Q64605 (PTPRS_RAT) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 3, 2013.
Version 97.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Receptor-type tyrosine-protein phosphatase S Short name=R-PTP-S EC=3.1.3.48 Alternative name(s): Leukocyte common antigen-related protein-tyrosine phosphatase 2 Short name=LAR-PTP2 Receptor-type tyrosine-protein phosphatase sigma Short name=R-PTP-sigma | ||
| Gene names |
| ||
| Organism | Rattus norvegicus (Rat) [Reference proteome] | ||
| Taxonomic identifier | 10116 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Rattus![]() |
Protein attributes
| Sequence length | 1907 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Interacts with LAR-interacting protein LIP.1 By similarity. |
| Catalytic activity | Protein tyrosine phosphate + H2O = protein tyrosine + phosphate. |
| Subunit structure | Interacts with PPFIA1, PPFIA2 and PPFIA3 By similarity. |
| Subcellular location | Membrane; Single-pass type I membrane protein By similarity. |
| Tissue specificity | Detected in heart, testis and liver. Detected at lower levels in skeletal muscle, brain, spleen and kidney. Ref.1 |
| Post-translational modification | A cleavage occurs, separating the extracellular domain from the transmembrane segment. This process called 'ectodomain shedding' is thought to be involved in receptor desensitization, signal transduction and/or membrane localization By similarity. |
| Sequence similarities | Belongs to the protein-tyrosine phosphatase family. Receptor class 2A subfamily. Contains 8 fibronectin type-III domains. Contains 3 Ig-like C2-type (immunoglobulin-like) domains. Contains 2 tyrosine-protein phosphatase domains. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Cell adhesion |
| Cellular component | Membrane |
| Coding sequence diversity | Alternative splicing |
| Domain | Immunoglobulin domain Repeat Signal Transmembrane Transmembrane helix |
| Molecular function | Hydrolase Protein phosphatase Receptor |
| PTM | Disulfide bond Glycoprotein |
| Technical term | 3D-structure Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | cell adhesion Inferred from electronic annotation. Source: UniProtKB-KW |
| Cellular_component | integral to membrane Inferred from electronic annotation. Source: UniProtKB-KW |
| Molecular_function | protein tyrosine phosphatase activity Inferred from direct assay Ref.1. Source: RGD |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q64605-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q64605-2) The sequence of this isoform differs from the canonical sequence as follows: 624-668: VSWRPPPPETHNGALVGYSVRYRPLGSEDPDPKEVNNIPPTTTQI → I |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||||||||||||||||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 29 | 29 | Potential | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Chain | 30 – 1907 | 1878 | Receptor-type tyrosine-protein phosphatase S | PRO_5000142153 | ||||||||||||||||||||||||||||||||||||||||||||||||||
Regions | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Topological domain | 30 – 1257 | 1228 | Extracellular Potential | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Transmembrane | 1258 – 1278 | 21 | Helical; Potential | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Topological domain | 1279 – 1907 | 629 | Cytoplasmic Potential | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 33 – 123 | 91 | Ig-like C2-type 1 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 135 – 224 | 90 | Ig-like C2-type 2 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 232 – 314 | 83 | Ig-like C2-type 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 319 – 407 | 89 | Fibronectin type-III 1 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 413 – 507 | 95 | Fibronectin type-III 2 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 512 – 600 | 89 | Fibronectin type-III 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 605 – 702 | 98 | Fibronectin type-III 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 707 – 806 | 100 | Fibronectin type-III 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 814 – 899 | 86 | Fibronectin type-III 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 904 – 1007 | 104 | Fibronectin type-III 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 1009 – 1092 | 84 | Fibronectin type-III 8 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 1352 – 1607 | 256 | Tyrosine-protein phosphatase 1 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 1639 – 1898 | 260 | Tyrosine-protein phosphatase 2 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Region | 1548 – 1554 | 7 | Substrate binding By similarity | |||||||||||||||||||||||||||||||||||||||||||||||||||
Sites | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Active site | 1548 | 1 | Phosphocysteine intermediate By similarity | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Active site | 1839 | 1 | Phosphocysteine intermediate By similarity | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 1516 | 1 | Substrate By similarity | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 1592 | 1 | Substrate By similarity | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Site | 1172 – 1173 | 2 | Cleavage By similarity | |||||||||||||||||||||||||||||||||||||||||||||||||||
Amino acid modifications | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Glycosylation | 250 | 1 | N-linked (GlcNAc...) Potential | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Glycosylation | 295 | 1 | N-linked (GlcNAc...) Potential | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Glycosylation | 720 | 1 | N-linked (GlcNAc...) Potential | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Glycosylation | 916 | 1 | N-linked (GlcNAc...) Potential | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 54 ↔ 107 | By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 156 ↔ 207 | By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 253 ↔ 298 | By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 624 – 668 | 45 | VSWRP…TTTQI → I in isoform 2. | VSP_026932 | ||||||||||||||||||||||||||||||||||||||||||||||||||
Experimental info | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 597 | 1 | R → C in AAC37656. Ref.1 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 753 | 1 | A → T in AAC37656. Ref.1 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 913 | 1 | A → P in AAC37656. Ref.1 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 934 | 1 | R → G in AAC37656. Ref.1 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 950 | 1 | A → T in AAC37656. Ref.1 | |||||||||||||||||||||||||||||||||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 1334 – 1336 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 1337 – 1358 | 22 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 1369 – 1371 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 1373 – 1375 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 1376 – 1378 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 1388 – 1390 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 1391 – 1393 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 1401 – 1404 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 1405 – 1413 | 9 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 1416 – 1423 | 8 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 1428 – 1430 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 1431 – 1440 | 10 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 1445 – 1448 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 1452 – 1454 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 1457 – 1460 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 1466 – 1472 | 7 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 1475 – 1484 | 10 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 1486 – 1497 | 12 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 1504 – 1511 | 8 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 1516 – 1519 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 1524 – 1536 | 13 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 1544 – 1553 | 10 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 1554 – 1571 | 18 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 1572 – 1574 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 1576 – 1584 | 9 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 1594 – 1608 | 15 | ||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Molecular cloning and expression of a unique receptor-like protein-tyrosine-phosphatase in the leucocyte-common-antigen-related phosphate family." Zhang W.-R., Hashimoto N., Ahmad F., Ding W., Goldstein B.J. Biochem. J. 302:39-47(1994) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), CHARACTERIZATION, TISSUE SPECIFICITY. Strain: Sprague-Dawley. Tissue: Liver. |
| [2] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Prostate. |
| [3] | "Structural genomics of protein phosphatases." Almo S.C., Bonanno J.B., Sauder J.M., Emtage S., Dilorenzo T.P., Malashkevich V., Wasserman S.R., Swaminathan S., Eswaramoorthy S., Agarwal R., Kumaran D., Madegowda M., Ragumani S., Patskovsky Y., Alvarado J., Ramagopal U.A., Faber-Barata J., Chance M.R. Burley S.K.J. Struct. Funct. Genomics 8:121-140(2007) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.0 ANGSTROMS) OF 1328-1614. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | L11587 mRNA. Translation: AAC37656.1. BC105753 mRNA. Translation: AAI05754.1. | ||||||||||||
| IPI | IPI00214375. IPI00655248. | ||||||||||||
| PIR | I58148. S46217. | ||||||||||||
| RefSeq | NP_062013.1. NM_019140.2. | ||||||||||||
| UniGene | Rn.91202. | ||||||||||||
3D structure databases | |||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||
| ProteinModelPortal | Q64605. | ||||||||||||
| SMR | Q64605. Positions 317-510, 1326-1901. | ||||||||||||
| ModBase | Search... | ||||||||||||
PTM databases | |||||||||||||
| PhosphoSite | Q64605. | ||||||||||||
Proteomic databases | |||||||||||||
| PRIDE | Q64605. | ||||||||||||
Protocols and materials databases | |||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||
Genome annotation databases | |||||||||||||
| GeneID | 25529. | ||||||||||||
| KEGG | rno:25529. | ||||||||||||
Organism-specific databases | |||||||||||||
| CTD | 5802. | ||||||||||||
| RGD | 3452. Ptprs. | ||||||||||||
Phylogenomic databases | |||||||||||||
| HOVERGEN | HBG053758. | ||||||||||||
| KO | K06778. | ||||||||||||
Gene expression databases | |||||||||||||
| Genevestigator | Q64605. | ||||||||||||
Family and domain databases | |||||||||||||
| Gene3D | 2.60.40.10. 10 hits. | ||||||||||||
| InterPro | IPR003961. Fibronectin_type3. IPR007110. Ig-like_dom. IPR013783. Ig-like_fold. IPR013098. Ig_I-set. IPR003598. Ig_sub2. IPR000387. Tyr/Dual-sp_Pase. IPR016130. Tyr_Pase_AS. IPR000242. Tyr_Pase_rcpt/non-rcpt. [Graphical view] | ||||||||||||
| Pfam | PF00041. fn3. 6 hits. PF07679. I-set. 3 hits. PF00102. Y_phosphatase. 2 hits. [Graphical view] | ||||||||||||
| PRINTS | PR00700. PRTYPHPHTASE. | ||||||||||||
| SMART | SM00060. FN3. 8 hits. SM00408. IGc2. 3 hits. SM00194. PTPc. 2 hits. [Graphical view] | ||||||||||||
| SUPFAM | SSF49265. FN_III-like. 8 hits. | ||||||||||||
| PROSITE | PS50853. FN3. 8 hits. PS50835. IG_LIKE. 3 hits. PS00383. TYR_PHOSPHATASE_1. 2 hits. PS50056. TYR_PHOSPHATASE_2. 2 hits. PS50055. TYR_PHOSPHATASE_PTP. 2 hits. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other | |||||||||||||
| BindingDB | Q64605. | ||||||||||||
| ChEMBL | CHEMBL3108. | ||||||||||||
| EvolutionaryTrace | Q64605. | ||||||||||||
| NextBio | 607019. | ||||||||||||
Entry information
| Entry name | PTPRS_RAT | ||||||||
| Accession | Primary (citable) accession number: Q64605 Secondary accession number(s): Q07808 Q64675 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
