Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Cytosolic acyl coenzyme A thioester hydrolase

Gene

Acot7

Organism
Rattus norvegicus (Rat)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Acyl-CoA thioesterases are a group of enzymes that catalyze the hydrolysis of acyl-CoAs to the free fatty acid and coenzyme A (CoASH), providing the potential to regulate intracellular levels of acyl-CoAs, free fatty acids and CoASH. May play an important physiological function in brain. May play a regulatory role by modulating the cellular levels of fatty acyl-CoA ligands for certain transcription factors as well as the substrates for fatty acid metabolizing enzymes, contributing to lipid homeostasis. Has broad specificity, active towards fatty acyl-CoAs with chain-lengths of C8-C18.

Catalytic activityi

Palmitoyl-CoA + H2O = CoA + palmitate.

Kineticsi

  1. KM=5.9 µM for palmitoyl-CoA
  1. Vmax=553 µmol/min/mg enzyme with palmitoyl-CoA as substrate

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Active sitei67By similarity1
Active sitei256By similarity1

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Hydrolase, Serine esterase

Enzyme and pathway databases

BRENDAi3.1.2.2. 5301.
3.1.2.20. 5301.
ReactomeiR-RNO-75105. Fatty Acyl-CoA Biosynthesis.
SABIO-RKQ64559.

Chemistry databases

SwissLipidsiSLP:000000586.
SLP:000000614. [Q64559-1]

Names & Taxonomyi

Protein namesi
Recommended name:
Cytosolic acyl coenzyme A thioester hydrolase (EC:3.1.2.2)
Alternative name(s):
ACH1
ACT
Acyl-CoA thioesterase 7
Brain acyl-CoA hydrolase
Short name:
BACH
CTE-IIa
CTE-IIb
Short name:
CTE-II
LACH1
Long chain acyl-CoA thioester hydrolase
MTE-II
Gene namesi
Name:Acot7
Synonyms:Bach
OrganismiRattus norvegicus (Rat)
Taxonomic identifieri10116 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeRattus
Proteomesi
  • UP000002494 Componenti: Chromosome 5

Organism-specific databases

RGDi628856. Acot7.

Subcellular locationi

GO - Cellular componenti

  • cytosol Source: RGD
  • extracellular exosome Source: Ensembl
  • nucleoplasm Source: Ensembl
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000538081 – 381Cytosolic acyl coenzyme A thioester hydrolaseAdd BLAST381

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei169N6-acetyllysineBy similarity1
Modified residuei199N6-acetyllysineBy similarity1
Modified residuei284N6-acetyllysineBy similarity1

Post-translational modificationi

The N-terminus is blocked.

Keywords - PTMi

Acetylation

Proteomic databases

PaxDbiQ64559.
PRIDEiQ64559.

PTM databases

iPTMnetiQ64559.
PhosphoSitePlusiQ64559.

Expressioni

Tissue specificityi

Isoform 1 is expressed constitutively in brain and testis. Isoform 2 is induced in liver by treatment with the peroxisome proliferator.

Gene expression databases

BgeeiENSRNOG00000010580.
ExpressionAtlasiQ64559. baseline and differential.
GenevisibleiQ64559. RN.

Interactioni

Subunit structurei

Homohexamer.By similarity

Protein-protein interaction databases

STRINGi10116.ENSRNOP00000014213.

Structurei

3D structure databases

ProteinModelPortaliQ64559.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini51 – 169HotDog ACOT-type 1PROSITE-ProRule annotationAdd BLAST119
Domaini225 – 339HotDog ACOT-type 2PROSITE-ProRule annotationAdd BLAST115

Domaini

Both HotDog ACOT-type hydrolase domains are required for efficient activity.By similarity

Sequence similaritiesi

Contains 2 HotDog ACOT-type domains.PROSITE-ProRule annotation

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiKOG2763. Eukaryota.
COG1607. LUCA.
GeneTreeiENSGT00760000119297.
HOGENOMiHOG000007663.
HOVERGENiHBG036928.
InParanoidiQ64559.
KOiK17360.
OrthoDBiEOG091G0CG4.
PhylomeDBiQ64559.
TreeFamiTF329579.

Family and domain databases

Gene3Di3.10.129.10. 2 hits.
InterProiIPR033120. HOTDOG_ACOT.
IPR029069. HotDog_dom.
IPR006683. Thioestr_dom.
[Graphical view]
PfamiPF03061. 4HBT. 2 hits.
[Graphical view]
SUPFAMiSSF54637. SSF54637. 2 hits.
PROSITEiPS51770. HOTDOG_ACOT. 2 hits.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 2 (identifier: Q64559-2) [UniParc]FASTAAdd to basket
Also known as: LACH1, MTE-II

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MKLLARTLYL WEVGRQVASW SLTSGQECLV LRETWWASMR AVRTRAVHHK
60 70 80 90 100
PGHCIAMGRI MRPDDANVAG NVHGGTILKM IEEAGVIIST RHCNSQNGER
110 120 130 140 150
CVAALARVER TDFLSPMCIG EVAHVSAEIT YTSKHSVEVQ VHVLSENILT
160 170 180 190 200
GTKKLTNKAT LWYVPLSLKN VDKVLEVPPI VYLRQEQEEE GRKRYEAQKL
210 220 230 240 250
ERMETKWRNG DIVQPILNPE PNTVSYSQSS LIHLVGPSDC TLHGFVHGGV
260 270 280 290 300
TMKLMDEVAG IVAARHCKTN IVTASVDAIN FHDKIRKGCV ITISGRMTFT
310 320 330 340 350
SNKSMEIEVL VDADPVVDNS QKRYRAASAF FTYVSLNQEG KPLPVPQLVP
360 370 380
ETEDEKKRFE EGKGRYLQMK AKRQGHTEPQ P
Length:381
Mass (Da):42,735
Last modified:January 10, 2006 - v4
Checksum:iF19CB7B34A4BE5D7
GO
Isoform 1 (identifier: Q64559-1) [UniParc]FASTAAdd to basket
Also known as: BACH, CTE-IIa, CTE-II

The sequence of this isoform differs from the canonical sequence as follows:
     1-58: MKLLARTLYLWEVGRQVASWSLTSGQECLVLRETWWASMRAVRTRAVHHKPGHCIAMG → MSGPTTDTPAAIQIC

Show »
Length:338
Mass (Da):37,561
Checksum:i0AF14A2D55DB12A2
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti86V → A in AAC53202 (PubMed:8631842).Curated1
Sequence conflicti89S → R in AAC53202 (PubMed:8631842).Curated1
Sequence conflicti144L → M in AAC53202 (PubMed:8631842).Curated1
Sequence conflicti171V → A in BAA19627 (PubMed:9125130).Curated1
Sequence conflicti216I → V in AAC53202 (PubMed:8631842).Curated1
Sequence conflicti279I → V in BAA19627 (PubMed:9125130).Curated1
Sequence conflicti343L → M in AAC53202 (PubMed:8631842).Curated1
Sequence conflicti372K → N in AAC53202 (PubMed:8631842).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0169561 – 58MKLLA…CIAMG → MSGPTTDTPAAIQIC in isoform 1. 4 PublicationsAdd BLAST58

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U49694 mRNA. Translation: AAC53202.1.
D88890 mRNA. Translation: BAA19626.1.
D88891 mRNA. Translation: BAA19627.2.
Y09332 mRNA. Translation: CAA70512.1.
BC087716 mRNA. Translation: AAH87716.1.
PIRiJC5415.
JC5416.
RefSeqiNP_001139533.1. NM_001146061.1. [Q64559-2]
NP_037346.2. NM_013214.4.
UniGeneiRn.6024.

Genome annotation databases

EnsembliENSRNOT00000014213; ENSRNOP00000014213; ENSRNOG00000010580. [Q64559-2]
GeneIDi26759.
KEGGirno:26759.
UCSCiRGD:628856. rat. [Q64559-2]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U49694 mRNA. Translation: AAC53202.1.
D88890 mRNA. Translation: BAA19626.1.
D88891 mRNA. Translation: BAA19627.2.
Y09332 mRNA. Translation: CAA70512.1.
BC087716 mRNA. Translation: AAH87716.1.
PIRiJC5415.
JC5416.
RefSeqiNP_001139533.1. NM_001146061.1. [Q64559-2]
NP_037346.2. NM_013214.4.
UniGeneiRn.6024.

3D structure databases

ProteinModelPortaliQ64559.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10116.ENSRNOP00000014213.

Chemistry databases

SwissLipidsiSLP:000000586.
SLP:000000614. [Q64559-1]

PTM databases

iPTMnetiQ64559.
PhosphoSitePlusiQ64559.

Proteomic databases

PaxDbiQ64559.
PRIDEiQ64559.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSRNOT00000014213; ENSRNOP00000014213; ENSRNOG00000010580. [Q64559-2]
GeneIDi26759.
KEGGirno:26759.
UCSCiRGD:628856. rat. [Q64559-2]

Organism-specific databases

CTDi11332.
RGDi628856. Acot7.

Phylogenomic databases

eggNOGiKOG2763. Eukaryota.
COG1607. LUCA.
GeneTreeiENSGT00760000119297.
HOGENOMiHOG000007663.
HOVERGENiHBG036928.
InParanoidiQ64559.
KOiK17360.
OrthoDBiEOG091G0CG4.
PhylomeDBiQ64559.
TreeFamiTF329579.

Enzyme and pathway databases

BRENDAi3.1.2.2. 5301.
3.1.2.20. 5301.
ReactomeiR-RNO-75105. Fatty Acyl-CoA Biosynthesis.
SABIO-RKQ64559.

Miscellaneous databases

PROiQ64559.

Gene expression databases

BgeeiENSRNOG00000010580.
ExpressionAtlasiQ64559. baseline and differential.
GenevisibleiQ64559. RN.

Family and domain databases

Gene3Di3.10.129.10. 2 hits.
InterProiIPR033120. HOTDOG_ACOT.
IPR029069. HotDog_dom.
IPR006683. Thioestr_dom.
[Graphical view]
PfamiPF03061. 4HBT. 2 hits.
[Graphical view]
SUPFAMiSSF54637. SSF54637. 2 hits.
PROSITEiPS51770. HOTDOG_ACOT. 2 hits.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiBACH_RAT
AccessioniPrimary (citable) accession number: Q64559
Secondary accession number(s): O08652, O09041
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: January 10, 2006
Last modified: November 2, 2016
This is version 128 of the entry and version 4 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Caution

These proteins have been named according to their molecular weight (see PubMed:11755680): BACH (also called CTE-IIa and CTE-II), LACH1 (also called MTE-II) and ACT (also called CTE-IIb). It is unknown whether ACT corresponds to another isoform.Curated

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.