Q64559 (BACH_RAT) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 94.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Cytosolic acyl coenzyme A thioester hydrolase EC=3.1.2.2 Alternative name(s): ACH1 ACT Acyl-CoA thioesterase 7 Brain acyl-CoA hydrolase Short name=BACH CTE-IIa CTE-IIb Short name=CTE-II LACH1 Long chain acyl-CoA thioester hydrolase MTE-II | ||||
| Gene names |
| ||||
| Organism | Rattus norvegicus (Rat) | ||||
| Taxonomic identifier | 10116 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Rattus |
Protein attributes
| Sequence length | 381 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Acyl-CoA thioesterases are a group of enzymes that catalyze the hydrolysis of acyl-CoAs to the free fatty acid and coenzyme A (CoASH), providing the potential to regulate intracellular levels of acyl-CoAs, free fatty acids and CoASH. May play an important physiological function in brain. May play a regulatory role by modulating the cellular levels of fatty acyl-CoA ligands for certain transcription factors as well as the substrates for fatty acid metabolizing enzymes, contributing to lipid homeostasis. Has broad specificity, active towards fatty acyl-CoAs with chain-lengths of C8-C18. |
| Catalytic activity | Palmitoyl-CoA + H2O = CoA + palmitate. |
| Subunit structure | Homohexamer By similarity. |
| Subcellular location | |
| Tissue specificity | Isoform 1 is expressed constitutively in brain and testis. Isoform 2 is induced in liver by treatment with the peroxisome proliferator. |
| Domain | Both hydrolase domains are required for efficient activity By similarity. |
| Post-translational modification | The N-terminus is blocked. |
| Sequence similarities | Contains 2 acyl coenzyme A hydrolase domains. |
| Caution | These proteins have been named according to their molecular weight (see Ref.8): BACH (also called CTE-IIa and CTE-II), LACH1 (also called MTE-II) and ACT (also called CTE-IIb). It is unknown whether ACT corresponds to another isoform. |
| Biophysicochemical properties | Kinetic parameters: KM=5.9 µM for palmitoyl-CoA Vmax=553 µmol/min/mg enzyme with palmitoyl-CoA as substrate |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cytoplasm |
| Coding sequence diversity | Alternative splicing |
| Domain | Repeat |
| Molecular function | Hydrolase Serine esterase |
| PTM | Acetylation |
| Technical term | Complete proteome Direct protein sequencing Reference proteome |
| Gene Ontology (GO) | |
| Cellular component | cytosol Inferred from direct assay Ref.4. Source: RGD |
| Molecular function | carboxylesterase activity Inferred from electronic annotation. Source: UniProtKB-KW palmitoyl-CoA hydrolase activityInferred from electronic annotation. Source: EC |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 2 (identifier: Q64559-2) Also known as: LACH1; MTE-II; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 1 (identifier: Q64559-1) Also known as: BACH; CTE-IIa; CTE-II; The sequence of this isoform differs from the canonical sequence as follows: 1-58: MKLLARTLYLWEVGRQVASWSLTSGQECLVLRETWWASMRAVRTRAVHHKPGHCIAMG → MSGPTTDTPAAIQIC |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 381 | 381 | Cytosolic acyl coenzyme A thioester hydrolase | PRO_0000053808 | |||||
Regions | |||||||||
| Domain | 57 – 152 | 96 | Acyl coenzyme A hydrolase 1 | ||||||
| Domain | 243 – 320 | 78 | Acyl coenzyme A hydrolase 2 | ||||||
Sites | |||||||||
| Active site | 67 | 1 | By similarity | ||||||
| Active site | 256 | 1 | By similarity | ||||||
Amino acid modifications | |||||||||
| Modified residue | 79 | 1 | N6-acetyllysine By similarity | ||||||
| Modified residue | 169 | 1 | N6-acetyllysine By similarity | ||||||
| Modified residue | 199 | 1 | N6-acetyllysine By similarity | ||||||
| Modified residue | 284 | 1 | N6-acetyllysine By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 58 | 58 | MKLLA…CIAMG → MSGPTTDTPAAIQIC in isoform 1. | VSP_016956 | |||||
Experimental info | |||||||||
| Sequence conflict | 86 | 1 | V → A in AAC53202. Ref.1 | ||||||
| Sequence conflict | 89 | 1 | S → R in AAC53202. Ref.1 | ||||||
| Sequence conflict | 144 | 1 | L → M in AAC53202. Ref.1 | ||||||
| Sequence conflict | 171 | 1 | V → A in BAA19627. Ref.2 | ||||||
| Sequence conflict | 216 | 1 | I → V in AAC53202. Ref.1 | ||||||
| Sequence conflict | 279 | 1 | I → V in BAA19627. Ref.2 | ||||||
| Sequence conflict | 343 | 1 | L → M in AAC53202. Ref.1 | ||||||
| Sequence conflict | 372 | 1 | K → N in AAC53202. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Molecular cloning and expression of cDNA encoding rat brain cytosolic acyl-coenzyme A thioester hydrolase." Broustas C.G., Larkins L.K., Uhler M.D., Hajra A.K. J. Biol. Chem. 271:10470-10476(1996) [PubMed: 8631842] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), PROTEIN SEQUENCE OF 306-343. Tissue: Brain. |
| [2] | "Molecular cloning and expression of cDNAs encoding rat brain and liver cytosolic long-chain acyl-CoA hydrolases." Yamada J., Furihata T., Iida N., Watanabe T., Hosokawa M., Satoh T., Someya A., Nagaoka I., Suga T. Biochem. Biophys. Res. Commun. 232:198-203(1997) [PubMed: 9125130] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), PROTEIN SEQUENCE OF 60-72; 256-264; 315-343 AND 370-380. Strain: Sprague-Dawley. Tissue: Brain and Liver. |
| [3] | Yamada J., Furihata T., Iida N., Watanabe T., Hosokawa M., Satoh T., Someya A., Nagaoka I., Suga T. Submitted (MAR-2005) to the EMBL/GenBank/DDBJ databases Cited for: SEQUENCE REVISION TO N-TERMINUS (ISOFORM 2). |
| [4] | "Peroxisome proliferator-induced acyl-CoA thioesterase from rat liver cytosol: molecular cloning and functional expression in Chinese hamster ovary cells." Engberg S.T., Aoyama T., Alexson S.E.H., Hashimoto T., Svensson L.T. Biochem. J. 323:525-531(1997) [PubMed: 9163348] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Liver. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Brain. |
| [6] | Lubec G., Diao W., Afjehi-Sadat L. Submitted (NOV-2006) to UniProtKB Cited for: PROTEIN SEQUENCE OF 135-153 AND 173-184 (ISOFORMS 1/2), MASS SPECTROMETRY. Strain: Sprague-Dawley. Tissue: Hippocampus and Spinal cord. |
| [7] | "Purification and properties of long-chain acyl-CoA hydrolases from the liver cytosol of rats treated with peroxisome proliferator." Yamada J., Matsumoto I., Furihata T., Sakuma M., Suga T. Arch. Biochem. Biophys. 308:118-125(1994) [PubMed: 7906114] [Abstract] Cited for: CHARACTERIZATION. |
| [8] | "The role Acyl-CoA thioesterases play in mediating intracellular lipid metabolism." Hunt M.C., Alexson S.E.H. Prog. Lipid Res. 41:99-130(2002) [PubMed: 11755680] [Abstract] Cited for: REVIEW. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | U49694 mRNA. Translation: AAC53202.1. D88890 mRNA. Translation: BAA19626.1. D88891 mRNA. Translation: BAA19627.2. Y09332 mRNA. Translation: CAA70512.1. BC087716 mRNA. Translation: AAH87716.1. |
| IPI | IPI00213571. IPI00326904. |
| PIR | JC5415. JC5416. |
| RefSeq | NP_001139533.1. NM_001146061.1. NP_037346.2. NM_013214.4. |
| UniGene | Rn.6024. |
3D structure databases | |
| ProteinModelPortal | Q64559. |
| SMR | Q64559. Positions 59-204, 219-376. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | Q64559. |
PTM databases | |
| PhosphoSite | Q64559. |
Proteomic databases | |
| PRIDE | Q64559. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENSRNOT00000014213; ENSRNOP00000014213; ENSRNOG00000010580. |
| GeneID | 26759. |
| KEGG | rno:26759. |
| UCSC | D88891. rat. |
Organism-specific databases | |
| CTD | 11332. |
| RGD | 628856. Acot7. |
Phylogenomic databases | |
| eggNOG | roNOG15499. |
| GeneTree | ENSGT00390000000934. |
| HOVERGEN | HBG036928. |
| InParanoid | Q64559. |
Enzyme and pathway databases | |
| BRENDA | 3.1.2.2. 5301. |
Gene expression databases | |
| ArrayExpress | Q64559. |
| Genevestigator | Q64559. |
| GermOnline | ENSRNOG00000010580. Rattus norvegicus. |
Family and domain databases | |
| InterPro | IPR006683. Thioestr_supf. [Graphical view] |
| KO | K01068. |
| Pfam | PF03061. 4HBT. 2 hits. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 608014. |
Entry information
| Entry name | BACH_RAT | ||||||||
| Accession | Primary (citable) accession number: Q64559 Secondary accession number(s): O08652, O09041 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| SIMILARITY comments Index of protein domains and families |

Clusters with