH67115.1. Different initiation.
BC080547 mRNA. Translation: AAH80547.1.
BC113952 mRNA. Translation: AAI13953.1.
AB062430 mRNA. Translation: BAB93493.1. Different initiation.
CCDSiCCDS32954.1. [Q66K74-1]
CCDS77262.1. [Q66K74-2]
RefSeqiNP_001295292.1. NM_001308363.1. [Q66K74-2]
NP_060644.4. NM_018174.5. [Q66K74-1]
UniGeneiHs.66048.

Genome annotation databases

EnsembliENST00000324096; ENSP00000325313; ENSG00000130479. [Q66K74-1]
ENST00000544059; ENSP00000439243; ENSG00000130479. [Q66K74-2]
GeneIDi55201.
KEGGihsa:55201.
UCSCiuc002nhe.2. human. [Q66K74-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ440784 mRNA. Translation: CAD29574.1.
DQ387861 mRNA. Translation: ABD47682.1.
AK027623 mRNA. Translation: BAB55242.1. Frameshift.
AK001531 mRNA. Translation: BAA91743.1. Different initiation.
AK023118 mRNA. Translation: BAB14415.1. Different initiation.
AK294936 mRNA. Translation: BAG58014.1.
AL834233 mRNA. Translation: CAD38911.1. Different initiation.
AC008761 Genomic DNA. No translation available.
BC006358 mRNA. Translation: AAH06358.2.
BC007253 mRNA. Translation: AAH07253.1. Different initiation.
BC008806 mRNA. Translation: AAH08806.2.
BC067115 mRNA. Translation: AAH67115.1. Different initiation.
BC080547 mRNA. Translation: AAH80547.1.
BC113952 mRNA. Translation: AAI13953.1.
AB062430 mRNA. Translation: BAB93493.1. Different initiation.
CCDSiCCDS32954.1. [Q66K74-1]
CCDS77262.1. [Q66K74-2]
RefSeqiNP_001295292.1. NM_001308363.1. [Q66K74-2]
NP_060644.4. NM_018174.5. [Q66K74-1]
UniGeneiHs.66048.

3D structure databases

ProteinModelPortaliQ66K74.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi120498. 38 interactors.
IntActiQ66K74. 20 interactors.
STRINGi9606.ENSP00000325313.

PTM databases

iPTMnetiQ66K74.
PhosphoSitePlusiQ66K74.

Polymorphism and mutation databases

BioMutaiMAP1S.
DMDMi160410004.

Proteomic databases

EPDiQ66K74.
MaxQBiQ66K74.
PaxDbiQ66K74.
PeptideAtlasiQ66K74.
PRIDEiQ66K74.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000324096; ENSP00000325313; ENSG00000130479. [Q66K74-1]
ENST00000544059; ENSP00000439243; ENSG00000130479. [Q66K74-2]
GeneIDi55201.
KEGGihsa:55201.
UCSCiuc002nhe.2. human. [Q66K74-1]

Organism-specific databases

CTDi55201.
DisGeNETi55201.
GeneCardsiMAP1S.
H-InvDBHIX0014899.
HGNCiHGNC:15715. MAP1S.
HPAiHPA050934.
HPA054637.
MIMi607573. gene.
neXtProtiNX_Q66K74.
OpenTargetsiENSG00000130479.
PharmGKBiPA38031.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG3592. Eukaryota.
ENOG410XRYM. LUCA.
GeneTreeiENSGT00550000074593.
HOVERGENiHBG108117.
InParanoidiQ66K74.
KOiK10429.
OMAiPCEFEHR.
OrthoDBiEOG091G12OH.
PhylomeDBiQ66K74.
TreeFamiTF350229.

Miscellaneous databases

ChiTaRSiMAP1S. human.
GeneWikiiMAP1S.
GenomeRNAii55201.
PROiQ66K74.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000130479.
ExpressionAtlasiQ66K74. baseline and differential.
GenevisibleiQ66K74. HS.

Family and domain databases

Gene3Di3.60.15.10. 2 hits.
InterProiIPR026074. MAP1.
IPR001279. Metallo-B-lactamas.
[Graphical view]
PANTHERiPTHR13843. PTHR13843. 1 hit.
ProtoNetiSearch...

Entry informationi

Entry nameiMAP1S_HUMAN
AccessioniPrimary (citable) accession number: Q66K74
Secondary accession number(s): B4DH53
, Q27QB1, Q6NXF1, Q8N3L8, Q8N3W5, Q8NI88, Q96H94, Q96IT4, Q96SP8, Q9BRC6, Q9H928, Q9NVK7
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 13, 2007
Last sequence update: November 13, 2007
Last modified: November 2, 2016
This is version 114 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Miscellaneous

Depletion of MAP1S by RNAi causes mitotic abnormalities that consist of failure to form a stable metaphase plate, premature sister chromatid separation, lagging chromosomes, and multipolar spindles.

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 19
    Human chromosome 19: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.