Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

La-related protein 1B

Gene

LARP1B

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

GO - Molecular functioni

  • poly(A) RNA binding Source: UniProtKB
Complete GO annotation...

Keywords - Ligandi

RNA-binding

Names & Taxonomyi

Protein namesi
Recommended name:
La-related protein 1B
Alternative name(s):
La ribonucleoprotein domain family member 1B
La ribonucleoprotein domain family member 2
La-related protein 2
Gene namesi
Name:LARP1B
Synonyms:LARP2
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 4

Organism-specific databases

HGNCiHGNC:24704. LARP1B.

Subcellular locationi

GO - Cellular componenti

  • nucleus Source: UniProtKB
Complete GO annotation...

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000138709.
PharmGKBiPA165664174.

Polymorphism and mutation databases

DMDMi158564329.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002994111 – 914La-related protein 1BAdd BLAST914

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei60PhosphoserineCombined sources1
Modified residuei327PhosphoserineCombined sources1
Modified residuei329PhosphothreonineCombined sources1
Modified residuei335PhosphoserineCombined sources1
Modified residuei340PhosphoserineCombined sources1
Modified residuei343PhosphoserineCombined sources1
Modified residuei427PhosphothreonineCombined sources1
Modified residuei432PhosphoserineCombined sources1
Modified residuei436PhosphoserineCombined sources1
Modified residuei454PhosphothreonineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ659C4.
MaxQBiQ659C4.
PaxDbiQ659C4.
PeptideAtlasiQ659C4.
PRIDEiQ659C4.

PTM databases

iPTMnetiQ659C4.
PhosphoSitePlusiQ659C4.

Expressioni

Gene expression databases

BgeeiENSG00000138709.
CleanExiHS_LARP2.
ExpressionAtlasiQ659C4. baseline and differential.
GenevisibleiQ659C4. HS.

Organism-specific databases

HPAiHPA036280.
HPA036281.

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
KIF2AO001393EBI-3940258,EBI-2692369
TRIM69Q86WT63EBI-3940258,EBI-749955

Protein-protein interaction databases

BioGridi120438. 27 interactors.
DIPiDIP-47319N.
IntActiQ659C4. 11 interactors.
STRINGi9606.ENSP00000321997.

Structurei

3D structure databases

ProteinModelPortaliQ659C4.
SMRiQ659C4.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini209 – 299HTH La-type RNA-bindingPROSITE-ProRule annotationAdd BLAST91

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi114 – 167Arg-richAdd BLAST54

Sequence similaritiesi

Belongs to the LARP family.Curated
Contains 1 HTH La-type RNA-binding domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiKOG2590. Eukaryota.
COG5193. LUCA.
GeneTreeiENSGT00390000000523.
InParanoidiQ659C4.
KOiK18757.
OMAiMSQAKIT.
OrthoDBiEOG091G02X0.
PhylomeDBiQ659C4.
TreeFamiTF314516.

Family and domain databases

Gene3Di1.10.10.10. 1 hit.
InterProiIPR006607. DM15.
IPR006630. Lupus_La_RNA-bd.
IPR011991. WHTH_DNA-bd_dom.
[Graphical view]
PfamiPF05383. La. 1 hit.
[Graphical view]
SMARTiSM00684. DM15. 3 hits.
SM00715. LA. 1 hit.
[Graphical view]
SUPFAMiSSF46785. SSF46785. 1 hit.
PROSITEiPS50961. HTH_LA. 1 hit.
[Graphical view]

Sequences (9)i

Sequence statusi: Complete.

This entry describes 9 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q659C4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MENWPTPSEL VNTGFQSVLS QGNKKPQNRK EKEEKVEKRS NSDSKENRET
60 70 80 90 100
KLNGPGENVS EDEAQSSNQR KRANKHKWVP LHLDVVRSES QERPGSRNSS
110 120 130 140 150
RCQPEANKPT HNNRRNDTRS WKRDREKRDD QDDVSSVRSE GGNIRGSFRG
160 170 180 190 200
RGRGRGRGRG RGRGNPRLNF DYSYGYQEHG ERTDQPFQTE LNTSMMYYYD
210 220 230 240 250
DGTGVQVYPV EEALLKEYIK RQIEYYFSVE NLERDFFLRG KMDEQGFLPI
260 270 280 290 300
SLIAGFQRVQ ALTTNLNLIL EALKDSTEVE IVDEKMRKKI EPEKWPIPGP
310 320 330 340 350
PPRSVPPTDF SQLIDCPEFV PGQAFCSHTE SAPNSPRIGS PLSPKKNSET
360 370 380 390 400
SILQAMSRGL STSLPDLDSE PWIEVKKRHQ PAPVKLRESV SVPEGSLNQL
410 420 430 440 450
CSSEEPEQEE LDFLFDEEIE QIGRKNTFTD WSDNDSDYEI DDQDLNKILI
460 470 480 490 500
VTQTPPYVKK HPGGDRTGTH MSRAKITSEL AKVINDGLYY YEQDLWMEED
510 520 530 540 550
ENKHTAIKQE VENFKKLNLI SKEQFENLTP ELPFEPNQEV PVAPSQSRQG
560 570 580 590 600
GVQGVLHIPK KDLTDELAQK LFDVSEITSA AMVHSLPTAV PESPRIHPTR
610 620 630 640 650
TPKTPRTPRL QDPNKTPRFY PVVKEPKAID VKSPRKRKTR HSTNPPLECH
660 670 680 690 700
VGWVMDSRDR GPGTSSVSTS NASPSEGAPL AGSYGCTPHS FPKFQHPSHE
710 720 730 740 750
LLKENGFTQQ VYHKYRRRCL SERKRLGIGQ SQEMNTLFRF WSFFLRDHFN
760 770 780 790 800
KKMYEEFRQL AWEDAKENYR YGLECLFRFY SYGLEKKFRR EIFQDFQEET
810 820 830 840 850
KKDYESGQLY GLEKFWAYLK YSQSKTQSID PKLQEYLCSF KRLEDFRVDP
860 870 880 890 900
PISDEFGRKR HSSTSGEESN RHRLPPNSST KPPNAAKPTS TSELQVPINS
910
PRRNISPESS DNSH
Length:914
Mass (Da):105,322
Last modified:September 11, 2007 - v2
Checksum:iA06968F316A432BC
GO
Isoform 2 (identifier: Q659C4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     73-120: ANKHKWVPLHLDVVRSESQERPGSRNSSRCQPEANKPTHNNRRNDTRS → G
     550-561: Missing.

Show »
Length:855
Mass (Da):98,592
Checksum:i0F0C4F2E5FDB77C5
GO
Isoform 3 (identifier: Q659C4-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     330-335: ESAPNS → VRVMIF
     336-914: Missing.

Show »
Length:335
Mass (Da):38,760
Checksum:iC9C6E17E4B69EDC0
GO
Isoform 4 (identifier: Q659C4-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-194: Missing.
     509-522: QEVENFKKLNLISK → VIVSGQHLSTDALF
     523-914: Missing.

Show »
Length:328
Mass (Da):37,423
Checksum:iAE95BD2DD32EF435
GO
Isoform 5 (identifier: Q659C4-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-581: Missing.
     850-914: PPISDEFGRK...ISPESSDNSH → NHHDRLLLLIINI

Show »
Length:281
Mass (Da):33,365
Checksum:iFCEA078CC09712CD
GO
Isoform 6 (identifier: Q659C4-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-654: Missing.
     896-914: VPINSPRRNISPESSDNSH → EADPIE

Show »
Length:247
Mass (Da):29,074
Checksum:iA588465BD3DFFB00
GO
Isoform 7 (identifier: Q659C4-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-654: Missing.
     850-914: PPISDEFGRKRHSSTSGEESNRHRLPPNSSTKPPNAAKPTSTSELQVPINSPRRNISPESSDNSH → EADPIE

Show »
Length:201
Mass (Da):24,078
Checksum:iB719AE1095269FA0
GO
Isoform 8 (identifier: Q659C4-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-790: Missing.
     791-806: EIFQDFQEETKKDYES → MRNLDNLLGKMQKKIT

Show »
Length:124
Mass (Da):14,193
Checksum:iADF0FC1FEAEFB368
GO
Isoform 9 (identifier: Q659C4-9) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     771-787: YGLECLFRFYSYGLEKK → SAVWTRKVLGLFEIFSI
     788-914: Missing.

Show »
Length:787
Mass (Da):90,405
Checksum:i53CDFB5EA4C8A79A
GO

Sequence cautioni

The sequence AAH50654 differs from that shown. Reason: Frameshift at position 753.Curated
The sequence AAH50654 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence BAB15679 differs from that shown. Reason: Frameshift at position 721.Curated
The sequence CAH56379 differs from that shown. Reason: Frameshift at position 113.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti272A → V in BAC03970 (PubMed:14702039).Curated1
Sequence conflicti289K → E in BAA91576 (PubMed:14702039).Curated1
Sequence conflicti291E → T in BAC05306 (PubMed:14702039).Curated1
Sequence conflicti473R → Q in BAC03970 (PubMed:14702039).Curated1
Sequence conflicti639T → A in CAD97908 (PubMed:17974005).Curated1
Sequence conflicti671N → S in AAH62606 (PubMed:15489334).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_034813462P → R.2 PublicationsCorresponds to variant rs12508837dbSNPEnsembl.1
Natural variantiVAR_034814660R → H.2 PublicationsCorresponds to variant rs12645577dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0276381 – 790Missing in isoform 8. 1 PublicationAdd BLAST790
Alternative sequenceiVSP_0276391 – 654Missing in isoform 6 and isoform 7. 1 PublicationAdd BLAST654
Alternative sequenceiVSP_0276401 – 581Missing in isoform 5. 1 PublicationAdd BLAST581
Alternative sequenceiVSP_0276411 – 194Missing in isoform 4. 1 PublicationAdd BLAST194
Alternative sequenceiVSP_02764273 – 120ANKHK…NDTRS → G in isoform 2. 1 PublicationAdd BLAST48
Alternative sequenceiVSP_027643330 – 335ESAPNS → VRVMIF in isoform 3. 1 Publication6
Alternative sequenceiVSP_027644336 – 914Missing in isoform 3. 1 PublicationAdd BLAST579
Alternative sequenceiVSP_027645509 – 522QEVEN…NLISK → VIVSGQHLSTDALF in isoform 4. 1 PublicationAdd BLAST14
Alternative sequenceiVSP_027646523 – 914Missing in isoform 4. 1 PublicationAdd BLAST392
Alternative sequenceiVSP_027647550 – 561Missing in isoform 2. 1 PublicationAdd BLAST12
Alternative sequenceiVSP_027648771 – 787YGLEC…GLEKK → SAVWTRKVLGLFEIFSI in isoform 9. 1 PublicationAdd BLAST17
Alternative sequenceiVSP_027649788 – 914Missing in isoform 9. 1 PublicationAdd BLAST127
Alternative sequenceiVSP_027650791 – 806EIFQD…KDYES → MRNLDNLLGKMQKKIT in isoform 8. 1 PublicationAdd BLAST16
Alternative sequenceiVSP_027651850 – 914PPISD…SDNSH → NHHDRLLLLIINI in isoform 5. 1 PublicationAdd BLAST65
Alternative sequenceiVSP_027652850 – 914PPISD…SDNSH → EADPIE in isoform 7. 1 PublicationAdd BLAST65
Alternative sequenceiVSP_027653896 – 914VPINS…SDNSH → EADPIE in isoform 6. 1 PublicationAdd BLAST19

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK001240 mRNA. Translation: BAA91576.1.
AK027164 mRNA. Translation: BAB15679.1. Frameshift.
AK092764 mRNA. Translation: BAC03970.1.
AK098437 mRNA. Translation: BAC05306.1.
AL137759 mRNA. Translation: CAH56379.1. Frameshift.
AL832170 mRNA. Translation: CAH56210.1.
BX537937 mRNA. Translation: CAD97908.1.
AC096898 Genomic DNA. No translation available.
AC099340 Genomic DNA. No translation available.
AC108045 Genomic DNA. No translation available.
AC114735 Genomic DNA. Translation: AAY41042.1.
AC124030 Genomic DNA. Translation: AAY41031.1.
BC030516 mRNA. Translation: AAH30516.1.
BC050654 mRNA. Translation: AAH50654.1. Sequence problems.
BC062606 mRNA. Translation: AAH62606.1.
BC110300 mRNA. Translation: AAI10301.1.
CCDSiCCDS3738.1. [Q659C4-1]
CCDS64057.1. [Q659C4-3]
RefSeqiNP_001265533.1. NM_001278604.1. [Q659C4-3]
NP_060548.2. NM_018078.3. [Q659C4-1]
NP_115615.2. NM_032239.3.
NP_835144.1. NM_178043.2.
XP_011530371.1. XM_011532069.1. [Q659C4-2]
XP_016863842.1. XM_017008353.1. [Q659C4-3]
UniGeneiHs.657067.

Genome annotation databases

EnsembliENST00000326639; ENSP00000321997; ENSG00000138709. [Q659C4-1]
ENST00000394288; ENSP00000377829; ENSG00000138709. [Q659C4-3]
GeneIDi55132.
KEGGihsa:55132.
UCSCiuc003ify.5. human. [Q659C4-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK001240 mRNA. Translation: BAA91576.1.
AK027164 mRNA. Translation: BAB15679.1. Frameshift.
AK092764 mRNA. Translation: BAC03970.1.
AK098437 mRNA. Translation: BAC05306.1.
AL137759 mRNA. Translation: CAH56379.1. Frameshift.
AL832170 mRNA. Translation: CAH56210.1.
BX537937 mRNA. Translation: CAD97908.1.
AC096898 Genomic DNA. No translation available.
AC099340 Genomic DNA. No translation available.
AC108045 Genomic DNA. No translation available.
AC114735 Genomic DNA. Translation: AAY41042.1.
AC124030 Genomic DNA. Translation: AAY41031.1.
BC030516 mRNA. Translation: AAH30516.1.
BC050654 mRNA. Translation: AAH50654.1. Sequence problems.
BC062606 mRNA. Translation: AAH62606.1.
BC110300 mRNA. Translation: AAI10301.1.
CCDSiCCDS3738.1. [Q659C4-1]
CCDS64057.1. [Q659C4-3]
RefSeqiNP_001265533.1. NM_001278604.1. [Q659C4-3]
NP_060548.2. NM_018078.3. [Q659C4-1]
NP_115615.2. NM_032239.3.
NP_835144.1. NM_178043.2.
XP_011530371.1. XM_011532069.1. [Q659C4-2]
XP_016863842.1. XM_017008353.1. [Q659C4-3]
UniGeneiHs.657067.

3D structure databases

ProteinModelPortaliQ659C4.
SMRiQ659C4.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi120438. 27 interactors.
DIPiDIP-47319N.
IntActiQ659C4. 11 interactors.
STRINGi9606.ENSP00000321997.

PTM databases

iPTMnetiQ659C4.
PhosphoSitePlusiQ659C4.

Polymorphism and mutation databases

DMDMi158564329.

Proteomic databases

EPDiQ659C4.
MaxQBiQ659C4.
PaxDbiQ659C4.
PeptideAtlasiQ659C4.
PRIDEiQ659C4.

Protocols and materials databases

DNASUi55132.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000326639; ENSP00000321997; ENSG00000138709. [Q659C4-1]
ENST00000394288; ENSP00000377829; ENSG00000138709. [Q659C4-3]
GeneIDi55132.
KEGGihsa:55132.
UCSCiuc003ify.5. human. [Q659C4-1]

Organism-specific databases

CTDi55132.
GeneCardsiLARP1B.
HGNCiHGNC:24704. LARP1B.
HPAiHPA036280.
HPA036281.
neXtProtiNX_Q659C4.
OpenTargetsiENSG00000138709.
PharmGKBiPA165664174.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG2590. Eukaryota.
COG5193. LUCA.
GeneTreeiENSGT00390000000523.
InParanoidiQ659C4.
KOiK18757.
OMAiMSQAKIT.
OrthoDBiEOG091G02X0.
PhylomeDBiQ659C4.
TreeFamiTF314516.

Miscellaneous databases

ChiTaRSiLARP1B. human.
GenomeRNAii55132.
PROiQ659C4.

Gene expression databases

BgeeiENSG00000138709.
CleanExiHS_LARP2.
ExpressionAtlasiQ659C4. baseline and differential.
GenevisibleiQ659C4. HS.

Family and domain databases

Gene3Di1.10.10.10. 1 hit.
InterProiIPR006607. DM15.
IPR006630. Lupus_La_RNA-bd.
IPR011991. WHTH_DNA-bd_dom.
[Graphical view]
PfamiPF05383. La. 1 hit.
[Graphical view]
SMARTiSM00684. DM15. 3 hits.
SM00715. LA. 1 hit.
[Graphical view]
SUPFAMiSSF46785. SSF46785. 1 hit.
PROSITEiPS50961. HTH_LA. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiLAR1B_HUMAN
AccessioniPrimary (citable) accession number: Q659C4
Secondary accession number(s): Q2YDB6
, Q4W599, Q4W5B2, Q659A0, Q6P5X2, Q7Z3F7, Q86VK7, Q8N6F4, Q8N7H4, Q8NAF2, Q9H5E7, Q9NW12
Entry historyi
Integrated into UniProtKB/Swiss-Prot: September 11, 2007
Last sequence update: September 11, 2007
Last modified: November 30, 2016
This is version 101 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 4
    Human chromosome 4: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.