Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q64605

- PTPRS_RAT

UniProt

Q64605 - PTPRS_RAT

Protein

Receptor-type tyrosine-protein phosphatase S

Gene

Ptprs

Organism
Rattus norvegicus (Rat)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 105 (01 Oct 2014)
      Sequence version 2 (24 Jul 2007)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Interacts with LAR-interacting protein LIP.1.By similarity

    Catalytic activityi

    Protein tyrosine phosphate + H2O = protein tyrosine + phosphate.PROSITE-ProRule annotation

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sitei1172 – 11732CleavageBy similarity
    Binding sitei1516 – 15161SubstrateBy similarity
    Active sitei1548 – 15481Phosphocysteine intermediateBy similarity
    Binding sitei1592 – 15921SubstrateBy similarity
    Active sitei1839 – 18391Phosphocysteine intermediateBy similarity

    GO - Molecular functioni

    1. protein tyrosine phosphatase activity Source: RGD

    GO - Biological processi

    1. cell adhesion Source: UniProtKB-KW
    2. peptidyl-tyrosine dephosphorylation Source: GOC

    Keywords - Molecular functioni

    Hydrolase, Protein phosphatase, Receptor

    Keywords - Biological processi

    Cell adhesion

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Receptor-type tyrosine-protein phosphatase S (EC:3.1.3.48)
    Short name:
    R-PTP-S
    Alternative name(s):
    Leukocyte common antigen-related protein-tyrosine phosphatase 2
    Short name:
    LAR-PTP2
    Receptor-type tyrosine-protein phosphatase sigma
    Short name:
    R-PTP-sigma
    Gene namesi
    Name:Ptprs
    OrganismiRattus norvegicus (Rat)
    Taxonomic identifieri10116 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeRattus
    ProteomesiUP000002494: Unplaced

    Organism-specific databases

    RGDi3452. Ptprs.

    Subcellular locationi

    Membrane By similarity; Single-pass type I membrane protein By similarity

    GO - Cellular componenti

    1. integral component of membrane Source: UniProtKB-KW

    Keywords - Cellular componenti

    Membrane

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Signal peptidei1 – 2929Sequence AnalysisAdd
    BLAST
    Chaini30 – 19071878Receptor-type tyrosine-protein phosphatase SPRO_5000142153Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Disulfide bondi54 ↔ 107PROSITE-ProRule annotation
    Disulfide bondi156 ↔ 207PROSITE-ProRule annotation
    Glycosylationi250 – 2501N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi253 ↔ 298PROSITE-ProRule annotation
    Glycosylationi295 – 2951N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi720 – 7201N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi916 – 9161N-linked (GlcNAc...)Sequence Analysis

    Post-translational modificationi

    A cleavage occurs, separating the extracellular domain from the transmembrane segment. This process called 'ectodomain shedding' is thought to be involved in receptor desensitization, signal transduction and/or membrane localization By similarity.By similarity

    Keywords - PTMi

    Disulfide bond, Glycoprotein

    Proteomic databases

    PRIDEiQ64605.

    PTM databases

    PhosphoSiteiQ64605.

    Expressioni

    Tissue specificityi

    Detected in heart, testis and liver. Detected at lower levels in skeletal muscle, brain, spleen and kidney.1 Publication

    Gene expression databases

    GenevestigatoriQ64605.

    Interactioni

    Subunit structurei

    Interacts with PPFIA1, PPFIA2 and PPFIA3.By similarity

    Structurei

    Secondary structure

    1
    1907
    Legend: HelixTurnBeta strand
    Show more details
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Helixi1334 – 13363
    Helixi1337 – 135822
    Helixi1369 – 13713
    Turni1373 – 13753
    Helixi1376 – 13783
    Helixi1388 – 13903
    Beta strandi1391 – 13933
    Turni1401 – 14044
    Beta strandi1405 – 14139
    Beta strandi1416 – 14238
    Helixi1428 – 14303
    Helixi1431 – 144010
    Beta strandi1445 – 14484
    Beta strandi1452 – 14543
    Beta strandi1457 – 14604
    Beta strandi1466 – 14727
    Beta strandi1475 – 148410
    Beta strandi1486 – 149712
    Beta strandi1504 – 15118
    Beta strandi1516 – 15194
    Helixi1524 – 153613
    Beta strandi1544 – 155310
    Helixi1554 – 157118
    Beta strandi1572 – 15743
    Helixi1576 – 15849
    Helixi1594 – 160815

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    EntryMethodResolution (Å)ChainPositionsPDBsum
    2NV5X-ray2.00A/B/C1328-1614[»]
    ProteinModelPortaliQ64605.
    SMRiQ64605. Positions 317-510, 1326-1901.
    ModBaseiSearch...
    MobiDBiSearch...

    Miscellaneous databases

    EvolutionaryTraceiQ64605.

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini30 – 12571228ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini1279 – 1907629CytoplasmicSequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei1258 – 127821HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini33 – 12391Ig-like C2-type 1Add
    BLAST
    Domaini135 – 22490Ig-like C2-type 2Add
    BLAST
    Domaini232 – 31483Ig-like C2-type 3Add
    BLAST
    Domaini321 – 41191Fibronectin type-III 1PROSITE-ProRule annotationAdd
    BLAST
    Domaini416 – 51095Fibronectin type-III 2PROSITE-ProRule annotationAdd
    BLAST
    Domaini514 – 60390Fibronectin type-III 3PROSITE-ProRule annotationAdd
    BLAST
    Domaini608 – 70598Fibronectin type-III 4PROSITE-ProRule annotationAdd
    BLAST
    Domaini710 – 809100Fibronectin type-III 5PROSITE-ProRule annotationAdd
    BLAST
    Domaini810 – 90697Fibronectin type-III 6PROSITE-ProRule annotationAdd
    BLAST
    Domaini907 – 1008102Fibronectin type-III 7PROSITE-ProRule annotationAdd
    BLAST
    Domaini1011 – 109585Fibronectin type-III 8PROSITE-ProRule annotationAdd
    BLAST
    Domaini1352 – 1607256Tyrosine-protein phosphatase 1PROSITE-ProRule annotationAdd
    BLAST
    Domaini1639 – 1898260Tyrosine-protein phosphatase 2PROSITE-ProRule annotationAdd
    BLAST

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni1548 – 15547Substrate bindingBy similarity

    Sequence similaritiesi

    Contains 8 fibronectin type-III domains.PROSITE-ProRule annotation
    Contains 2 tyrosine-protein phosphatase domains.PROSITE-ProRule annotation

    Keywords - Domaini

    Immunoglobulin domain, Repeat, Signal, Transmembrane, Transmembrane helix

    Phylogenomic databases

    HOVERGENiHBG053758.
    KOiK06778.
    PhylomeDBiQ64605.

    Family and domain databases

    Gene3Di2.60.40.10. 10 hits.
    3.90.190.10. 2 hits.
    InterProiIPR003961. Fibronectin_type3.
    IPR007110. Ig-like_dom.
    IPR013783. Ig-like_fold.
    IPR013098. Ig_I-set.
    IPR003598. Ig_sub2.
    IPR029021. Prot-tyrosine_phosphatase-like.
    IPR000387. Tyr/Dual-sp_Pase.
    IPR016130. Tyr_Pase_AS.
    IPR000242. Tyr_Pase_rcpt/non-rcpt.
    [Graphical view]
    PfamiPF00041. fn3. 6 hits.
    PF07679. I-set. 3 hits.
    PF00102. Y_phosphatase. 2 hits.
    [Graphical view]
    PRINTSiPR00700. PRTYPHPHTASE.
    SMARTiSM00060. FN3. 8 hits.
    SM00408. IGc2. 3 hits.
    SM00194. PTPc. 2 hits.
    [Graphical view]
    SUPFAMiSSF49265. SSF49265. 5 hits.
    SSF52799. SSF52799. 2 hits.
    PROSITEiPS50853. FN3. 8 hits.
    PS50835. IG_LIKE. 3 hits.
    PS00383. TYR_PHOSPHATASE_1. 2 hits.
    PS50056. TYR_PHOSPHATASE_2. 2 hits.
    PS50055. TYR_PHOSPHATASE_PTP. 2 hits.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q64605-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MAPTWRPSVV SVVGPVGLFL VLLARGCLAE EPPRFIREPK DQIGVSGGVA     50
    SFVCQATGDP KPRVTWNKKG KKVNSQRFET IDFDESSGAV LRIQPLRTPR 100
    DENVYECVAQ NSVGEITVHA KLTVLREDQL PPGFPNIDMG PQLKVVERTR 150
    TATMLCAASG NPDPEITWFK DFLPVDPSAS NGRIKQLRSG ALQIESSEET 200
    DQGKYECVAT NSAGVRYSSP ANLYVRVRRV APRFSILPMS HEIMPGGNVN 250
    ITCVAVGSPM PYVKWMQGAE DLTPEDDMPV GRNVLELTDV KDSANYTCVA 300
    MSSLGVIEAV AQITVKSLPK APGTPVVTEN TATSITVTWD SGNPDPVSYY 350
    VIEYKSKSQD GPYQIKEDIT TTRYSIGGLS PNSEYEIWVS AVNSIGQGPP 400
    SESVVTRTGE QAPASAPRNV QARMLSATTM IVQWEEPVEP NGLIRGYRVY 450
    YTMEPEHPVG NWQKHNVDDS LLTTVGSLLE DETYTVRVLA FTSVGDGPLS 500
    DPIQVKTQQG VPGQPMNLRA EAKSETSIGL SWSAPRQESV IKYELLFREG 550
    DRGREVGRTF DPTTAFVVED LKPNTEYAFR LAARSPQGLG AFTAVVRQRT 600
    LQAKPSAPPQ DVKCTSLRST AILVSWRPPP PETHNGALVG YSVRYRPLGS 650
    EDPDPKEVNN IPPTTTQILL EALEKWTEYR VTAVAYTEVG PGPESSPVVV 700
    RTDEDVPSAP PRKVEAEALN ATAIRVLWRS PTPGRQHGQI RGYQVHYVRM 750
    EGAEARGPPR IKDIMLADAQ EMVITNLQPE TAYSITVAAY TMKGDGARSK 800
    PKVVVTKGAV LGRPTLSVQQ TPEGSLLARW EPPADAAEDP VLGYRLQFGR 850
    EDAAPATLEL AAWERRFAAP AHKGATYVFR LAARGRAGLG EEASAALSIP 900
    EDAPRGFPQI LGAAGNVSAG SVILRWLPPV PAERNGAIIK YTVSVREAGA 950
    PGPATETELA AAAQPGAETA LTLQGLRPET AYELRVRAHT RRGPGPFSPP 1000
    LRYRLARDPV SPKNFKVKMI MKTSVLLSWE FPDNYNSPTP YKIQYNGLTL 1050
    DVDGRTTKKL ITHLKPHTFY NFVLTNRGSS LGGLQQTVTA RTAFNMLSGK 1100
    PSVAPKPDND GSIVVYLPDG QSPVTVQNYF IVMVPLRKSR GGQFPILLGS 1150
    PEDMDLEELI QDLSRLQRRS LRHSRQLEVP RPYIAARFSI LPAVFHPGNQ 1200
    KQYGGFDNRG LEPGHRYVLF VLAVLQKNEP TFAASPFSDP FQLDNPDPQP 1250
    IVDGEEGLIW VIGPVLAVVF IICIVIAILL YKNKPDSKRK DSEPRTKCLL 1300
    NNADLAPHHP KDPVEMRRIN FQTPGMLSHP PIPITDMAEH MERLKANDSL 1350
    KLSQEYESID PGQQFTWEHS NLEANKPKNR YANVIAYDHS RVILQPLEGI 1400
    MGSDYINANY VDGYRRQNAY IATQGPLPET FGDFWRMVWE QRSATVVMMT 1450
    RLEEKSRVKC DQYWPNRGTE TYGFIQVTLL DTMELATFCV RTFSLHKNGS 1500
    SEKREVRHFQ FTAWPDHGVP EYPTPFLAFL RRVKTCNPPD AGPVVVHCSA 1550
    GVGRTGCFIV IDAMLERIRT EKTVDVYGHV TLMRSQRNYM VQTEDQYSFI 1600
    HEALLEAVGC GNTEVPARSL YTYIQKLAQV EPGEHVTGME LEFKRLASSK 1650
    AHTSRFITAS LPCNKFKNRL VNILPYESSR VCLQPIRGVE GSDYINASFI 1700
    DGYRQQKAYI ATQGPLAETT EDFWRALWEN NSTIVVMLTK LREMGREKCH 1750
    QYWPAERSAR YQYFVVDPMA EYNMPQYILR EFKVTDARDG QSRTVRQFQF 1800
    TDWPEQGAPK SGEGFIDFIG QVHKTKEQFG QDGPISVHCS AGVGRTGVFI 1850
    TLSIVLERMR YEGVVDIFQT VKVLRTQRPA MVQTEDEYQF CFQAALEYLG 1900
    SFDHYAT 1907
    Length:1,907
    Mass (Da):211,931
    Last modified:July 24, 2007 - v2
    Checksum:i5CD377A88377CDA4
    GO
    Isoform 2 (identifier: Q64605-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         624-668: VSWRPPPPETHNGALVGYSVRYRPLGSEDPDPKEVNNIPPTTTQI → I

    Show »
    Length:1,863
    Mass (Da):207,079
    Checksum:i78BA7E27A7A772F0
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti597 – 5971R → C in AAC37656. (PubMed:8068021)Curated
    Sequence conflicti753 – 7531A → T in AAC37656. (PubMed:8068021)Curated
    Sequence conflicti913 – 9131A → P in AAC37656. (PubMed:8068021)Curated
    Sequence conflicti934 – 9341R → G in AAC37656. (PubMed:8068021)Curated
    Sequence conflicti950 – 9501A → T in AAC37656. (PubMed:8068021)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei624 – 66845VSWRP…TTTQI → I in isoform 2. 1 PublicationVSP_026932Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    L11587 mRNA. Translation: AAC37656.1.
    BC105753 mRNA. Translation: AAI05754.1.
    PIRiI58148.
    S46217.
    RefSeqiNP_062013.1. NM_019140.2.
    UniGeneiRn.91202.

    Genome annotation databases

    GeneIDi25529.
    KEGGirno:25529.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    L11587 mRNA. Translation: AAC37656.1 .
    BC105753 mRNA. Translation: AAI05754.1 .
    PIRi I58148.
    S46217.
    RefSeqi NP_062013.1. NM_019140.2.
    UniGenei Rn.91202.

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    Entry Method Resolution (Å) Chain Positions PDBsum
    2NV5 X-ray 2.00 A/B/C 1328-1614 [» ]
    ProteinModelPortali Q64605.
    SMRi Q64605. Positions 317-510, 1326-1901.
    ModBasei Search...
    MobiDBi Search...

    Chemistry

    BindingDBi Q64605.

    PTM databases

    PhosphoSitei Q64605.

    Proteomic databases

    PRIDEi Q64605.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    GeneIDi 25529.
    KEGGi rno:25529.

    Organism-specific databases

    CTDi 5802.
    RGDi 3452. Ptprs.

    Phylogenomic databases

    HOVERGENi HBG053758.
    KOi K06778.
    PhylomeDBi Q64605.

    Miscellaneous databases

    EvolutionaryTracei Q64605.
    NextBioi 607019.

    Gene expression databases

    Genevestigatori Q64605.

    Family and domain databases

    Gene3Di 2.60.40.10. 10 hits.
    3.90.190.10. 2 hits.
    InterProi IPR003961. Fibronectin_type3.
    IPR007110. Ig-like_dom.
    IPR013783. Ig-like_fold.
    IPR013098. Ig_I-set.
    IPR003598. Ig_sub2.
    IPR029021. Prot-tyrosine_phosphatase-like.
    IPR000387. Tyr/Dual-sp_Pase.
    IPR016130. Tyr_Pase_AS.
    IPR000242. Tyr_Pase_rcpt/non-rcpt.
    [Graphical view ]
    Pfami PF00041. fn3. 6 hits.
    PF07679. I-set. 3 hits.
    PF00102. Y_phosphatase. 2 hits.
    [Graphical view ]
    PRINTSi PR00700. PRTYPHPHTASE.
    SMARTi SM00060. FN3. 8 hits.
    SM00408. IGc2. 3 hits.
    SM00194. PTPc. 2 hits.
    [Graphical view ]
    SUPFAMi SSF49265. SSF49265. 5 hits.
    SSF52799. SSF52799. 2 hits.
    PROSITEi PS50853. FN3. 8 hits.
    PS50835. IG_LIKE. 3 hits.
    PS00383. TYR_PHOSPHATASE_1. 2 hits.
    PS50056. TYR_PHOSPHATASE_2. 2 hits.
    PS50055. TYR_PHOSPHATASE_PTP. 2 hits.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Molecular cloning and expression of a unique receptor-like protein-tyrosine-phosphatase in the leucocyte-common-antigen-related phosphate family."
      Zhang W.-R., Hashimoto N., Ahmad F., Ding W., Goldstein B.J.
      Biochem. J. 302:39-47(1994) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), CHARACTERIZATION, TISSUE SPECIFICITY.
      Strain: Sprague-Dawley.
      Tissue: Liver.
    2. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Prostate.
    3. Cited for: X-RAY CRYSTALLOGRAPHY (2.0 ANGSTROMS) OF 1328-1614.

    Entry informationi

    Entry nameiPTPRS_RAT
    AccessioniPrimary (citable) accession number: Q64605
    Secondary accession number(s): Q07808
    , Q3KRE9, Q64621, Q64675
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: July 24, 2007
    Last sequence update: July 24, 2007
    Last modified: October 1, 2014
    This is version 105 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Reference proteome

    Documents

    1. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    2. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3