Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Cyclin-D-binding Myb-like transcription factor 1

Gene

Dmtf1

Organism
Rattus norvegicus (Rat)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at transcript leveli

Functioni

Transcriptional activator which activates the CDKN2A/ARF locus in response to Ras-Raf signaling, thereby promoting p53/TP53-dependent growth arrest. Binds to the consensus sequence 5'-CCCG[GT]ATGT-3'.By similarity

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
DNA bindingi306 – 32924H-T-H motifPROSITE-ProRule annotationAdd
BLAST

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Activator

Keywords - Biological processi

Cell cycle, Transcription, Transcription regulation

Keywords - Ligandi

DNA-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Cyclin-D-binding Myb-like transcription factor 1
Gene namesi
Name:Dmtf1
OrganismiRattus norvegicus (Rat)
Taxonomic identifieri10116 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeRattus
Proteomesi
  • UP000002494 Componenti: Chromosome 4

Organism-specific databases

RGDi70966. Dmtf1.

Subcellular locationi

  • Nucleus PROSITE-ProRule annotation

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Keywords - Diseasei

Tumor suppressor

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 760760Cyclin-D-binding Myb-like transcription factor 1PRO_0000323731Add
BLAST

Post-translational modificationi

Phosphorylated by the cyclin-D2/CDK4, cyclin-D3/CDK4 and cyclin-D2/CDK6 complexes and to a lesser extent by the cyclin-D1/CDK4 complex.By similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiQ66HG1.

Expressioni

Gene expression databases

GenevisibleiQ66HG1. RN.

Interactioni

Subunit structurei

Interacts with the D-type cyclins CCND1, CCND2 and CCND3. Interaction with D-type cyclins may modulate transcriptional activation by this protein.By similarity

Protein-protein interaction databases

STRINGi10116.ENSRNOP00000046030.

Structurei

3D structure databases

ProteinModelPortaliQ66HG1.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini225 – 26339Myb-like 1PROSITE-ProRule annotationAdd
BLAST
Domaini268 – 33366HTH myb-typePROSITE-ProRule annotationAdd
BLAST
Domaini339 – 38850Myb-like 2PROSITE-ProRule annotationAdd
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni1 – 237237Interaction with CCND2By similarityAdd
BLAST
Regioni87 – 458372Required for DNA-bindingBy similarityAdd
BLAST
Regioni87 – 17084Required for transcriptional activationBy similarityAdd
BLAST
Regioni176 – 690515Interaction with CCND1, CCND2 and CCND3By similarityAdd
BLAST
Regioni459 – 760302Required for transcriptional activationBy similarityAdd
BLAST

Sequence similaritiesi

Belongs to the DMTF1 family.Curated
Contains 1 HTH myb-type DNA-binding domain.PROSITE-ProRule annotation
Contains 2 Myb-like domains.PROSITE-ProRule annotation

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiKOG0051. Eukaryota.
COG5147. LUCA.
GeneTreeiENSGT00530000063659.
HOGENOMiHOG000112233.
HOVERGENiHBG053416.
InParanoidiQ66HG1.
OMAiFPDEIHQ.
OrthoDBiEOG7QZG92.
PhylomeDBiQ66HG1.
TreeFamiTF333537.

Family and domain databases

Gene3Di1.10.10.60. 2 hits.
InterProiIPR009057. Homeodomain-like.
IPR017877. Myb-like_dom.
IPR017930. Myb_dom.
IPR001005. SANT/Myb.
[Graphical view]
PfamiPF00249. Myb_DNA-binding. 2 hits.
[Graphical view]
SMARTiSM00717. SANT. 3 hits.
[Graphical view]
SUPFAMiSSF46689. SSF46689. 3 hits.
PROSITEiPS51294. HTH_MYB. 1 hit.
PS50090. MYB_LIKE. 2 hits.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q66HG1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSTVEEDSDT VTVETVNSVT FTQDTDGNLI LHCPQNDPDE IDSEDSTEPP
60 70 80 90 100
HKRLCLSSED DQSIDDSTPC ISVVALPLSE NDQSFEVTMT ATTEVADDEL
110 120 130 140 150
SEGTVTQIQI LQNDQLDEMS PLGTEEVSAV SQAWFTTKED KDSLTNKGHK
160 170 180 190 200
WKQGMWSKEE IDILMNNIER YLKARGIKDA TEIIFEMSKD ERKDFYRTIA
210 220 230 240 250
WGLNRPLFAV YRRVLRMYDD RNHVGKYTPE EIEKLKELRI KHGNDWATIG
260 270 280 290 300
AALGRSASSV KDRCRLMKDT CNTGKWTEEE EKRLAEVVHE LTSTEPGDIV
310 320 330 340 350
TQGVSWAAVA ERVGTRSEKQ CRSKWLNYLN WKQSGGTEWT KEDEINLILR
360 370 380 390 400
IAELDVADEN DINWDLLAEG WSSVRSPQWL RSKWWTIKRQ IANHKDVSFP
410 420 430 440 450
VLIKGLKQLH ENQKNNPVLL ENKSGSGVPN SNCNSSVQHV QIRVARLEDN
460 470 480 490 500
TAISPSPMAA LQIPVQITHV SSTDSPAASV DSETITLNSG TLQTFEILPS
510 520 530 540 550
FHLQPTGTPG TYLLQTSSSQ GLPLTLTTSP TVTLAAAAPA SPEQIIVHAL
560 570 580 590 600
SPEHLLNTSD NVTVQCHTPR VIIQTVATED ITSSISQAEL TADSDLHSSD
610 620 630 640 650
FPEPPDALEA DTFPDEIPRP KMTIQPSFNN AHVSKYSDQN STELMNSVMV
660 670 680 690 700
RTEEEIADTD LKQEPPSDLA SAYVTEDLES PTIVHQVHQT IDDETILIVP
710 720 730 740 750
SPHGFIQASD GIDAESVLPL TTLTDPIFQH HQEESNIIGS SLGSPVSEDS
760
KDVEDLVNCH
Note: No experimental confirmation available.
Length:760
Mass (Da):84,452
Last modified:March 18, 2008 - v2
Checksum:i83F3FB5675DBC30B
GO
Isoform 2 (identifier: Q66HG1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     401-471: VLIKGLKQLHENQKNNPVLLENKSGSGVPNSNCNSSVQHVQIRVARLEDNTAISPSPMAALQIPVQITHVS → A

Show »
Length:690
Mass (Da):76,877
Checksum:i0D5467739E5504E0
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei401 – 47171VLIKG…ITHVS → A in isoform 2. 2 PublicationsVSP_032102Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AABR03031952 Genomic DNA. No translation available.
BC081880 mRNA. Translation: AAH81880.1.
AF352170 mRNA. Translation: AAK32706.1.
RefSeqiNP_446145.1. NM_053693.1. [Q66HG1-2]
XP_006236055.1. XM_006235993.1. [Q66HG1-1]
UniGeneiRn.116028.

Genome annotation databases

EnsembliENSRNOT00000007948; ENSRNOP00000007948; ENSRNOG00000005908. [Q66HG1-2]
ENSRNOT00000044810; ENSRNOP00000046030; ENSRNOG00000005908. [Q66HG1-1]
GeneIDi114485.
KEGGirno:114485.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AABR03031952 Genomic DNA. No translation available.
BC081880 mRNA. Translation: AAH81880.1.
AF352170 mRNA. Translation: AAK32706.1.
RefSeqiNP_446145.1. NM_053693.1. [Q66HG1-2]
XP_006236055.1. XM_006235993.1. [Q66HG1-1]
UniGeneiRn.116028.

3D structure databases

ProteinModelPortaliQ66HG1.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10116.ENSRNOP00000046030.

Proteomic databases

PaxDbiQ66HG1.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSRNOT00000007948; ENSRNOP00000007948; ENSRNOG00000005908. [Q66HG1-2]
ENSRNOT00000044810; ENSRNOP00000046030; ENSRNOG00000005908. [Q66HG1-1]
GeneIDi114485.
KEGGirno:114485.

Organism-specific databases

CTDi9988.
RGDi70966. Dmtf1.

Phylogenomic databases

eggNOGiKOG0051. Eukaryota.
COG5147. LUCA.
GeneTreeiENSGT00530000063659.
HOGENOMiHOG000112233.
HOVERGENiHBG053416.
InParanoidiQ66HG1.
OMAiFPDEIHQ.
OrthoDBiEOG7QZG92.
PhylomeDBiQ66HG1.
TreeFamiTF333537.

Miscellaneous databases

NextBioi618493.
PROiQ66HG1.

Gene expression databases

GenevisibleiQ66HG1. RN.

Family and domain databases

Gene3Di1.10.10.60. 2 hits.
InterProiIPR009057. Homeodomain-like.
IPR017877. Myb-like_dom.
IPR017930. Myb_dom.
IPR001005. SANT/Myb.
[Graphical view]
PfamiPF00249. Myb_DNA-binding. 2 hits.
[Graphical view]
SMARTiSM00717. SANT. 3 hits.
[Graphical view]
SUPFAMiSSF46689. SSF46689. 3 hits.
PROSITEiPS51294. HTH_MYB. 1 hit.
PS50090. MYB_LIKE. 2 hits.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Genome sequence of the Brown Norway rat yields insights into mammalian evolution."
    Gibbs R.A., Weinstock G.M., Metzker M.L., Muzny D.M., Sodergren E.J., Scherer S., Scott G., Steffen D., Worley K.C., Burch P.E., Okwuonu G., Hines S., Lewis L., Deramo C., Delgado O., Dugan-Rocha S., Miner G., Morgan M.
    , Hawes A., Gill R., Holt R.A., Adams M.D., Amanatides P.G., Baden-Tillson H., Barnstead M., Chin S., Evans C.A., Ferriera S., Fosler C., Glodek A., Gu Z., Jennings D., Kraft C.L., Nguyen T., Pfannkoch C.M., Sitter C., Sutton G.G., Venter J.C., Woodage T., Smith D., Lee H.-M., Gustafson E., Cahill P., Kana A., Doucette-Stamm L., Weinstock K., Fechtel K., Weiss R.B., Dunn D.M., Green E.D., Blakesley R.W., Bouffard G.G., De Jong P.J., Osoegawa K., Zhu B., Marra M., Schein J., Bosdet I., Fjell C., Jones S., Krzywinski M., Mathewson C., Siddiqui A., Wye N., McPherson J., Zhao S., Fraser C.M., Shetty J., Shatsman S., Geer K., Chen Y., Abramzon S., Nierman W.C., Havlak P.H., Chen R., Durbin K.J., Egan A., Ren Y., Song X.-Z., Li B., Liu Y., Qin X., Cawley S., Cooney A.J., D'Souza L.M., Martin K., Wu J.Q., Gonzalez-Garay M.L., Jackson A.R., Kalafus K.J., McLeod M.P., Milosavljevic A., Virk D., Volkov A., Wheeler D.A., Zhang Z., Bailey J.A., Eichler E.E., Tuzun E., Birney E., Mongin E., Ureta-Vidal A., Woodwark C., Zdobnov E., Bork P., Suyama M., Torrents D., Alexandersson M., Trask B.J., Young J.M., Huang H., Wang H., Xing H., Daniels S., Gietzen D., Schmidt J., Stevens K., Vitt U., Wingrove J., Camara F., Mar Alba M., Abril J.F., Guigo R., Smit A., Dubchak I., Rubin E.M., Couronne O., Poliakov A., Huebner N., Ganten D., Goesele C., Hummel O., Kreitler T., Lee Y.-A., Monti J., Schulz H., Zimdahl H., Himmelbauer H., Lehrach H., Jacob H.J., Bromberg S., Gullings-Handley J., Jensen-Seaman M.I., Kwitek A.E., Lazar J., Pasko D., Tonellato P.J., Twigger S., Ponting C.P., Duarte J.M., Rice S., Goodstadt L., Beatson S.A., Emes R.D., Winter E.E., Webber C., Brandt P., Nyakatura G., Adetobi M., Chiaromonte F., Elnitski L., Eswara P., Hardison R.C., Hou M., Kolbe D., Makova K., Miller W., Nekrutenko A., Riemer C., Schwartz S., Taylor J., Yang S., Zhang Y., Lindpaintner K., Andrews T.D., Caccamo M., Clamp M., Clarke L., Curwen V., Durbin R.M., Eyras E., Searle S.M., Cooper G.M., Batzoglou S., Brudno M., Sidow A., Stone E.A., Payseur B.A., Bourque G., Lopez-Otin C., Puente X.S., Chakrabarti K., Chatterji S., Dewey C., Pachter L., Bray N., Yap V.B., Caspi A., Tesler G., Pevzner P.A., Haussler D., Roskin K.M., Baertsch R., Clawson H., Furey T.S., Hinrichs A.S., Karolchik D., Kent W.J., Rosenbloom K.R., Trumbower H., Weirauch M., Cooper D.N., Stenson P.D., Ma B., Brent M., Arumugam M., Shteynberg D., Copley R.R., Taylor M.S., Riethman H., Mudunuri U., Peterson J., Guyer M., Felsenfeld A., Old S., Mockrin S., Collins F.S.
    Nature 428:493-521(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  2. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Kidney.
  3. "A dual-color FISH gene map of the proximal region of rat chromosome 4 and comparative analysis in human and mouse."
    Walentinsson A., Helou K., Levan G.
    Mamm. Genome 12:900-908(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 449-527 (ISOFORM 2).
    Strain: Brown Norway.

Entry informationi

Entry nameiDMTF1_RAT
AccessioniPrimary (citable) accession number: Q66HG1
Secondary accession number(s): Q99MC8
Entry historyi
Integrated into UniProtKB/Swiss-Prot: March 18, 2008
Last sequence update: March 18, 2008
Last modified: February 17, 2016
This is version 113 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.