Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q64605 (PTPRS_RAT) Reviewed, UniProtKB/Swiss-Prot

Last modified June 11, 2014. Version 104. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (2) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Receptor-type tyrosine-protein phosphatase S

Short name=R-PTP-S
EC=3.1.3.48
Alternative name(s):
Leukocyte common antigen-related protein-tyrosine phosphatase 2
Short name=LAR-PTP2
Receptor-type tyrosine-protein phosphatase sigma
Short name=R-PTP-sigma
Gene names
Name:Ptprs
OrganismRattus norvegicus (Rat) [Reference proteome]
Taxonomic identifier10116 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeRattus

Protein attributes

Sequence length1907 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is further processed into a mature form.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Interacts with LAR-interacting protein LIP.1 By similarity.

Catalytic activity

Protein tyrosine phosphate + H2O = protein tyrosine + phosphate.

Subunit structure

Interacts with PPFIA1, PPFIA2 and PPFIA3 By similarity.

Subcellular location

Membrane; Single-pass type I membrane protein By similarity.

Tissue specificity

Detected in heart, testis and liver. Detected at lower levels in skeletal muscle, brain, spleen and kidney. Ref.1

Post-translational modification

A cleavage occurs, separating the extracellular domain from the transmembrane segment. This process called 'ectodomain shedding' is thought to be involved in receptor desensitization, signal transduction and/or membrane localization By similarity.

Sequence similarities

Belongs to the protein-tyrosine phosphatase family. Receptor class 2A subfamily.

Contains 8 fibronectin type-III domains.

Contains 3 Ig-like C2-type (immunoglobulin-like) domains.

Contains 2 tyrosine-protein phosphatase domains.

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q64605-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q64605-2)

The sequence of this isoform differs from the canonical sequence as follows:
     624-668: VSWRPPPPETHNGALVGYSVRYRPLGSEDPDPKEVNNIPPTTTQI → I

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Signal peptide1 – 2929 Potential
Chain30 – 19071878Receptor-type tyrosine-protein phosphatase S
PRO_5000142153

Regions

Topological domain30 – 12571228Extracellular Potential
Transmembrane1258 – 127821Helical; Potential
Topological domain1279 – 1907629Cytoplasmic Potential
Domain33 – 12391Ig-like C2-type 1
Domain135 – 22490Ig-like C2-type 2
Domain232 – 31483Ig-like C2-type 3
Domain321 – 41191Fibronectin type-III 1
Domain416 – 51095Fibronectin type-III 2
Domain514 – 60390Fibronectin type-III 3
Domain608 – 70598Fibronectin type-III 4
Domain710 – 809100Fibronectin type-III 5
Domain810 – 90697Fibronectin type-III 6
Domain907 – 1008102Fibronectin type-III 7
Domain1011 – 109585Fibronectin type-III 8
Domain1352 – 1607256Tyrosine-protein phosphatase 1
Domain1639 – 1898260Tyrosine-protein phosphatase 2
Region1548 – 15547Substrate binding By similarity

Sites

Active site15481Phosphocysteine intermediate By similarity
Active site18391Phosphocysteine intermediate By similarity
Binding site15161Substrate By similarity
Binding site15921Substrate By similarity
Site1172 – 11732Cleavage By similarity

Amino acid modifications

Glycosylation2501N-linked (GlcNAc...) Potential
Glycosylation2951N-linked (GlcNAc...) Potential
Glycosylation7201N-linked (GlcNAc...) Potential
Glycosylation9161N-linked (GlcNAc...) Potential
Disulfide bond54 ↔ 107 By similarity
Disulfide bond156 ↔ 207 By similarity
Disulfide bond253 ↔ 298 By similarity

Natural variations

Alternative sequence624 – 66845VSWRP…TTTQI → I in isoform 2.
VSP_026932

Experimental info

Sequence conflict5971R → C in AAC37656. Ref.1
Sequence conflict7531A → T in AAC37656. Ref.1
Sequence conflict9131A → P in AAC37656. Ref.1
Sequence conflict9341R → G in AAC37656. Ref.1
Sequence conflict9501A → T in AAC37656. Ref.1

Secondary structure

.............................................. 1907
Helix Strand Turn

Details...

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified July 24, 2007. Version 2.
Checksum: 5CD377A88377CDA4

FASTA1,907211,931
        10         20         30         40         50         60 
MAPTWRPSVV SVVGPVGLFL VLLARGCLAE EPPRFIREPK DQIGVSGGVA SFVCQATGDP 

        70         80         90        100        110        120 
KPRVTWNKKG KKVNSQRFET IDFDESSGAV LRIQPLRTPR DENVYECVAQ NSVGEITVHA 

       130        140        150        160        170        180 
KLTVLREDQL PPGFPNIDMG PQLKVVERTR TATMLCAASG NPDPEITWFK DFLPVDPSAS 

       190        200        210        220        230        240 
NGRIKQLRSG ALQIESSEET DQGKYECVAT NSAGVRYSSP ANLYVRVRRV APRFSILPMS 

       250        260        270        280        290        300 
HEIMPGGNVN ITCVAVGSPM PYVKWMQGAE DLTPEDDMPV GRNVLELTDV KDSANYTCVA 

       310        320        330        340        350        360 
MSSLGVIEAV AQITVKSLPK APGTPVVTEN TATSITVTWD SGNPDPVSYY VIEYKSKSQD 

       370        380        390        400        410        420 
GPYQIKEDIT TTRYSIGGLS PNSEYEIWVS AVNSIGQGPP SESVVTRTGE QAPASAPRNV 

       430        440        450        460        470        480 
QARMLSATTM IVQWEEPVEP NGLIRGYRVY YTMEPEHPVG NWQKHNVDDS LLTTVGSLLE 

       490        500        510        520        530        540 
DETYTVRVLA FTSVGDGPLS DPIQVKTQQG VPGQPMNLRA EAKSETSIGL SWSAPRQESV 

       550        560        570        580        590        600 
IKYELLFREG DRGREVGRTF DPTTAFVVED LKPNTEYAFR LAARSPQGLG AFTAVVRQRT 

       610        620        630        640        650        660 
LQAKPSAPPQ DVKCTSLRST AILVSWRPPP PETHNGALVG YSVRYRPLGS EDPDPKEVNN 

       670        680        690        700        710        720 
IPPTTTQILL EALEKWTEYR VTAVAYTEVG PGPESSPVVV RTDEDVPSAP PRKVEAEALN 

       730        740        750        760        770        780 
ATAIRVLWRS PTPGRQHGQI RGYQVHYVRM EGAEARGPPR IKDIMLADAQ EMVITNLQPE 

       790        800        810        820        830        840 
TAYSITVAAY TMKGDGARSK PKVVVTKGAV LGRPTLSVQQ TPEGSLLARW EPPADAAEDP 

       850        860        870        880        890        900 
VLGYRLQFGR EDAAPATLEL AAWERRFAAP AHKGATYVFR LAARGRAGLG EEASAALSIP 

       910        920        930        940        950        960 
EDAPRGFPQI LGAAGNVSAG SVILRWLPPV PAERNGAIIK YTVSVREAGA PGPATETELA 

       970        980        990       1000       1010       1020 
AAAQPGAETA LTLQGLRPET AYELRVRAHT RRGPGPFSPP LRYRLARDPV SPKNFKVKMI 

      1030       1040       1050       1060       1070       1080 
MKTSVLLSWE FPDNYNSPTP YKIQYNGLTL DVDGRTTKKL ITHLKPHTFY NFVLTNRGSS 

      1090       1100       1110       1120       1130       1140 
LGGLQQTVTA RTAFNMLSGK PSVAPKPDND GSIVVYLPDG QSPVTVQNYF IVMVPLRKSR 

      1150       1160       1170       1180       1190       1200 
GGQFPILLGS PEDMDLEELI QDLSRLQRRS LRHSRQLEVP RPYIAARFSI LPAVFHPGNQ 

      1210       1220       1230       1240       1250       1260 
KQYGGFDNRG LEPGHRYVLF VLAVLQKNEP TFAASPFSDP FQLDNPDPQP IVDGEEGLIW 

      1270       1280       1290       1300       1310       1320 
VIGPVLAVVF IICIVIAILL YKNKPDSKRK DSEPRTKCLL NNADLAPHHP KDPVEMRRIN 

      1330       1340       1350       1360       1370       1380 
FQTPGMLSHP PIPITDMAEH MERLKANDSL KLSQEYESID PGQQFTWEHS NLEANKPKNR 

      1390       1400       1410       1420       1430       1440 
YANVIAYDHS RVILQPLEGI MGSDYINANY VDGYRRQNAY IATQGPLPET FGDFWRMVWE 

      1450       1460       1470       1480       1490       1500 
QRSATVVMMT RLEEKSRVKC DQYWPNRGTE TYGFIQVTLL DTMELATFCV RTFSLHKNGS 

      1510       1520       1530       1540       1550       1560 
SEKREVRHFQ FTAWPDHGVP EYPTPFLAFL RRVKTCNPPD AGPVVVHCSA GVGRTGCFIV 

      1570       1580       1590       1600       1610       1620 
IDAMLERIRT EKTVDVYGHV TLMRSQRNYM VQTEDQYSFI HEALLEAVGC GNTEVPARSL 

      1630       1640       1650       1660       1670       1680 
YTYIQKLAQV EPGEHVTGME LEFKRLASSK AHTSRFITAS LPCNKFKNRL VNILPYESSR 

      1690       1700       1710       1720       1730       1740 
VCLQPIRGVE GSDYINASFI DGYRQQKAYI ATQGPLAETT EDFWRALWEN NSTIVVMLTK 

      1750       1760       1770       1780       1790       1800 
LREMGREKCH QYWPAERSAR YQYFVVDPMA EYNMPQYILR EFKVTDARDG QSRTVRQFQF 

      1810       1820       1830       1840       1850       1860 
TDWPEQGAPK SGEGFIDFIG QVHKTKEQFG QDGPISVHCS AGVGRTGVFI TLSIVLERMR 

      1870       1880       1890       1900 
YEGVVDIFQT VKVLRTQRPA MVQTEDEYQF CFQAALEYLG SFDHYAT 

« Hide

Isoform 2 [UniParc].

Checksum: 78BA7E27A7A772F0
Show »

FASTA1,863207,079

References

« Hide 'large scale' references
[1]"Molecular cloning and expression of a unique receptor-like protein-tyrosine-phosphatase in the leucocyte-common-antigen-related phosphate family."
Zhang W.-R., Hashimoto N., Ahmad F., Ding W., Goldstein B.J.
Biochem. J. 302:39-47(1994) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), CHARACTERIZATION, TISSUE SPECIFICITY.
Strain: Sprague-Dawley.
Tissue: Liver.
[2]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Prostate.
[3]"Structural genomics of protein phosphatases."
Almo S.C., Bonanno J.B., Sauder J.M., Emtage S., Dilorenzo T.P., Malashkevich V., Wasserman S.R., Swaminathan S., Eswaramoorthy S., Agarwal R., Kumaran D., Madegowda M., Ragumani S., Patskovsky Y., Alvarado J., Ramagopal U.A., Faber-Barata J., Chance M.R. expand/collapse author list , Sali A., Fiser A., Zhang Z.Y., Lawrence D.S., Burley S.K.
J. Struct. Funct. Genomics 8:121-140(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: X-RAY CRYSTALLOGRAPHY (2.0 ANGSTROMS) OF 1328-1614.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
L11587 mRNA. Translation: AAC37656.1.
BC105753 mRNA. Translation: AAI05754.1.
PIRI58148.
S46217.
RefSeqNP_062013.1. NM_019140.2.
UniGeneRn.91202.

3D structure databases

PDBe
RCSB-PDB
PDBj
EntryMethodResolution (Å)ChainPositionsPDBsum
2NV5X-ray2.00A/B/C1328-1614[»]
ProteinModelPortalQ64605.
SMRQ64605. Positions 317-510, 1326-1901.
ModBaseSearch...
MobiDBSearch...

Chemistry

BindingDBQ64605.

PTM databases

PhosphoSiteQ64605.

Proteomic databases

PRIDEQ64605.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

GeneID25529.
KEGGrno:25529.

Organism-specific databases

CTD5802.
RGD3452. Ptprs.

Phylogenomic databases

HOVERGENHBG053758.
KOK06778.
PhylomeDBQ64605.

Gene expression databases

GenevestigatorQ64605.

Family and domain databases

Gene3D2.60.40.10. 10 hits.
3.90.190.10. 2 hits.
InterProIPR003961. Fibronectin_type3.
IPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR013098. Ig_I-set.
IPR003598. Ig_sub2.
IPR029021. Prot-tyrosine_phosphatase-like.
IPR000387. Tyr/Dual-sp_Pase.
IPR016130. Tyr_Pase_AS.
IPR000242. Tyr_Pase_rcpt/non-rcpt.
[Graphical view]
PfamPF00041. fn3. 6 hits.
PF07679. I-set. 3 hits.
PF00102. Y_phosphatase. 2 hits.
[Graphical view]
PRINTSPR00700. PRTYPHPHTASE.
SMARTSM00060. FN3. 8 hits.
SM00408. IGc2. 3 hits.
SM00194. PTPc. 2 hits.
[Graphical view]
SUPFAMSSF49265. SSF49265. 5 hits.
SSF52799. SSF52799. 2 hits.
PROSITEPS50853. FN3. 8 hits.
PS50835. IG_LIKE. 3 hits.
PS00383. TYR_PHOSPHATASE_1. 2 hits.
PS50056. TYR_PHOSPHATASE_2. 2 hits.
PS50055. TYR_PHOSPHATASE_PTP. 2 hits.
[Graphical view]
ProtoNetSearch...

Other

EvolutionaryTraceQ64605.
NextBio607019.

Entry information

Entry namePTPRS_RAT
AccessionPrimary (citable) accession number: Q64605
Secondary accession number(s): Q07808 expand/collapse secondary AC list , Q3KRE9, Q64621, Q64675
Entry history
Integrated into UniProtKB/Swiss-Prot: July 24, 2007
Last sequence update: July 24, 2007
Last modified: June 11, 2014
This is version 104 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Relevant documents

SIMILARITY comments

Index of protein domains and families

PDB cross-references

Index of Protein Data Bank (PDB) cross-references