Q659C4 (LAR1B_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 56.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: La-related protein 1B Alternative name(s): La ribonucleoprotein domain family member 1B La ribonucleoprotein domain family member 2 La-related protein 2 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 914 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Sequence similarities | Belongs to the LARP family. Contains 1 HTH La-type RNA-binding domain. |
| Sequence caution | The sequence AAH50654.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended. The sequence AAH50654.1 differs from that shown. Reason: Frameshift at position 753. The sequence BAB15679.1 differs from that shown. Reason: Frameshift at position 721. The sequence CAH56379.1 differs from that shown. Reason: Frameshift at position 113. |
Ontologies
| Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing Polymorphism |
| Ligand | RNA-binding |
| PTM | Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Molecular function | RNA binding Inferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 9 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q659C4-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q659C4-2) The sequence of this isoform differs from the canonical sequence as follows: 73-120: ANKHKWVPLHLDVVRSESQERPGSRNSSRCQPEANKPTHNNRRNDTRS → G 550-561: Missing. | ||||||
| Isoform 3 (identifier: Q659C4-3) The sequence of this isoform differs from the canonical sequence as follows: 330-335: ESAPNS → VRVMIF 336-914: Missing. | ||||||
| Isoform 4 (identifier: Q659C4-4) The sequence of this isoform differs from the canonical sequence as follows: 1-194: Missing. 509-522: QEVENFKKLNLISK → VIVSGQHLSTDALF 523-914: Missing. | ||||||
| Isoform 5 (identifier: Q659C4-5) The sequence of this isoform differs from the canonical sequence as follows: 1-581: Missing. 850-914: PPISDEFGRK...ISPESSDNSH → NHHDRLLLLIINI | ||||||
| Isoform 6 (identifier: Q659C4-6) The sequence of this isoform differs from the canonical sequence as follows: 1-654: Missing. 896-914: VPINSPRRNISPESSDNSH → EADPIE | ||||||
| Isoform 7 (identifier: Q659C4-7) The sequence of this isoform differs from the canonical sequence as follows: 1-654: Missing. 850-914: PPISDEFGRKRHSSTSGEESNRHRLPPNSSTKPPNAAKPTSTSELQVPINSPRRNISPESSDNSH → EADPIE | ||||||
| Isoform 8 (identifier: Q659C4-8) The sequence of this isoform differs from the canonical sequence as follows: 1-790: Missing. 791-806: EIFQDFQEETKKDYES → MRNLDNLLGKMQKKIT | ||||||
| Isoform 9 (identifier: Q659C4-9) The sequence of this isoform differs from the canonical sequence as follows: 771-787: YGLECLFRFYSYGLEKK → SAVWTRKVLGLFEIFSI 788-914: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 914 | 914 | La-related protein 1B | PRO_0000299411 | |||||
Regions | |||||||||
| Domain | 209 – 299 | 91 | HTH La-type RNA-binding | ||||||
| Compositional bias | 114 – 167 | 54 | Arg-rich | ||||||
Amino acid modifications | |||||||||
| Modified residue | 60 | 1 | Phosphoserine Ref.5 Ref.6 Ref.8 | ||||||
| Modified residue | 340 | 1 | Phosphoserine Ref.5 Ref.6 | ||||||
| Modified residue | 343 | 1 | Phosphoserine Ref.5 Ref.6 | ||||||
| Modified residue | 363 | 1 | Phosphoserine Ref.7 | ||||||
| Modified residue | 432 | 1 | Phosphoserine Ref.8 | ||||||
| Modified residue | 454 | 1 | Phosphothreonine Ref.6 | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 790 | 790 | Missing in isoform 8. | VSP_027638 | |||||
| Alternative sequence | 1 – 654 | 654 | Missing in isoform 6 and isoform 7. | VSP_027639 | |||||
| Alternative sequence | 1 – 581 | 581 | Missing in isoform 5. | VSP_027640 | |||||
| Alternative sequence | 1 – 194 | 194 | Missing in isoform 4. | VSP_027641 | |||||
| Alternative sequence | 73 – 120 | 48 | ANKHK…NDTRS → G in isoform 2. | VSP_027642 | |||||
| Alternative sequence | 330 – 335 | 6 | ESAPNS → VRVMIF in isoform 3. | VSP_027643 | |||||
| Alternative sequence | 336 – 914 | 579 | Missing in isoform 3. | VSP_027644 | |||||
| Alternative sequence | 509 – 522 | 14 | QEVEN…NLISK → VIVSGQHLSTDALF in isoform 4. | VSP_027645 | |||||
| Alternative sequence | 523 – 914 | 392 | Missing in isoform 4. | VSP_027646 | |||||
| Alternative sequence | 550 – 561 | 12 | Missing in isoform 2. | VSP_027647 | |||||
| Alternative sequence | 771 – 787 | 17 | YGLEC…GLEKK → SAVWTRKVLGLFEIFSI in isoform 9. | VSP_027648 | |||||
| Alternative sequence | 788 – 914 | 127 | Missing in isoform 9. | VSP_027649 | |||||
| Alternative sequence | 791 – 806 | 16 | EIFQD…KDYES → MRNLDNLLGKMQKKIT in isoform 8. | VSP_027650 | |||||
| Alternative sequence | 850 – 914 | 65 | PPISD…SDNSH → NHHDRLLLLIINI in isoform 5. | VSP_027651 | |||||
| Alternative sequence | 850 – 914 | 65 | PPISD…SDNSH → EADPIE in isoform 7. | VSP_027652 | |||||
| Alternative sequence | 896 – 914 | 19 | VPINS…SDNSH → EADPIE in isoform 6. | VSP_027653 | |||||
| Natural variant | 462 | 1 | P → R. Ref.1 Ref.2 Corresponds to variant rs12508837 [ dbSNP | Ensembl ]. | VAR_034813 | |||||
| Natural variant | 660 | 1 | R → H. Ref.2 Ref.4 Corresponds to variant rs12645577 [ dbSNP | Ensembl ]. | VAR_034814 | |||||
Experimental info | |||||||||
| Sequence conflict | 272 | 1 | A → V in BAC03970. Ref.1 | ||||||
| Sequence conflict | 289 | 1 | K → E in BAA91576. Ref.1 | ||||||
| Sequence conflict | 291 | 1 | E → T in BAC05306. Ref.1 | ||||||
| Sequence conflict | 473 | 1 | R → Q in BAC03970. Ref.1 | ||||||
| Sequence conflict | 639 | 1 | T → A in CAD97908. Ref.2 | ||||||
| Sequence conflict | 671 | 1 | N → S in AAH62606. Ref.4 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| [1] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 4 AND 8), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-634 (ISOFORM 2), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 608-914 (ISOFORM 1), VARIANT ARG-462. Tissue: Lung, Small intestine, Teratocarcinoma and Thyroid. |
| [2] | "The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399(2007) [PubMed: 17974005] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 5), VARIANTS ARG-462 AND HIS-660. Tissue: Cervix, Rectum tumor and Testis. |
| [3] | "Generation and annotation of the DNA sequences of human chromosomes 2 and 4." Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H. Wilson R.K.Nature 434:724-731(2005) [PubMed: 15815621] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3; 6 AND 7), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 633-914 (ISOFORM 9), VARIANT HIS-660. Tissue: Blood and Brain. |
| [5] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed: 18669648] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-60; SER-340 AND SER-343, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [6] | "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach." Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S. Anal. Chem. 81:4493-4501(2009) [PubMed: 19413330] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-60; SER-340; SER-343 AND THR-454, MASS SPECTROMETRY. Tissue: Embryonic kidney. |
| [7] | "Large-scale proteomics analysis of the human kinome." Oppermann F.S., Gnad F., Olsen J.V., Hornberger R., Greff Z., Keri G., Mann M., Daub H. Mol. Cell. Proteomics 8:1751-1764(2009) [PubMed: 19369195] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-363, MASS SPECTROMETRY. |
| [8] | "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions." Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K. Sci. Signal. 2:RA46-RA46(2009) [PubMed: 19690332] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-60 AND SER-432, MASS SPECTROMETRY. Tissue: Leukemic T-cell. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AK001240 mRNA. Translation: BAA91576.1. AK027164 mRNA. Translation: BAB15679.1. Frameshift. AK092764 mRNA. Translation: BAC03970.1. AK098437 mRNA. Translation: BAC05306.1. AL137759 mRNA. Translation: CAH56379.1. Frameshift. AL832170 mRNA. Translation: CAH56210.1. BX537937 mRNA. Translation: CAD97908.1. AC096898 Genomic DNA. No translation available. AC099340 Genomic DNA. No translation available. AC108045 Genomic DNA. No translation available. AC114735 Genomic DNA. Translation: AAY41042.1. AC124030 Genomic DNA. Translation: AAY41031.1. BC030516 mRNA. Translation: AAH30516.1. BC050654 mRNA. Translation: AAH50654.1. Sequence problems. BC062606 mRNA. Translation: AAH62606.1. BC110300 mRNA. Translation: AAI10301.1. |
| IPI | IPI00383949. IPI00855721. IPI00855786. IPI00855812. IPI00855930. IPI00855953. IPI00856120. IPI00940348. IPI00943149. |
| RefSeq | NP_060548.2. NM_018078.2. NP_115615.2. NM_032239.2. NP_835144.1. NM_178043.1. |
| UniGene | Hs.657067. |
3D structure databases | |
| HSSP | HSSP built from PDB template 2CQK based on UniProtKB Q71RC2. |
| ProteinModelPortal | Q659C4. |
| SMR | Q659C4. Positions 209-301. |
| ModBase | Search... |
Protein-protein interaction databases | |
| DIP | DIP-47319N. |
| IntAct | Q659C4. 1 interaction. |
PTM databases | |
| PhosphoSite | Q659C4. |
Polymorphism databases | |
| DMDM | 158564329. |
Proteomic databases | |
| PRIDE | Q659C4. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000326639; ENSP00000321997; ENSG00000138709. |
| GeneID | 55132. |
| KEGG | hsa:55132. |
| UCSC | uc003ifx.1. human. uc003ifz.1. human. uc003iga.1. human. uc003igc.2. human. uc003igf.1. human. |
Organism-specific databases | |
| CTD | 55132. |
| GeneCards | GC04P128983. |
| HGNC | HGNC:24704. LARP1B. |
| HPA | HPA036280. |
| neXtProt | NX_Q659C4. |
| PharmGKB | PA142671565. PA165664174. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | prNOG10846. |
| GeneTree | ENSGT00390000000523. |
| InParanoid | Q659C4. |
| OMA | YQEHGER. |
| OrthoDB | EOG4PZJ64. |
| PhylomeDB | Q659C4. |
Gene expression databases | |
| ArrayExpress | Q659C4. |
| Bgee | Q659C4. |
| CleanEx | HS_LARP2. |
| Genevestigator | Q659C4. |
Family and domain databases | |
| InterPro | IPR006607. DM15. IPR006630. Lupus_La_RNA-bd. IPR011991. WHTH_trsnscrt_rep_DNA-bd. [Graphical view] |
| Gene3D | G3DSA:1.10.10.10. Wing_hlx_DNA_bd. 1 hit. |
| Pfam | PF05383. La. 1 hit. [Graphical view] |
| SMART | SM00684. DM15. 3 hits. SM00715. LA. 1 hit. [Graphical view] |
| PROSITE | PS50961. HTH_LA. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 58806. |
Entry information
| Entry name | LAR1B_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q659C4 Secondary accession number(s): Q2YDB6 Q9NW12 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 4 Human chromosome 4: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| SIMILARITY comments Index of protein domains and families |

Clusters with