SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q64605

- PTPRS_RAT

UniProt

Q64605 - PTPRS_RAT

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Receptor-type tyrosine-protein phosphatase S

Gene
Ptprs
Organism
Rattus norvegicus (Rat)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Interacts with LAR-interacting protein LIP.1 By similarity.

Catalytic activityi

Protein tyrosine phosphate + H2O = protein tyrosine + phosphate.

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sitei1172 – 11732Cleavage By similarity
Binding sitei1516 – 15161Substrate By similarity
Active sitei1548 – 15481Phosphocysteine intermediate By similarity
Binding sitei1592 – 15921Substrate By similarity
Active sitei1839 – 18391Phosphocysteine intermediate By similarity

GO - Molecular functioni

  1. protein tyrosine phosphatase activity Source: RGD

GO - Biological processi

  1. cell adhesion Source: UniProtKB-KW
  2. peptidyl-tyrosine dephosphorylation Source: GOC
Complete GO annotation...

Keywords - Molecular functioni

Hydrolase, Protein phosphatase, Receptor

Keywords - Biological processi

Cell adhesion

Names & Taxonomyi

Protein namesi
Recommended name:
Receptor-type tyrosine-protein phosphatase S (EC:3.1.3.48)
Short name:
R-PTP-S
Alternative name(s):
Leukocyte common antigen-related protein-tyrosine phosphatase 2
Short name:
LAR-PTP2
Receptor-type tyrosine-protein phosphatase sigma
Short name:
R-PTP-sigma
Gene namesi
Name:Ptprs
OrganismiRattus norvegicus (Rat)
Taxonomic identifieri10116 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeRattus
ProteomesiUP000002494: Unplaced

Organism-specific databases

RGDi3452. Ptprs.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini30 – 12571228Extracellular Reviewed predictionAdd
BLAST
Transmembranei1258 – 127821Helical; Reviewed predictionAdd
BLAST
Topological domaini1279 – 1907629Cytoplasmic Reviewed predictionAdd
BLAST

GO - Cellular componenti

  1. integral component of membrane Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 2929 Reviewed predictionAdd
BLAST
Chaini30 – 19071878Receptor-type tyrosine-protein phosphatase SPRO_5000142153Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Disulfide bondi54 ↔ 107 By similarity
Disulfide bondi156 ↔ 207 By similarity
Glycosylationi250 – 2501N-linked (GlcNAc...) Reviewed prediction
Disulfide bondi253 ↔ 298 By similarity
Glycosylationi295 – 2951N-linked (GlcNAc...) Reviewed prediction
Glycosylationi720 – 7201N-linked (GlcNAc...) Reviewed prediction
Glycosylationi916 – 9161N-linked (GlcNAc...) Reviewed prediction

Post-translational modificationi

A cleavage occurs, separating the extracellular domain from the transmembrane segment. This process called 'ectodomain shedding' is thought to be involved in receptor desensitization, signal transduction and/or membrane localization By similarity.

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PRIDEiQ64605.

PTM databases

PhosphoSiteiQ64605.

Expressioni

Tissue specificityi

Detected in heart, testis and liver. Detected at lower levels in skeletal muscle, brain, spleen and kidney.1 Publication

Gene expression databases

GenevestigatoriQ64605.

Interactioni

Subunit structurei

Interacts with PPFIA1, PPFIA2 and PPFIA3 By similarity.

Structurei

Secondary structure

1
1907
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Helixi1334 – 13363
Helixi1337 – 135822
Helixi1369 – 13713
Turni1373 – 13753
Helixi1376 – 13783
Helixi1388 – 13903
Beta strandi1391 – 13933
Turni1401 – 14044
Beta strandi1405 – 14139
Beta strandi1416 – 14238
Helixi1428 – 14303
Helixi1431 – 144010
Beta strandi1445 – 14484
Beta strandi1452 – 14543
Beta strandi1457 – 14604
Beta strandi1466 – 14727
Beta strandi1475 – 148410
Beta strandi1486 – 149712
Beta strandi1504 – 15118
Beta strandi1516 – 15194
Helixi1524 – 153613
Beta strandi1544 – 155310
Helixi1554 – 157118
Beta strandi1572 – 15743
Helixi1576 – 15849
Helixi1594 – 160815

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
2NV5X-ray2.00A/B/C1328-1614[»]
ProteinModelPortaliQ64605.
SMRiQ64605. Positions 317-510, 1326-1901.

Miscellaneous databases

EvolutionaryTraceiQ64605.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini33 – 12391Ig-like C2-type 1Add
BLAST
Domaini135 – 22490Ig-like C2-type 2Add
BLAST
Domaini232 – 31483Ig-like C2-type 3Add
BLAST
Domaini321 – 41191Fibronectin type-III 1Add
BLAST
Domaini416 – 51095Fibronectin type-III 2Add
BLAST
Domaini514 – 60390Fibronectin type-III 3Add
BLAST
Domaini608 – 70598Fibronectin type-III 4Add
BLAST
Domaini710 – 809100Fibronectin type-III 5Add
BLAST
Domaini810 – 90697Fibronectin type-III 6Add
BLAST
Domaini907 – 1008102Fibronectin type-III 7Add
BLAST
Domaini1011 – 109585Fibronectin type-III 8Add
BLAST
Domaini1352 – 1607256Tyrosine-protein phosphatase 1Add
BLAST
Domaini1639 – 1898260Tyrosine-protein phosphatase 2Add
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni1548 – 15547Substrate binding By similarity

Sequence similaritiesi

Keywords - Domaini

Immunoglobulin domain, Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

HOVERGENiHBG053758.
KOiK06778.
PhylomeDBiQ64605.

Family and domain databases

Gene3Di2.60.40.10. 10 hits.
3.90.190.10. 2 hits.
InterProiIPR003961. Fibronectin_type3.
IPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR013098. Ig_I-set.
IPR003598. Ig_sub2.
IPR029021. Prot-tyrosine_phosphatase-like.
IPR000387. Tyr/Dual-sp_Pase.
IPR016130. Tyr_Pase_AS.
IPR000242. Tyr_Pase_rcpt/non-rcpt.
[Graphical view]
PfamiPF00041. fn3. 6 hits.
PF07679. I-set. 3 hits.
PF00102. Y_phosphatase. 2 hits.
[Graphical view]
PRINTSiPR00700. PRTYPHPHTASE.
SMARTiSM00060. FN3. 8 hits.
SM00408. IGc2. 3 hits.
SM00194. PTPc. 2 hits.
[Graphical view]
SUPFAMiSSF49265. SSF49265. 5 hits.
SSF52799. SSF52799. 2 hits.
PROSITEiPS50853. FN3. 8 hits.
PS50835. IG_LIKE. 3 hits.
PS00383. TYR_PHOSPHATASE_1. 2 hits.
PS50056. TYR_PHOSPHATASE_2. 2 hits.
PS50055. TYR_PHOSPHATASE_PTP. 2 hits.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q64605-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MAPTWRPSVV SVVGPVGLFL VLLARGCLAE EPPRFIREPK DQIGVSGGVA     50
SFVCQATGDP KPRVTWNKKG KKVNSQRFET IDFDESSGAV LRIQPLRTPR 100
DENVYECVAQ NSVGEITVHA KLTVLREDQL PPGFPNIDMG PQLKVVERTR 150
TATMLCAASG NPDPEITWFK DFLPVDPSAS NGRIKQLRSG ALQIESSEET 200
DQGKYECVAT NSAGVRYSSP ANLYVRVRRV APRFSILPMS HEIMPGGNVN 250
ITCVAVGSPM PYVKWMQGAE DLTPEDDMPV GRNVLELTDV KDSANYTCVA 300
MSSLGVIEAV AQITVKSLPK APGTPVVTEN TATSITVTWD SGNPDPVSYY 350
VIEYKSKSQD GPYQIKEDIT TTRYSIGGLS PNSEYEIWVS AVNSIGQGPP 400
SESVVTRTGE QAPASAPRNV QARMLSATTM IVQWEEPVEP NGLIRGYRVY 450
YTMEPEHPVG NWQKHNVDDS LLTTVGSLLE DETYTVRVLA FTSVGDGPLS 500
DPIQVKTQQG VPGQPMNLRA EAKSETSIGL SWSAPRQESV IKYELLFREG 550
DRGREVGRTF DPTTAFVVED LKPNTEYAFR LAARSPQGLG AFTAVVRQRT 600
LQAKPSAPPQ DVKCTSLRST AILVSWRPPP PETHNGALVG YSVRYRPLGS 650
EDPDPKEVNN IPPTTTQILL EALEKWTEYR VTAVAYTEVG PGPESSPVVV 700
RTDEDVPSAP PRKVEAEALN ATAIRVLWRS PTPGRQHGQI RGYQVHYVRM 750
EGAEARGPPR IKDIMLADAQ EMVITNLQPE TAYSITVAAY TMKGDGARSK 800
PKVVVTKGAV LGRPTLSVQQ TPEGSLLARW EPPADAAEDP VLGYRLQFGR 850
EDAAPATLEL AAWERRFAAP AHKGATYVFR LAARGRAGLG EEASAALSIP 900
EDAPRGFPQI LGAAGNVSAG SVILRWLPPV PAERNGAIIK YTVSVREAGA 950
PGPATETELA AAAQPGAETA LTLQGLRPET AYELRVRAHT RRGPGPFSPP 1000
LRYRLARDPV SPKNFKVKMI MKTSVLLSWE FPDNYNSPTP YKIQYNGLTL 1050
DVDGRTTKKL ITHLKPHTFY NFVLTNRGSS LGGLQQTVTA RTAFNMLSGK 1100
PSVAPKPDND GSIVVYLPDG QSPVTVQNYF IVMVPLRKSR GGQFPILLGS 1150
PEDMDLEELI QDLSRLQRRS LRHSRQLEVP RPYIAARFSI LPAVFHPGNQ 1200
KQYGGFDNRG LEPGHRYVLF VLAVLQKNEP TFAASPFSDP FQLDNPDPQP 1250
IVDGEEGLIW VIGPVLAVVF IICIVIAILL YKNKPDSKRK DSEPRTKCLL 1300
NNADLAPHHP KDPVEMRRIN FQTPGMLSHP PIPITDMAEH MERLKANDSL 1350
KLSQEYESID PGQQFTWEHS NLEANKPKNR YANVIAYDHS RVILQPLEGI 1400
MGSDYINANY VDGYRRQNAY IATQGPLPET FGDFWRMVWE QRSATVVMMT 1450
RLEEKSRVKC DQYWPNRGTE TYGFIQVTLL DTMELATFCV RTFSLHKNGS 1500
SEKREVRHFQ FTAWPDHGVP EYPTPFLAFL RRVKTCNPPD AGPVVVHCSA 1550
GVGRTGCFIV IDAMLERIRT EKTVDVYGHV TLMRSQRNYM VQTEDQYSFI 1600
HEALLEAVGC GNTEVPARSL YTYIQKLAQV EPGEHVTGME LEFKRLASSK 1650
AHTSRFITAS LPCNKFKNRL VNILPYESSR VCLQPIRGVE GSDYINASFI 1700
DGYRQQKAYI ATQGPLAETT EDFWRALWEN NSTIVVMLTK LREMGREKCH 1750
QYWPAERSAR YQYFVVDPMA EYNMPQYILR EFKVTDARDG QSRTVRQFQF 1800
TDWPEQGAPK SGEGFIDFIG QVHKTKEQFG QDGPISVHCS AGVGRTGVFI 1850
TLSIVLERMR YEGVVDIFQT VKVLRTQRPA MVQTEDEYQF CFQAALEYLG 1900
SFDHYAT 1907
Length:1,907
Mass (Da):211,931
Last modified:July 24, 2007 - v2
Checksum:i5CD377A88377CDA4
GO
Isoform 2 (identifier: Q64605-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     624-668: VSWRPPPPETHNGALVGYSVRYRPLGSEDPDPKEVNNIPPTTTQI → I

Show »
Length:1,863
Mass (Da):207,079
Checksum:i78BA7E27A7A772F0
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei624 – 66845VSWRP…TTTQI → I in isoform 2. VSP_026932Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti597 – 5971R → C in AAC37656. 1 Publication
Sequence conflicti753 – 7531A → T in AAC37656. 1 Publication
Sequence conflicti913 – 9131A → P in AAC37656. 1 Publication
Sequence conflicti934 – 9341R → G in AAC37656. 1 Publication
Sequence conflicti950 – 9501A → T in AAC37656. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
L11587 mRNA. Translation: AAC37656.1.
BC105753 mRNA. Translation: AAI05754.1.
PIRiI58148.
S46217.
RefSeqiNP_062013.1. NM_019140.2.
UniGeneiRn.91202.

Genome annotation databases

GeneIDi25529.
KEGGirno:25529.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
L11587 mRNA. Translation: AAC37656.1 .
BC105753 mRNA. Translation: AAI05754.1 .
PIRi I58148.
S46217.
RefSeqi NP_062013.1. NM_019140.2.
UniGenei Rn.91202.

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
2NV5 X-ray 2.00 A/B/C 1328-1614 [» ]
ProteinModelPortali Q64605.
SMRi Q64605. Positions 317-510, 1326-1901.
ModBasei Search...
MobiDBi Search...

Chemistry

BindingDBi Q64605.

PTM databases

PhosphoSitei Q64605.

Proteomic databases

PRIDEi Q64605.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

GeneIDi 25529.
KEGGi rno:25529.

Organism-specific databases

CTDi 5802.
RGDi 3452. Ptprs.

Phylogenomic databases

HOVERGENi HBG053758.
KOi K06778.
PhylomeDBi Q64605.

Miscellaneous databases

EvolutionaryTracei Q64605.
NextBioi 607019.

Gene expression databases

Genevestigatori Q64605.

Family and domain databases

Gene3Di 2.60.40.10. 10 hits.
3.90.190.10. 2 hits.
InterProi IPR003961. Fibronectin_type3.
IPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR013098. Ig_I-set.
IPR003598. Ig_sub2.
IPR029021. Prot-tyrosine_phosphatase-like.
IPR000387. Tyr/Dual-sp_Pase.
IPR016130. Tyr_Pase_AS.
IPR000242. Tyr_Pase_rcpt/non-rcpt.
[Graphical view ]
Pfami PF00041. fn3. 6 hits.
PF07679. I-set. 3 hits.
PF00102. Y_phosphatase. 2 hits.
[Graphical view ]
PRINTSi PR00700. PRTYPHPHTASE.
SMARTi SM00060. FN3. 8 hits.
SM00408. IGc2. 3 hits.
SM00194. PTPc. 2 hits.
[Graphical view ]
SUPFAMi SSF49265. SSF49265. 5 hits.
SSF52799. SSF52799. 2 hits.
PROSITEi PS50853. FN3. 8 hits.
PS50835. IG_LIKE. 3 hits.
PS00383. TYR_PHOSPHATASE_1. 2 hits.
PS50056. TYR_PHOSPHATASE_2. 2 hits.
PS50055. TYR_PHOSPHATASE_PTP. 2 hits.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Molecular cloning and expression of a unique receptor-like protein-tyrosine-phosphatase in the leucocyte-common-antigen-related phosphate family."
    Zhang W.-R., Hashimoto N., Ahmad F., Ding W., Goldstein B.J.
    Biochem. J. 302:39-47(1994) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), CHARACTERIZATION, TISSUE SPECIFICITY.
    Strain: Sprague-Dawley.
    Tissue: Liver.
  2. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Prostate.
  3. Cited for: X-RAY CRYSTALLOGRAPHY (2.0 ANGSTROMS) OF 1328-1614.

Entry informationi

Entry nameiPTPRS_RAT
AccessioniPrimary (citable) accession number: Q64605
Secondary accession number(s): Q07808
, Q3KRE9, Q64621, Q64675
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 24, 2007
Last sequence update: July 24, 2007
Last modified: June 11, 2014
This is version 104 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi