Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Tax1-binding protein 1 homolog

Gene

Tax1bp1

Organism
Rattus norvegicus (Rat)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at transcript leveli

Functioni

Inhibits TNF-induced apoptosis by mediating the TNFAIP3 anti-apoptotic activity. Degraded by caspase-3-like family proteins upon TNF-induced apoptosis. May also play a role in the pro-inflammatory cytokine IL-1 signaling cascade (By similarity).By similarity

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri749 – 778UBZ-type 1Add BLAST30
Zinc fingeri779 – 813UBZ-type 2Add BLAST35

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Apoptosis

Keywords - Ligandi

Metal-binding, Zinc

Enzyme and pathway databases

ReactomeiR-RNO-5357905. Regulation of TNFR1 signaling.
R-RNO-936440. Negative regulators of RIG-I/MDA5 signaling.

Names & Taxonomyi

Protein namesi
Recommended name:
Tax1-binding protein 1 homolog
Alternative name(s):
Liver regeneration-related protein LRRG004
Gene namesi
Name:Tax1bp1
ORF Names:Aa1076
OrganismiRattus norvegicus (Rat)
Taxonomic identifieri10116 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeRattus
Proteomesi
  • UP000002494 Componenti: Chromosome 4

Organism-specific databases

RGDi708579. Tax1bp1.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002345571 – 813Tax1-binding protein 1 homologAdd BLAST813

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei124PhosphoserineBy similarity1
Modified residuei138PhosphoserineBy similarity1
Modified residuei225PhosphoserineBy similarity1
Modified residuei618Phosphoserine; by IKKABy similarity1
Modified residuei631PhosphoserineBy similarity1
Modified residuei692Phosphoserine; by IKKABy similarity1

Post-translational modificationi

Phosphorylated in the C-terminal region by CHUK/IKKA leading to NF-kappa-B signaling down-regulation.By similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiQ66HA4.
PRIDEiQ66HA4.

Expressioni

Gene expression databases

BgeeiENSRNOG00000008393.
GenevisibleiQ66HA4. RN.

Interactioni

Subunit structurei

Homooligomer. Interacts with TRAF6 in a IL-1-dependent manner. Interacts with TNFAIP3. Interacts with STARD13 (By similarity).By similarity

Protein-protein interaction databases

STRINGi10116.ENSRNOP00000046052.

Structurei

3D structure databases

ProteinModelPortaliQ66HA4.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni320 – 420OligomerizationBy similarityAdd BLAST101

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili144 – 596Sequence analysisAdd BLAST453

Domaini

The C-terminal UBZ-type zinc fingers function as ubiquitin-binding domains.By similarity

Sequence similaritiesi

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri749 – 778UBZ-type 1Add BLAST30
Zinc fingeri779 – 813UBZ-type 2Add BLAST35

Keywords - Domaini

Coiled coil, Repeat, Zinc-finger

Phylogenomic databases

eggNOGiENOG410IGMS. Eukaryota.
ENOG410XQDF. LUCA.
GeneTreeiENSGT00530000063216.
HOGENOMiHOG000252947.
HOVERGENiHBG053034.
InParanoidiQ66HA4.
OMAiRKMEGQN.
OrthoDBiEOG091G01W2.
PhylomeDBiQ66HA4.
TreeFamiTF329501.

Family and domain databases

InterProiIPR012852. CALCOCO1-like.
[Graphical view]
PfamiPF07888. CALCOCO1. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q66HA4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MTSFQEVPLQ TSNFAHVIFQ NVAKSYLPNA HLECHYTLTP YIHPHSKDWV
60 70 80 90 100
GIFKVGWSTA RDYYTFLWSP MPEQYVEGST VNCVLAFQGY YLPNDDGEFY
110 120 130 140 150
QFCYVTHKGE IRGASTPFQF RAASPVEELL TMEDEGNSDM LVVTTKAGLL
160 170 180 190 200
ELKIEKTLKE KEELLKLVSV LEKETAQLRE QVGRMERELS HEKSRCEQLQ
210 220 230 240 250
AEQKGLLEVS QSLRVENEEF MKRYSDATSK AHQLEEDIVS VTHKAVEKET
260 270 280 290 300
ELDSLKDKLR KAQQEKEQLE CQLKTEKDEK ELYKVHLKNT EIENTKLVSE
310 320 330 340 350
IQTLKNVDGN KESMITHFKE EIGKLQSCLA DKENLHRALL LTTSNKEDTL
360 370 380 390 400
LLKEQLRKAE EQVQATRQEL IFLAKELSDA VNVRDKTMAD LHTARLENER
410 420 430 440 450
VKKQLADTLA ELQLHAVKTD QEKTDTLEHE LRREVEDLKL RLQMAADHYK
460 470 480 490 500
EKFKECQRLQ KQINKLSDQS ASSNGVFTKR MGSQQKVNDA SINTDPAASA
510 520 530 540 550
SAVDVKPAAS CAAETDFDMS AKDHVCEVTK EMAEKVEKYN KCKQLLQDEK
560 570 580 590 600
AKCNKYADEL AQMELKWKEQ VRIAENVKLE LAELEDSYSL QLAEKDKEIN
610 620 630 640 650
CLASFLENLS REKELTKSLE DQKGRKMEGQ SPQQVSRCLN TCSEQSGLLP
660 670 680 690 700
TLPAAQPVLQ YGNPYTAHET RDGADGAFYP DEIQRPPVRG PSWEDNVVCS
710 720 730 740 750
QPARNLSRPD GLEDPEDSRE DENVPIPPDP ANQHLRGHGA GFCFDSSFDV
760 770 780 790 800
HKKCPLCELM FPPNYDQIKF EEHVESHWKV CPMCSEQFPP DYDQQGFERH
810
VQTHFDQNVL NFD
Length:813
Mass (Da):93,197
Last modified:October 11, 2004 - v1
Checksum:i82073C220E017AD3
GO
Isoform 2 (identifier: Q66HA4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     590-613: LQLAEKDKEINCLASFLENLSREK → VSSENVRLELAELEDSYS
     780-813: VCPMCSEQFPPDYDQQGFERHVQTHFDQNVLNFD → LPGEFFIEYP...SRQISDLQVQ

Note: No experimental confirmation available.
Show »
Length:845
Mass (Da):96,706
Checksum:i251EC5676EE65D4C
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_018357590 – 613LQLAE…LSREK → VSSENVRLELAELEDSYS in isoform 2. 1 PublicationAdd BLAST24
Alternative sequenceiVSP_018358780 – 813VCPMC…VLNFD → LPGEFFIEYPWATYAPHETL GPWRRLGKVLAVLSSDTQLW CEKPDISLGRQKQKILGMCW SESRQISDLQVQ in isoform 2. 1 PublicationAdd BLAST34

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY318959 mRNA. Translation: AAP85370.1.
BC081949 mRNA. Translation: AAH81949.1.
RefSeqiNP_001004199.1. NM_001004199.1. [Q66HA4-1]
UniGeneiRn.3474.

Genome annotation databases

EnsembliENSRNOT00000011371; ENSRNOP00000011371; ENSRNOG00000008393. [Q66HA4-1]
ENSRNOT00000041988; ENSRNOP00000046052; ENSRNOG00000008393. [Q66HA4-2]
GeneIDi246244.
KEGGirno:246244.
UCSCiRGD:708579. rat. [Q66HA4-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY318959 mRNA. Translation: AAP85370.1.
BC081949 mRNA. Translation: AAH81949.1.
RefSeqiNP_001004199.1. NM_001004199.1. [Q66HA4-1]
UniGeneiRn.3474.

3D structure databases

ProteinModelPortaliQ66HA4.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10116.ENSRNOP00000046052.

Proteomic databases

PaxDbiQ66HA4.
PRIDEiQ66HA4.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSRNOT00000011371; ENSRNOP00000011371; ENSRNOG00000008393. [Q66HA4-1]
ENSRNOT00000041988; ENSRNOP00000046052; ENSRNOG00000008393. [Q66HA4-2]
GeneIDi246244.
KEGGirno:246244.
UCSCiRGD:708579. rat. [Q66HA4-1]

Organism-specific databases

CTDi8887.
RGDi708579. Tax1bp1.

Phylogenomic databases

eggNOGiENOG410IGMS. Eukaryota.
ENOG410XQDF. LUCA.
GeneTreeiENSGT00530000063216.
HOGENOMiHOG000252947.
HOVERGENiHBG053034.
InParanoidiQ66HA4.
OMAiRKMEGQN.
OrthoDBiEOG091G01W2.
PhylomeDBiQ66HA4.
TreeFamiTF329501.

Enzyme and pathway databases

ReactomeiR-RNO-5357905. Regulation of TNFR1 signaling.
R-RNO-936440. Negative regulators of RIG-I/MDA5 signaling.

Miscellaneous databases

PROiQ66HA4.

Gene expression databases

BgeeiENSRNOG00000008393.
GenevisibleiQ66HA4. RN.

Family and domain databases

InterProiIPR012852. CALCOCO1-like.
[Graphical view]
PfamiPF07888. CALCOCO1. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiTAXB1_RAT
AccessioniPrimary (citable) accession number: Q66HA4
Secondary accession number(s): Q7TQ13
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 16, 2006
Last sequence update: October 11, 2004
Last modified: September 7, 2016
This is version 76 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.