Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Receptor-type tyrosine-protein phosphatase S

Gene

Ptprs

Organism
Rattus norvegicus (Rat)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Cell surface receptor that binds to glycosaminoglycans, including chondroitin sulfate proteoglycans and heparan sulfate proteoglycans. Binding to chondroitin sulfate and heparan sulfate proteoglycans has opposite effects on PTPRS oligomerization and regulation of neurite outgrowth. Contributes to the inhibition of neurite and axonal outgrowth by chondroitin sulfate proteoglycans, also after nerve transection. Plays a role in stimulating neurite outgrowth in response to the heparan sulfate proteoglycan GPC2. Required for normal brain development, especially for normal development of the pituitary gland and the olfactory bulb (By similarity). Functions as tyrosine phosphatase (PubMed:8068021). Mediates dephosphorylation of NTRK1, NTRK2 and NTRK3 (By similarity). Plays a role in down-regulation of signaling cascades that lead to the activation of Akt and MAP kinases. Down-regulates TLR9-mediated activation of NF-kappa-B, as well as production of TNF, interferon alpha and interferon beta (By similarity).By similarity1 Publication

Catalytic activityi

Protein tyrosine phosphate + H2O = protein tyrosine + phosphate.PROSITE-ProRule annotation1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Binding sitei1516SubstrateBy similarity1
Active sitei1548Phosphocysteine intermediateBy similarity1
Binding sitei1592SubstrateBy similarity1
Active sitei1839Phosphocysteine intermediateBy similarity1

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionHeparin-binding, Hydrolase, Protein phosphatase, Receptor
Biological processCell adhesion

Names & Taxonomyi

Protein namesi
Recommended name:
Receptor-type tyrosine-protein phosphatase S (EC:3.1.3.481 Publication)
Short name:
R-PTP-S
Alternative name(s):
Leukocyte common antigen-related protein-tyrosine phosphatase 2
Short name:
LAR-PTP21 Publication
Receptor-type tyrosine-protein phosphatase sigma
Short name:
R-PTP-sigma
Gene namesi
Name:Ptprs
OrganismiRattus norvegicus (Rat)
Taxonomic identifieri10116 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeRattus
Proteomesi
  • UP000002494 Componenti: Unplaced

Organism-specific databases

RGDi3452. Ptprs.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini30 – 1257ExtracellularSequence analysisAdd BLAST1228
Transmembranei1258 – 1278HelicalSequence analysisAdd BLAST21
Topological domaini1279 – 1907CytoplasmicSequence analysisAdd BLAST629

GO - Cellular componenti

  • axon Source: UniProtKB
  • cell junction Source: UniProtKB-KW
  • integral component of postsynaptic density membrane Source: UniProtKB
  • integral component of synaptic vesicle membrane Source: UniProtKB
  • perikaryon Source: UniProtKB-SubCell

Keywords - Cellular componenti

Cell junction, Cell membrane, Cell projection, Cytoplasmic vesicle, Membrane, Postsynaptic cell membrane, Synapse, Synaptosome

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 29Sequence analysisAdd BLAST29
ChainiPRO_500014215330 – 1907Receptor-type tyrosine-protein phosphatase SAdd BLAST1878

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Disulfide bondi54 ↔ 107PROSITE-ProRule annotation
Disulfide bondi156 ↔ 207PROSITE-ProRule annotation
Glycosylationi250N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi253 ↔ 298PROSITE-ProRule annotation
Glycosylationi295N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi720N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi916N-linked (GlcNAc...) asparagineSequence analysis1

Post-translational modificationi

A cleavage occurs, separating the extracellular domain from the transmembrane segment. This process called 'ectodomain shedding' is thought to be involved in receptor desensitization, signal transduction and/or membrane localization (By similarity).By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sitei1172 – 1173CleavageBy similarity2

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDbiQ64605.
PRIDEiQ64605.

PTM databases

iPTMnetiQ64605.
PhosphoSitePlusiQ64605.

Expressioni

Tissue specificityi

Detected in brain neocortex (at protein level) (PubMed:22519304). Detected in heart, testis and liver (PubMed:8068021). Detected at lower levels in skeletal muscle, brain, spleen and kidney (PubMed:8068021).2 Publications

Interactioni

Subunit structurei

Binding to large heparan sulfate proteoglycan structures promotes oligomerization. Binding to chondroitin sulfate proteoglycan does not lead to oligomerization (By similarity). Interacts (via Ig-like domains) with NTRK1 and NTRK3, but does not form detectable complexes with NTRK2 (PubMed:17967490). Interacts with PPFIA1, PPFIA2 and PPFIA3 (By similarity).By similarity1 Publication

GO - Molecular functioni

Protein-protein interaction databases

STRINGi10116.ENSRNOP00000065227.

Structurei

Secondary structure

11907
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Helixi1334 – 1336Combined sources3
Helixi1337 – 1358Combined sources22
Helixi1369 – 1371Combined sources3
Turni1373 – 1375Combined sources3
Helixi1376 – 1378Combined sources3
Helixi1388 – 1390Combined sources3
Beta strandi1391 – 1393Combined sources3
Turni1401 – 1404Combined sources4
Beta strandi1405 – 1413Combined sources9
Beta strandi1416 – 1423Combined sources8
Helixi1428 – 1430Combined sources3
Helixi1431 – 1440Combined sources10
Beta strandi1445 – 1448Combined sources4
Beta strandi1452 – 1454Combined sources3
Beta strandi1457 – 1460Combined sources4
Beta strandi1466 – 1472Combined sources7
Beta strandi1475 – 1484Combined sources10
Beta strandi1486 – 1497Combined sources12
Beta strandi1504 – 1511Combined sources8
Beta strandi1516 – 1519Combined sources4
Helixi1524 – 1536Combined sources13
Beta strandi1544 – 1553Combined sources10
Helixi1554 – 1571Combined sources18
Beta strandi1572 – 1574Combined sources3
Helixi1576 – 1584Combined sources9
Helixi1594 – 1608Combined sources15

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2NV5X-ray2.00A/B/C1328-1614[»]
ProteinModelPortaliQ64605.
SMRiQ64605.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ64605.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini33 – 123Ig-like C2-type 1Add BLAST91
Domaini135 – 224Ig-like C2-type 2Add BLAST90
Domaini232 – 314Ig-like C2-type 3Add BLAST83
Domaini321 – 411Fibronectin type-III 1PROSITE-ProRule annotationAdd BLAST91
Domaini416 – 510Fibronectin type-III 2PROSITE-ProRule annotationAdd BLAST95
Domaini514 – 603Fibronectin type-III 3PROSITE-ProRule annotationAdd BLAST90
Domaini608 – 705Fibronectin type-III 4PROSITE-ProRule annotationAdd BLAST98
Domaini710 – 809Fibronectin type-III 5PROSITE-ProRule annotationAdd BLAST100
Domaini810 – 906Fibronectin type-III 6PROSITE-ProRule annotationAdd BLAST97
Domaini907 – 1008Fibronectin type-III 7PROSITE-ProRule annotationAdd BLAST102
Domaini1011 – 1095Fibronectin type-III 8PROSITE-ProRule annotationAdd BLAST85
Domaini1352 – 1607Tyrosine-protein phosphatase 1PROSITE-ProRule annotationAdd BLAST256
Domaini1639 – 1898Tyrosine-protein phosphatase 2PROSITE-ProRule annotationAdd BLAST260

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni68 – 72Important for binding to glycosaminoglycan chainsBy similarity5
Regioni1548 – 1554Substrate bindingBy similarity7

Sequence similaritiesi

Keywords - Domaini

Immunoglobulin domain, Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG4228. Eukaryota.
COG5599. LUCA.
HOVERGENiHBG053758.
InParanoidiQ64605.
KOiK06778.
PhylomeDBiQ64605.

Family and domain databases

CDDicd00063. FN3. 7 hits.
Gene3Di2.60.40.10. 11 hits.
3.90.190.10. 2 hits.
InterProiView protein in InterPro
IPR003961. FN3_dom.
IPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR013098. Ig_I-set.
IPR003599. Ig_sub.
IPR003598. Ig_sub2.
IPR029021. Prot-tyrosine_phosphatase-like.
IPR000242. PTPase_domain.
IPR016130. Tyr_Pase_AS.
IPR003595. Tyr_Pase_cat.
IPR000387. TYR_PHOSPHATASE_dom.
PfamiView protein in Pfam
PF00041. fn3. 6 hits.
PF07679. I-set. 3 hits.
PF00102. Y_phosphatase. 2 hits.
PRINTSiPR00700. PRTYPHPHTASE.
SMARTiView protein in SMART
SM00060. FN3. 8 hits.
SM00409. IG. 3 hits.
SM00408. IGc2. 3 hits.
SM00194. PTPc. 2 hits.
SM00404. PTPc_motif. 2 hits.
SUPFAMiSSF48726. SSF48726. 3 hits.
SSF49265. SSF49265. 5 hits.
SSF52799. SSF52799. 2 hits.
PROSITEiView protein in PROSITE
PS50853. FN3. 8 hits.
PS50835. IG_LIKE. 3 hits.
PS00383. TYR_PHOSPHATASE_1. 2 hits.
PS50056. TYR_PHOSPHATASE_2. 2 hits.
PS50055. TYR_PHOSPHATASE_PTP. 2 hits.

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q64605-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAPTWRPSVV SVVGPVGLFL VLLARGCLAE EPPRFIREPK DQIGVSGGVA
60 70 80 90 100
SFVCQATGDP KPRVTWNKKG KKVNSQRFET IDFDESSGAV LRIQPLRTPR
110 120 130 140 150
DENVYECVAQ NSVGEITVHA KLTVLREDQL PPGFPNIDMG PQLKVVERTR
160 170 180 190 200
TATMLCAASG NPDPEITWFK DFLPVDPSAS NGRIKQLRSG ALQIESSEET
210 220 230 240 250
DQGKYECVAT NSAGVRYSSP ANLYVRVRRV APRFSILPMS HEIMPGGNVN
260 270 280 290 300
ITCVAVGSPM PYVKWMQGAE DLTPEDDMPV GRNVLELTDV KDSANYTCVA
310 320 330 340 350
MSSLGVIEAV AQITVKSLPK APGTPVVTEN TATSITVTWD SGNPDPVSYY
360 370 380 390 400
VIEYKSKSQD GPYQIKEDIT TTRYSIGGLS PNSEYEIWVS AVNSIGQGPP
410 420 430 440 450
SESVVTRTGE QAPASAPRNV QARMLSATTM IVQWEEPVEP NGLIRGYRVY
460 470 480 490 500
YTMEPEHPVG NWQKHNVDDS LLTTVGSLLE DETYTVRVLA FTSVGDGPLS
510 520 530 540 550
DPIQVKTQQG VPGQPMNLRA EAKSETSIGL SWSAPRQESV IKYELLFREG
560 570 580 590 600
DRGREVGRTF DPTTAFVVED LKPNTEYAFR LAARSPQGLG AFTAVVRQRT
610 620 630 640 650
LQAKPSAPPQ DVKCTSLRST AILVSWRPPP PETHNGALVG YSVRYRPLGS
660 670 680 690 700
EDPDPKEVNN IPPTTTQILL EALEKWTEYR VTAVAYTEVG PGPESSPVVV
710 720 730 740 750
RTDEDVPSAP PRKVEAEALN ATAIRVLWRS PTPGRQHGQI RGYQVHYVRM
760 770 780 790 800
EGAEARGPPR IKDIMLADAQ EMVITNLQPE TAYSITVAAY TMKGDGARSK
810 820 830 840 850
PKVVVTKGAV LGRPTLSVQQ TPEGSLLARW EPPADAAEDP VLGYRLQFGR
860 870 880 890 900
EDAAPATLEL AAWERRFAAP AHKGATYVFR LAARGRAGLG EEASAALSIP
910 920 930 940 950
EDAPRGFPQI LGAAGNVSAG SVILRWLPPV PAERNGAIIK YTVSVREAGA
960 970 980 990 1000
PGPATETELA AAAQPGAETA LTLQGLRPET AYELRVRAHT RRGPGPFSPP
1010 1020 1030 1040 1050
LRYRLARDPV SPKNFKVKMI MKTSVLLSWE FPDNYNSPTP YKIQYNGLTL
1060 1070 1080 1090 1100
DVDGRTTKKL ITHLKPHTFY NFVLTNRGSS LGGLQQTVTA RTAFNMLSGK
1110 1120 1130 1140 1150
PSVAPKPDND GSIVVYLPDG QSPVTVQNYF IVMVPLRKSR GGQFPILLGS
1160 1170 1180 1190 1200
PEDMDLEELI QDLSRLQRRS LRHSRQLEVP RPYIAARFSI LPAVFHPGNQ
1210 1220 1230 1240 1250
KQYGGFDNRG LEPGHRYVLF VLAVLQKNEP TFAASPFSDP FQLDNPDPQP
1260 1270 1280 1290 1300
IVDGEEGLIW VIGPVLAVVF IICIVIAILL YKNKPDSKRK DSEPRTKCLL
1310 1320 1330 1340 1350
NNADLAPHHP KDPVEMRRIN FQTPGMLSHP PIPITDMAEH MERLKANDSL
1360 1370 1380 1390 1400
KLSQEYESID PGQQFTWEHS NLEANKPKNR YANVIAYDHS RVILQPLEGI
1410 1420 1430 1440 1450
MGSDYINANY VDGYRRQNAY IATQGPLPET FGDFWRMVWE QRSATVVMMT
1460 1470 1480 1490 1500
RLEEKSRVKC DQYWPNRGTE TYGFIQVTLL DTMELATFCV RTFSLHKNGS
1510 1520 1530 1540 1550
SEKREVRHFQ FTAWPDHGVP EYPTPFLAFL RRVKTCNPPD AGPVVVHCSA
1560 1570 1580 1590 1600
GVGRTGCFIV IDAMLERIRT EKTVDVYGHV TLMRSQRNYM VQTEDQYSFI
1610 1620 1630 1640 1650
HEALLEAVGC GNTEVPARSL YTYIQKLAQV EPGEHVTGME LEFKRLASSK
1660 1670 1680 1690 1700
AHTSRFITAS LPCNKFKNRL VNILPYESSR VCLQPIRGVE GSDYINASFI
1710 1720 1730 1740 1750
DGYRQQKAYI ATQGPLAETT EDFWRALWEN NSTIVVMLTK LREMGREKCH
1760 1770 1780 1790 1800
QYWPAERSAR YQYFVVDPMA EYNMPQYILR EFKVTDARDG QSRTVRQFQF
1810 1820 1830 1840 1850
TDWPEQGAPK SGEGFIDFIG QVHKTKEQFG QDGPISVHCS AGVGRTGVFI
1860 1870 1880 1890 1900
TLSIVLERMR YEGVVDIFQT VKVLRTQRPA MVQTEDEYQF CFQAALEYLG

SFDHYAT
Length:1,907
Mass (Da):211,931
Last modified:July 24, 2007 - v2
Checksum:i5CD377A88377CDA4
GO
Isoform 2 (identifier: Q64605-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     624-668: VSWRPPPPETHNGALVGYSVRYRPLGSEDPDPKEVNNIPPTTTQI → I

Show »
Length:1,863
Mass (Da):207,079
Checksum:i78BA7E27A7A772F0
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti597R → C in AAC37656 (PubMed:8068021).Curated1
Sequence conflicti753A → T in AAC37656 (PubMed:8068021).Curated1
Sequence conflicti913A → P in AAC37656 (PubMed:8068021).Curated1
Sequence conflicti934R → G in AAC37656 (PubMed:8068021).Curated1
Sequence conflicti950A → T in AAC37656 (PubMed:8068021).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_026932624 – 668VSWRP…TTTQI → I in isoform 2. 1 PublicationAdd BLAST45

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L11587 mRNA. Translation: AAC37656.1.
BC105753 mRNA. Translation: AAI05754.1.
PIRiI58148.
S46217.
RefSeqiNP_062013.1. NM_019140.2.
UniGeneiRn.91202.

Genome annotation databases

GeneIDi25529.
KEGGirno:25529.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L11587 mRNA. Translation: AAC37656.1.
BC105753 mRNA. Translation: AAI05754.1.
PIRiI58148.
S46217.
RefSeqiNP_062013.1. NM_019140.2.
UniGeneiRn.91202.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2NV5X-ray2.00A/B/C1328-1614[»]
ProteinModelPortaliQ64605.
SMRiQ64605.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10116.ENSRNOP00000065227.

PTM databases

iPTMnetiQ64605.
PhosphoSitePlusiQ64605.

Proteomic databases

PaxDbiQ64605.
PRIDEiQ64605.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

GeneIDi25529.
KEGGirno:25529.

Organism-specific databases

CTDi5802.
RGDi3452. Ptprs.

Phylogenomic databases

eggNOGiKOG4228. Eukaryota.
COG5599. LUCA.
HOVERGENiHBG053758.
InParanoidiQ64605.
KOiK06778.
PhylomeDBiQ64605.

Miscellaneous databases

EvolutionaryTraceiQ64605.
PROiPR:Q64605.

Family and domain databases

CDDicd00063. FN3. 7 hits.
Gene3Di2.60.40.10. 11 hits.
3.90.190.10. 2 hits.
InterProiView protein in InterPro
IPR003961. FN3_dom.
IPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR013098. Ig_I-set.
IPR003599. Ig_sub.
IPR003598. Ig_sub2.
IPR029021. Prot-tyrosine_phosphatase-like.
IPR000242. PTPase_domain.
IPR016130. Tyr_Pase_AS.
IPR003595. Tyr_Pase_cat.
IPR000387. TYR_PHOSPHATASE_dom.
PfamiView protein in Pfam
PF00041. fn3. 6 hits.
PF07679. I-set. 3 hits.
PF00102. Y_phosphatase. 2 hits.
PRINTSiPR00700. PRTYPHPHTASE.
SMARTiView protein in SMART
SM00060. FN3. 8 hits.
SM00409. IG. 3 hits.
SM00408. IGc2. 3 hits.
SM00194. PTPc. 2 hits.
SM00404. PTPc_motif. 2 hits.
SUPFAMiSSF48726. SSF48726. 3 hits.
SSF49265. SSF49265. 5 hits.
SSF52799. SSF52799. 2 hits.
PROSITEiView protein in PROSITE
PS50853. FN3. 8 hits.
PS50835. IG_LIKE. 3 hits.
PS00383. TYR_PHOSPHATASE_1. 2 hits.
PS50056. TYR_PHOSPHATASE_2. 2 hits.
PS50055. TYR_PHOSPHATASE_PTP. 2 hits.
ProtoNetiSearch...

Entry informationi

Entry nameiPTPRS_RAT
AccessioniPrimary (citable) accession number: Q64605
Secondary accession number(s): Q07808
, Q3KRE9, Q64621, Q64675
Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 24, 2007
Last sequence update: July 24, 2007
Last modified: May 10, 2017
This is version 124 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.