Q64518 (AT2A3_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 108.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Sarcoplasmic/endoplasmic reticulum calcium ATPase 3 Short name=SERCA3 Short name=SR Ca(2+)-ATPase 3 EC=3.6.3.8 Alternative name(s): Calcium pump 3 | ||
| Gene names |
| ||
| Organism | Mus musculus (Mouse) | ||
| Taxonomic identifier | 10090 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus |
Protein attributes
| Sequence length | 1038 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Function | This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the transport of the calcium. Transports calcium ions from the cytosol into the sarcoplasmic/endoplasmic reticulum lumen. Contributes to calcium sequestration involved in muscular excitation/contraction. |
| Catalytic activity | ATP + H2O + Ca2+[side 1] = ADP + phosphate + Ca2+[side 2]. |
| Subcellular location | Nucleus membrane; Multi-pass membrane protein By similarity. Endoplasmic reticulum membrane; Multi-pass membrane protein By similarity. Sarcoplasmic reticulum membrane; Multi-pass membrane protein By similarity. |
| Sequence similarities | Belongs to the cation transport ATPase (P-type) (TC 3.A.3) family. Type IIA subfamily. [View classification] |
Ontologies
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform SERCA3B (identifier: Q64518-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform SERCA3A (identifier: Q64518-2) The sequence of this isoform differs from the canonical sequence as follows: 994-1038: GVLGTFMQARSRQLPTTSRTPYHTGKKGPEVNPGSRGESPVWPSD → EKKDLK | ||||||
| Isoform SERCA3C (identifier: Q64518-3) The sequence of this isoform differs from the canonical sequence as follows: 1019-1038: KKGPEVNPGSRGESPVWPSD → LACKKKT |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1038 | 1038 | Sarcoplasmic/endoplasmic reticulum calcium ATPase 3 | PRO_0000046203 | |||||
Regions | |||||||||
| Topological domain | 1 – 48 | 48 | Cytoplasmic By similarity | ||||||
| Transmembrane | 49 – 69 | 21 | Helical; Name=1; By similarity | ||||||
| Topological domain | 70 – 89 | 20 | Lumenal By similarity | ||||||
| Transmembrane | 90 – 110 | 21 | Helical; Name=2; By similarity | ||||||
| Topological domain | 111 – 253 | 143 | Cytoplasmic By similarity | ||||||
| Transmembrane | 254 – 273 | 20 | Helical; Name=3; By similarity | ||||||
| Topological domain | 274 – 295 | 22 | Lumenal By similarity | ||||||
| Transmembrane | 296 – 313 | 18 | Helical; Name=4; By similarity | ||||||
| Topological domain | 314 – 757 | 444 | Cytoplasmic By similarity | ||||||
| Transmembrane | 758 – 777 | 20 | Helical; Name=5; By similarity | ||||||
| Topological domain | 778 – 787 | 10 | Lumenal By similarity | ||||||
| Transmembrane | 788 – 808 | 21 | Helical; Name=6; By similarity | ||||||
| Topological domain | 809 – 828 | 20 | Cytoplasmic By similarity | ||||||
| Transmembrane | 829 – 851 | 23 | Helical; Name=7; By similarity | ||||||
| Topological domain | 852 – 897 | 46 | Lumenal By similarity | ||||||
| Transmembrane | 898 – 917 | 20 | Helical; Name=8; By similarity | ||||||
| Topological domain | 918 – 930 | 13 | Cytoplasmic By similarity | ||||||
| Transmembrane | 931 – 949 | 19 | Helical; Name=9; By similarity | ||||||
| Topological domain | 950 – 964 | 15 | Lumenal By similarity | ||||||
| Transmembrane | 965 – 985 | 21 | Helical; Name=10; By similarity | ||||||
| Topological domain | 986 – 1038 | 53 | Cytoplasmic By similarity | ||||||
Sites | |||||||||
| Active site | 351 | 1 | 4-aspartylphosphate intermediate By similarity | ||||||
| Metal binding | 304 | 1 | Calcium 2; via carbonyl oxygen By similarity | ||||||
| Metal binding | 305 | 1 | Calcium 2; via carbonyl oxygen By similarity | ||||||
| Metal binding | 307 | 1 | Calcium 2; via carbonyl oxygen By similarity | ||||||
| Metal binding | 309 | 1 | Calcium 2 By similarity | ||||||
| Metal binding | 703 | 1 | Magnesium By similarity | ||||||
| Metal binding | 707 | 1 | Magnesium By similarity | ||||||
| Metal binding | 768 | 1 | Calcium 1 By similarity | ||||||
| Metal binding | 771 | 1 | Calcium 1 By similarity | ||||||
| Metal binding | 796 | 1 | Calcium 2 By similarity | ||||||
| Metal binding | 799 | 1 | Calcium 1 By similarity | ||||||
| Metal binding | 800 | 1 | Calcium 1 By similarity | ||||||
| Metal binding | 800 | 1 | Calcium 2 By similarity | ||||||
| Metal binding | 908 | 1 | Calcium 1 By similarity | ||||||
| Binding site | 515 | 1 | ATP By similarity | ||||||
Amino acid modifications | |||||||||
| Modified residue | 1 | 1 | N-acetylmethionine By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 994 – 1038 | 45 | GVLGT…VWPSD → EKKDLK in isoform SERCA3A. | VSP_000369 | |||||
| Alternative sequence | 1019 – 1038 | 20 | KKGPE…VWPSD → LACKKKT in isoform SERCA3C. | VSP_000370 | |||||
Experimental info | |||||||||
| Sequence conflict | 860 | 1 | T → A in AAB04098. Ref.1 | ||||||
| Sequence conflict | 860 | 1 | T → A in AAB04099. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | Tokuyama Y., Chen X., Roe M.W., Bell G.I. Submitted (JUL-1996) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS SERCA3A AND SERCA3B). Strain: C57BL/6. |
| [2] | Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C. Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [3] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA]. Strain: FVB/N. Tissue: Salivary gland. |
| [4] | "Structure of the human sarco/endoplasmic reticulum Ca2+-ATPase 3 gene. Promoter analysis and alternative splicing of the SERCA3 pre-mRNA." Dode L., De Greef C., Mountian I., Attard M., Town M.M., Casteels R., Wuytack F. J. Biol. Chem. 273:13982-13994(1998) [PubMed: 9593748] [Abstract] Cited for: PARTIAL NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM SERCA3A), ALTERNATIVE SPLICING. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | U49394 mRNA. Translation: AAB04099.1. U49393 mRNA. Translation: AAB04098.1. CH466596 Genomic DNA. Translation: EDL12704.1. BC017639 mRNA. Translation: AAH17639.1. Y15734, Y15735 Genomic DNA. Translation: CAA75744.1. Y15734, Y15735 Genomic DNA. Translation: CAA75745.1. Y15734, Y15735 Genomic DNA. Translation: CAA75743.1. Y15736 Genomic DNA. Translation: CAA75746.1. |
| IPI | IPI00336889. IPI00944111. IPI00988797. |
| RefSeq | NP_001156809.1. NM_001163337.1. NP_058025.2. NM_016745.3. |
| UniGene | Mm.6306. |
3D structure databases | |
| HSSP | HSSP built from PDB template 1SU4 based on UniProtKB P04191. |
| ProteinModelPortal | Q64518. |
| SMR | Q64518. Positions 1-994. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | Q64518. |
PTM databases | |
| PhosphoSite | Q64518. |
Proteomic databases | |
| PRIDE | Q64518. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENSMUST00000021142; ENSMUSP00000021142; ENSMUSG00000020788. ENSMUST00000108485; ENSMUSP00000104125; ENSMUSG00000020788. |
| GeneID | 53313. |
| KEGG | mmu:53313. |
Organism-specific databases | |
| CTD | 489. |
| MGI | MGI:1194503. Atp2a3. |
Phylogenomic databases | |
| eggNOG | maNOG16465. |
| HOGENOM | HBG456486. |
| HOVERGEN | HBG105648. |
| InParanoid | Q64518. |
| PhylomeDB | Q64518. |
Gene expression databases | |
| ArrayExpress | Q64518. |
| Bgee | Q64518. |
| CleanEx | MM_ATP2A3. |
| Genevestigator | Q64518. |
| GermOnline | ENSMUSG00000020788. Mus musculus. |
Family and domain databases | |
| InterPro | IPR023306. ATPase_cation_domN. IPR008250. ATPase_P-typ_ATPase-assoc-dom. IPR005782. ATPase_P-typ_Ca-transp. IPR006068. ATPase_P-typ_cation-transptr_C. IPR004014. ATPase_P-typ_cation-transptr_N. IPR023300. ATPase_P-typ_cyto_domA. IPR023299. ATPase_P-typ_cyto_domN. IPR001757. ATPase_P-typ_ion-transptr. IPR018303. ATPase_P-typ_P_site. IPR023298. ATPase_P-typ_TM_dom. IPR005834. Dehalogen-like_hydro. IPR023214. HAD-like_dom. [Graphical view] |
| Gene3D | G3DSA:2.70.150.10. ATPase_P-typ_cyto_domA. 2 hits. G3DSA:3.40.1110.10. ATPase_P-typ_cyto_domN. 1 hit. G3DSA:1.20.1110.10. ATPase_P-typ_TM_dom. 2 hits. |
| KO | K05853. |
| Pfam | PF00689. Cation_ATPase_C. 1 hit. PF00690. Cation_ATPase_N. 1 hit. PF00122. E1-E2_ATPase. 1 hit. PF00702. Hydrolase. 1 hit. [Graphical view] |
| PRINTS | PR00119. CATATPASE. |
| SMART | SM00831. Cation_ATPase_N. 1 hit. [Graphical view] |
| SUPFAM | SSF81660. ATPase_cation_domN. 1 hit. SSF56784. HAD-like_dom. 1 hit. |
| TIGRFAMs | TIGR01116. ATPase-IIA1_Ca. 1 hit. TIGR01494. ATPase_P-type. 3 hits. |
| PROSITE | PS00154. ATPASE_E1_E2. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| SOURCE | Search... |
Entry information
| Entry name | AT2A3_MOUSE | ||||||||
| Accession | Primary (citable) accession number: Q64518 Secondary accession number(s): O70625, Q64517, Q8VD16 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with