Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q64605

- PTPRS_RAT

UniProt

Q64605 - PTPRS_RAT

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Receptor-type tyrosine-protein phosphatase S

Gene

Ptprs

Organism
Rattus norvegicus (Rat)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Interacts with LAR-interacting protein LIP.1.By similarity

Catalytic activityi

Protein tyrosine phosphate + H2O = protein tyrosine + phosphate.PROSITE-ProRule annotation

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sitei1172 – 11732CleavageBy similarity
Binding sitei1516 – 15161SubstrateBy similarity
Active sitei1548 – 15481Phosphocysteine intermediateBy similarity
Binding sitei1592 – 15921SubstrateBy similarity
Active sitei1839 – 18391Phosphocysteine intermediateBy similarity

GO - Molecular functioni

  1. protein tyrosine phosphatase activity Source: RGD

GO - Biological processi

  1. cell adhesion Source: UniProtKB-KW
  2. peptidyl-tyrosine dephosphorylation Source: GOC
Complete GO annotation...

Keywords - Molecular functioni

Hydrolase, Protein phosphatase, Receptor

Keywords - Biological processi

Cell adhesion

Names & Taxonomyi

Protein namesi
Recommended name:
Receptor-type tyrosine-protein phosphatase S (EC:3.1.3.48)
Short name:
R-PTP-S
Alternative name(s):
Leukocyte common antigen-related protein-tyrosine phosphatase 2
Short name:
LAR-PTP2
Receptor-type tyrosine-protein phosphatase sigma
Short name:
R-PTP-sigma
Gene namesi
Name:Ptprs
OrganismiRattus norvegicus (Rat)
Taxonomic identifieri10116 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeRattus
ProteomesiUP000002494: Unplaced

Organism-specific databases

RGDi3452. Ptprs.

Subcellular locationi

Membrane By similarity; Single-pass type I membrane protein By similarity

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini30 – 12571228ExtracellularSequence AnalysisAdd
BLAST
Transmembranei1258 – 127821HelicalSequence AnalysisAdd
BLAST
Topological domaini1279 – 1907629CytoplasmicSequence AnalysisAdd
BLAST

GO - Cellular componenti

  1. integral component of membrane Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 2929Sequence AnalysisAdd
BLAST
Chaini30 – 19071878Receptor-type tyrosine-protein phosphatase SPRO_5000142153Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Disulfide bondi54 ↔ 107PROSITE-ProRule annotation
Disulfide bondi156 ↔ 207PROSITE-ProRule annotation
Glycosylationi250 – 2501N-linked (GlcNAc...)Sequence Analysis
Disulfide bondi253 ↔ 298PROSITE-ProRule annotation
Glycosylationi295 – 2951N-linked (GlcNAc...)Sequence Analysis
Glycosylationi720 – 7201N-linked (GlcNAc...)Sequence Analysis
Glycosylationi916 – 9161N-linked (GlcNAc...)Sequence Analysis

Post-translational modificationi

A cleavage occurs, separating the extracellular domain from the transmembrane segment. This process called 'ectodomain shedding' is thought to be involved in receptor desensitization, signal transduction and/or membrane localization (By similarity).By similarity

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PRIDEiQ64605.

PTM databases

PhosphoSiteiQ64605.

Expressioni

Tissue specificityi

Detected in heart, testis and liver. Detected at lower levels in skeletal muscle, brain, spleen and kidney.1 Publication

Gene expression databases

GenevestigatoriQ64605.

Interactioni

Subunit structurei

Interacts with PPFIA1, PPFIA2 and PPFIA3.By similarity

Structurei

Secondary structure

1
1907
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Helixi1334 – 13363
Helixi1337 – 135822
Helixi1369 – 13713
Turni1373 – 13753
Helixi1376 – 13783
Helixi1388 – 13903
Beta strandi1391 – 13933
Turni1401 – 14044
Beta strandi1405 – 14139
Beta strandi1416 – 14238
Helixi1428 – 14303
Helixi1431 – 144010
Beta strandi1445 – 14484
Beta strandi1452 – 14543
Beta strandi1457 – 14604
Beta strandi1466 – 14727
Beta strandi1475 – 148410
Beta strandi1486 – 149712
Beta strandi1504 – 15118
Beta strandi1516 – 15194
Helixi1524 – 153613
Beta strandi1544 – 155310
Helixi1554 – 157118
Beta strandi1572 – 15743
Helixi1576 – 15849
Helixi1594 – 160815

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
2NV5X-ray2.00A/B/C1328-1614[»]
ProteinModelPortaliQ64605.
SMRiQ64605. Positions 317-510, 1326-1901.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ64605.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini33 – 12391Ig-like C2-type 1Add
BLAST
Domaini135 – 22490Ig-like C2-type 2Add
BLAST
Domaini232 – 31483Ig-like C2-type 3Add
BLAST
Domaini321 – 41191Fibronectin type-III 1PROSITE-ProRule annotationAdd
BLAST
Domaini416 – 51095Fibronectin type-III 2PROSITE-ProRule annotationAdd
BLAST
Domaini514 – 60390Fibronectin type-III 3PROSITE-ProRule annotationAdd
BLAST
Domaini608 – 70598Fibronectin type-III 4PROSITE-ProRule annotationAdd
BLAST
Domaini710 – 809100Fibronectin type-III 5PROSITE-ProRule annotationAdd
BLAST
Domaini810 – 90697Fibronectin type-III 6PROSITE-ProRule annotationAdd
BLAST
Domaini907 – 1008102Fibronectin type-III 7PROSITE-ProRule annotationAdd
BLAST
Domaini1011 – 109585Fibronectin type-III 8PROSITE-ProRule annotationAdd
BLAST
Domaini1352 – 1607256Tyrosine-protein phosphatase 1PROSITE-ProRule annotationAdd
BLAST
Domaini1639 – 1898260Tyrosine-protein phosphatase 2PROSITE-ProRule annotationAdd
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni1548 – 15547Substrate bindingBy similarity

Sequence similaritiesi

Contains 8 fibronectin type-III domains.PROSITE-ProRule annotation
Contains 2 tyrosine-protein phosphatase domains.PROSITE-ProRule annotation

Keywords - Domaini

Immunoglobulin domain, Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

HOVERGENiHBG053758.
InParanoidiQ64605.
KOiK06778.
PhylomeDBiQ64605.

Family and domain databases

Gene3Di2.60.40.10. 10 hits.
3.90.190.10. 2 hits.
InterProiIPR003961. Fibronectin_type3.
IPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR013098. Ig_I-set.
IPR003598. Ig_sub2.
IPR029021. Prot-tyrosine_phosphatase-like.
IPR000387. Tyr/Dual-sp_Pase.
IPR016130. Tyr_Pase_AS.
IPR000242. Tyr_Pase_rcpt/non-rcpt.
[Graphical view]
PfamiPF00041. fn3. 6 hits.
PF07679. I-set. 3 hits.
PF00102. Y_phosphatase. 2 hits.
[Graphical view]
PRINTSiPR00700. PRTYPHPHTASE.
SMARTiSM00060. FN3. 8 hits.
SM00408. IGc2. 3 hits.
SM00194. PTPc. 2 hits.
[Graphical view]
SUPFAMiSSF49265. SSF49265. 5 hits.
SSF52799. SSF52799. 2 hits.
PROSITEiPS50853. FN3. 8 hits.
PS50835. IG_LIKE. 3 hits.
PS00383. TYR_PHOSPHATASE_1. 2 hits.
PS50056. TYR_PHOSPHATASE_2. 2 hits.
PS50055. TYR_PHOSPHATASE_PTP. 2 hits.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q64605-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAPTWRPSVV SVVGPVGLFL VLLARGCLAE EPPRFIREPK DQIGVSGGVA
60 70 80 90 100
SFVCQATGDP KPRVTWNKKG KKVNSQRFET IDFDESSGAV LRIQPLRTPR
110 120 130 140 150
DENVYECVAQ NSVGEITVHA KLTVLREDQL PPGFPNIDMG PQLKVVERTR
160 170 180 190 200
TATMLCAASG NPDPEITWFK DFLPVDPSAS NGRIKQLRSG ALQIESSEET
210 220 230 240 250
DQGKYECVAT NSAGVRYSSP ANLYVRVRRV APRFSILPMS HEIMPGGNVN
260 270 280 290 300
ITCVAVGSPM PYVKWMQGAE DLTPEDDMPV GRNVLELTDV KDSANYTCVA
310 320 330 340 350
MSSLGVIEAV AQITVKSLPK APGTPVVTEN TATSITVTWD SGNPDPVSYY
360 370 380 390 400
VIEYKSKSQD GPYQIKEDIT TTRYSIGGLS PNSEYEIWVS AVNSIGQGPP
410 420 430 440 450
SESVVTRTGE QAPASAPRNV QARMLSATTM IVQWEEPVEP NGLIRGYRVY
460 470 480 490 500
YTMEPEHPVG NWQKHNVDDS LLTTVGSLLE DETYTVRVLA FTSVGDGPLS
510 520 530 540 550
DPIQVKTQQG VPGQPMNLRA EAKSETSIGL SWSAPRQESV IKYELLFREG
560 570 580 590 600
DRGREVGRTF DPTTAFVVED LKPNTEYAFR LAARSPQGLG AFTAVVRQRT
610 620 630 640 650
LQAKPSAPPQ DVKCTSLRST AILVSWRPPP PETHNGALVG YSVRYRPLGS
660 670 680 690 700
EDPDPKEVNN IPPTTTQILL EALEKWTEYR VTAVAYTEVG PGPESSPVVV
710 720 730 740 750
RTDEDVPSAP PRKVEAEALN ATAIRVLWRS PTPGRQHGQI RGYQVHYVRM
760 770 780 790 800
EGAEARGPPR IKDIMLADAQ EMVITNLQPE TAYSITVAAY TMKGDGARSK
810 820 830 840 850
PKVVVTKGAV LGRPTLSVQQ TPEGSLLARW EPPADAAEDP VLGYRLQFGR
860 870 880 890 900
EDAAPATLEL AAWERRFAAP AHKGATYVFR LAARGRAGLG EEASAALSIP
910 920 930 940 950
EDAPRGFPQI LGAAGNVSAG SVILRWLPPV PAERNGAIIK YTVSVREAGA
960 970 980 990 1000
PGPATETELA AAAQPGAETA LTLQGLRPET AYELRVRAHT RRGPGPFSPP
1010 1020 1030 1040 1050
LRYRLARDPV SPKNFKVKMI MKTSVLLSWE FPDNYNSPTP YKIQYNGLTL
1060 1070 1080 1090 1100
DVDGRTTKKL ITHLKPHTFY NFVLTNRGSS LGGLQQTVTA RTAFNMLSGK
1110 1120 1130 1140 1150
PSVAPKPDND GSIVVYLPDG QSPVTVQNYF IVMVPLRKSR GGQFPILLGS
1160 1170 1180 1190 1200
PEDMDLEELI QDLSRLQRRS LRHSRQLEVP RPYIAARFSI LPAVFHPGNQ
1210 1220 1230 1240 1250
KQYGGFDNRG LEPGHRYVLF VLAVLQKNEP TFAASPFSDP FQLDNPDPQP
1260 1270 1280 1290 1300
IVDGEEGLIW VIGPVLAVVF IICIVIAILL YKNKPDSKRK DSEPRTKCLL
1310 1320 1330 1340 1350
NNADLAPHHP KDPVEMRRIN FQTPGMLSHP PIPITDMAEH MERLKANDSL
1360 1370 1380 1390 1400
KLSQEYESID PGQQFTWEHS NLEANKPKNR YANVIAYDHS RVILQPLEGI
1410 1420 1430 1440 1450
MGSDYINANY VDGYRRQNAY IATQGPLPET FGDFWRMVWE QRSATVVMMT
1460 1470 1480 1490 1500
RLEEKSRVKC DQYWPNRGTE TYGFIQVTLL DTMELATFCV RTFSLHKNGS
1510 1520 1530 1540 1550
SEKREVRHFQ FTAWPDHGVP EYPTPFLAFL RRVKTCNPPD AGPVVVHCSA
1560 1570 1580 1590 1600
GVGRTGCFIV IDAMLERIRT EKTVDVYGHV TLMRSQRNYM VQTEDQYSFI
1610 1620 1630 1640 1650
HEALLEAVGC GNTEVPARSL YTYIQKLAQV EPGEHVTGME LEFKRLASSK
1660 1670 1680 1690 1700
AHTSRFITAS LPCNKFKNRL VNILPYESSR VCLQPIRGVE GSDYINASFI
1710 1720 1730 1740 1750
DGYRQQKAYI ATQGPLAETT EDFWRALWEN NSTIVVMLTK LREMGREKCH
1760 1770 1780 1790 1800
QYWPAERSAR YQYFVVDPMA EYNMPQYILR EFKVTDARDG QSRTVRQFQF
1810 1820 1830 1840 1850
TDWPEQGAPK SGEGFIDFIG QVHKTKEQFG QDGPISVHCS AGVGRTGVFI
1860 1870 1880 1890 1900
TLSIVLERMR YEGVVDIFQT VKVLRTQRPA MVQTEDEYQF CFQAALEYLG

SFDHYAT
Length:1,907
Mass (Da):211,931
Last modified:July 24, 2007 - v2
Checksum:i5CD377A88377CDA4
GO
Isoform 2 (identifier: Q64605-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     624-668: VSWRPPPPETHNGALVGYSVRYRPLGSEDPDPKEVNNIPPTTTQI → I

Show »
Length:1,863
Mass (Da):207,079
Checksum:i78BA7E27A7A772F0
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti597 – 5971R → C in AAC37656. (PubMed:8068021)Curated
Sequence conflicti753 – 7531A → T in AAC37656. (PubMed:8068021)Curated
Sequence conflicti913 – 9131A → P in AAC37656. (PubMed:8068021)Curated
Sequence conflicti934 – 9341R → G in AAC37656. (PubMed:8068021)Curated
Sequence conflicti950 – 9501A → T in AAC37656. (PubMed:8068021)Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei624 – 66845VSWRP…TTTQI → I in isoform 2. 1 PublicationVSP_026932Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L11587 mRNA. Translation: AAC37656.1.
BC105753 mRNA. Translation: AAI05754.1.
PIRiI58148.
S46217.
RefSeqiNP_062013.1. NM_019140.2.
UniGeneiRn.91202.

Genome annotation databases

GeneIDi25529.
KEGGirno:25529.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L11587 mRNA. Translation: AAC37656.1 .
BC105753 mRNA. Translation: AAI05754.1 .
PIRi I58148.
S46217.
RefSeqi NP_062013.1. NM_019140.2.
UniGenei Rn.91202.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
2NV5 X-ray 2.00 A/B/C 1328-1614 [» ]
ProteinModelPortali Q64605.
SMRi Q64605. Positions 317-510, 1326-1901.
ModBasei Search...
MobiDBi Search...

PTM databases

PhosphoSitei Q64605.

Proteomic databases

PRIDEi Q64605.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

GeneIDi 25529.
KEGGi rno:25529.

Organism-specific databases

CTDi 5802.
RGDi 3452. Ptprs.

Phylogenomic databases

HOVERGENi HBG053758.
InParanoidi Q64605.
KOi K06778.
PhylomeDBi Q64605.

Miscellaneous databases

EvolutionaryTracei Q64605.
NextBioi 607019.

Gene expression databases

Genevestigatori Q64605.

Family and domain databases

Gene3Di 2.60.40.10. 10 hits.
3.90.190.10. 2 hits.
InterProi IPR003961. Fibronectin_type3.
IPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR013098. Ig_I-set.
IPR003598. Ig_sub2.
IPR029021. Prot-tyrosine_phosphatase-like.
IPR000387. Tyr/Dual-sp_Pase.
IPR016130. Tyr_Pase_AS.
IPR000242. Tyr_Pase_rcpt/non-rcpt.
[Graphical view ]
Pfami PF00041. fn3. 6 hits.
PF07679. I-set. 3 hits.
PF00102. Y_phosphatase. 2 hits.
[Graphical view ]
PRINTSi PR00700. PRTYPHPHTASE.
SMARTi SM00060. FN3. 8 hits.
SM00408. IGc2. 3 hits.
SM00194. PTPc. 2 hits.
[Graphical view ]
SUPFAMi SSF49265. SSF49265. 5 hits.
SSF52799. SSF52799. 2 hits.
PROSITEi PS50853. FN3. 8 hits.
PS50835. IG_LIKE. 3 hits.
PS00383. TYR_PHOSPHATASE_1. 2 hits.
PS50056. TYR_PHOSPHATASE_2. 2 hits.
PS50055. TYR_PHOSPHATASE_PTP. 2 hits.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Molecular cloning and expression of a unique receptor-like protein-tyrosine-phosphatase in the leucocyte-common-antigen-related phosphate family."
    Zhang W.-R., Hashimoto N., Ahmad F., Ding W., Goldstein B.J.
    Biochem. J. 302:39-47(1994) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), CHARACTERIZATION, TISSUE SPECIFICITY.
    Strain: Sprague-Dawley.
    Tissue: Liver.
  2. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Prostate.
  3. Cited for: X-RAY CRYSTALLOGRAPHY (2.0 ANGSTROMS) OF 1328-1614.

Entry informationi

Entry nameiPTPRS_RAT
AccessioniPrimary (citable) accession number: Q64605
Secondary accession number(s): Q07808
, Q3KRE9, Q64621, Q64675
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 24, 2007
Last sequence update: July 24, 2007
Last modified: November 26, 2014
This is version 107 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3