Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q64518

- AT2A3_MOUSE

UniProt

Q64518 - AT2A3_MOUSE

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Sarcoplasmic/endoplasmic reticulum calcium ATPase 3

Gene

Atp2a3

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at transcript leveli

Functioni

This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the transport of the calcium. Transports calcium ions from the cytosol into the sarcoplasmic/endoplasmic reticulum lumen. Contributes to calcium sequestration involved in muscular excitation/contraction.

Catalytic activityi

ATP + H2O + Ca2+(Side 1) = ADP + phosphate + Ca2+(Side 2).

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Metal bindingi304 – 3041Calcium 2; via carbonyl oxygenBy similarity
Metal bindingi305 – 3051Calcium 2; via carbonyl oxygenBy similarity
Metal bindingi307 – 3071Calcium 2; via carbonyl oxygenBy similarity
Metal bindingi309 – 3091Calcium 2By similarity
Active sitei351 – 35114-aspartylphosphate intermediateBy similarity
Binding sitei515 – 5151ATPBy similarity
Metal bindingi703 – 7031MagnesiumBy similarity
Metal bindingi707 – 7071MagnesiumBy similarity
Metal bindingi768 – 7681Calcium 1By similarity
Metal bindingi771 – 7711Calcium 1By similarity
Metal bindingi796 – 7961Calcium 2By similarity
Metal bindingi799 – 7991Calcium 1By similarity
Metal bindingi800 – 8001Calcium 1By similarity
Metal bindingi800 – 8001Calcium 2By similarity
Metal bindingi908 – 9081Calcium 1By similarity

GO - Molecular functioni

  1. ATP binding Source: UniProtKB-KW
  2. calcium-transporting ATPase activity Source: UniProtKB-EC
  3. metal ion binding Source: UniProtKB-KW
Complete GO annotation...

Keywords - Molecular functioni

Hydrolase

Keywords - Biological processi

Calcium transport, Ion transport, Transport

Keywords - Ligandi

ATP-binding, Calcium, Magnesium, Metal-binding, Nucleotide-binding

Enzyme and pathway databases

ReactomeiREACT_247905. Reduction of cytosolic Ca++ levels.
REACT_250224. Ion transport by P-type ATPases.

Names & Taxonomyi

Protein namesi
Recommended name:
Sarcoplasmic/endoplasmic reticulum calcium ATPase 3 (EC:3.6.3.8)
Short name:
SERCA3
Short name:
SR Ca(2+)-ATPase 3
Alternative name(s):
Calcium pump 3
Gene namesi
Name:Atp2a3
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589: Chromosome 11

Organism-specific databases

MGIiMGI:1194503. Atp2a3.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 4848CytoplasmicBy similarityAdd
BLAST
Transmembranei49 – 6921Helical; Name=1By similarityAdd
BLAST
Topological domaini70 – 8920LumenalBy similarityAdd
BLAST
Transmembranei90 – 11021Helical; Name=2By similarityAdd
BLAST
Topological domaini111 – 253143CytoplasmicBy similarityAdd
BLAST
Transmembranei254 – 27320Helical; Name=3By similarityAdd
BLAST
Topological domaini274 – 29522LumenalBy similarityAdd
BLAST
Transmembranei296 – 31318Helical; Name=4By similarityAdd
BLAST
Topological domaini314 – 757444CytoplasmicBy similarityAdd
BLAST
Transmembranei758 – 77720Helical; Name=5By similarityAdd
BLAST
Topological domaini778 – 78710LumenalBy similarity
Transmembranei788 – 80821Helical; Name=6By similarityAdd
BLAST
Topological domaini809 – 82820CytoplasmicBy similarityAdd
BLAST
Transmembranei829 – 85123Helical; Name=7By similarityAdd
BLAST
Topological domaini852 – 89746LumenalBy similarityAdd
BLAST
Transmembranei898 – 91720Helical; Name=8By similarityAdd
BLAST
Topological domaini918 – 93013CytoplasmicBy similarityAdd
BLAST
Transmembranei931 – 94919Helical; Name=9By similarityAdd
BLAST
Topological domaini950 – 96415LumenalBy similarityAdd
BLAST
Transmembranei965 – 98521Helical; Name=10By similarityAdd
BLAST
Topological domaini986 – 103853CytoplasmicBy similarityAdd
BLAST

GO - Cellular componenti

  1. endoplasmic reticulum Source: MGI
  2. integral component of membrane Source: UniProtKB-KW
  3. nucleus Source: UniProtKB-KW
  4. sarcoplasmic reticulum Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Endoplasmic reticulum, Membrane, Nucleus, Sarcoplasmic reticulum

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 10381038Sarcoplasmic/endoplasmic reticulum calcium ATPase 3PRO_0000046203Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei1 – 11N-acetylmethionineBy similarity
Modified residuei662 – 6621PhosphoserineBy similarity

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

MaxQBiQ64518.
PaxDbiQ64518.
PRIDEiQ64518.

PTM databases

PhosphoSiteiQ64518.

Expressioni

Gene expression databases

BgeeiQ64518.
CleanExiMM_ATP2A3.
ExpressionAtlasiQ64518. baseline and differential.
GenevestigatoriQ64518.

Interactioni

Protein-protein interaction databases

BioGridi207277. 1 interaction.
IntActiQ64518. 1 interaction.
MINTiMINT-4088610.

Structurei

3D structure databases

ProteinModelPortaliQ64518.
SMRiQ64518. Positions 1-994.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiCOG0474.
GeneTreeiENSGT00760000119003.
HOGENOMiHOG000265621.
HOVERGENiHBG105648.
InParanoidiQ64518.
KOiK05853.
OMAiACITRCY.
TreeFamiTF300651.

Family and domain databases

Gene3Di1.20.1110.10. 2 hits.
2.70.150.10. 2 hits.
3.40.1110.10. 1 hit.
InterProiIPR005782. ATPase_P-typ_Ca-transp_IIA.
IPR006068. ATPase_P-typ_cation-transptr_C.
IPR004014. ATPase_P-typ_cation-transptr_N.
IPR023299. ATPase_P-typ_cyto_domN.
IPR018303. ATPase_P-typ_P_site.
IPR023298. ATPase_P-typ_TM_dom.
IPR008250. ATPase_P-typ_transduc_dom_A.
IPR001757. Cation_transp_P_typ_ATPase.
IPR023214. HAD-like_dom.
[Graphical view]
PfamiPF00689. Cation_ATPase_C. 1 hit.
PF00690. Cation_ATPase_N. 1 hit.
PF00122. E1-E2_ATPase. 1 hit.
PF00702. Hydrolase. 1 hit.
[Graphical view]
PRINTSiPR00119. CATATPASE.
SMARTiSM00831. Cation_ATPase_N. 1 hit.
[Graphical view]
SUPFAMiSSF56784. SSF56784. 1 hit.
SSF81660. SSF81660. 1 hit.
TIGRFAMsiTIGR01116. ATPase-IIA1_Ca. 1 hit.
TIGR01494. ATPase_P-type. 3 hits.
PROSITEiPS00154. ATPASE_E1_E2. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform SERCA3B (identifier: Q64518-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MEEAHLLSAA DVLRRFSVTA EGGLSLEQVT DARERYGPNE LPTEEGKSLW
60 70 80 90 100
ELVVEQFEDL LVRILLLAAL VSFVLAWFEE GEETTTAFVE PLVIMLILVA
110 120 130 140 150
NAIVGVWQER NAESAIEALK EYEPEMGKVI RSDRKGVQRI RARDIVPGDI
160 170 180 190 200
VEVAVGDKVP ADLRLIEIKS TTLRVDQSIL TGESVSVTKH TDAIPDPRAV
210 220 230 240 250
NQDKKNMLFS GTNIASGKAL GVAVATGLQT ELGKIRSQMA AVEPERTPLQ
260 270 280 290 300
RKLDEFGRQL SHAISVICVA VWVINIGHFA DPAHGGSWLR GAVYYFKIAV
310 320 330 340 350
ALAVAAIPEG LPAVITTCLA LGTRRMARKN AIVRSLPSVE TLGCTSVICS
360 370 380 390 400
DKTGTLTTNQ MSVCRMFVVA EAEAGTCRLH EFTISGTTYT PEGEVRQGEQ
410 420 430 440 450
PVRCGQFDGL VELATICALC NDSALDYNEA KGVYEKVGEA TETALTCLVE
460 470 480 490 500
KMNVFDTDLK GLSRVERAGA CNSVIKQLMR KEFTLEFSRD RKSMSVYCTP
510 520 530 540 550
TRADPKVQGS KMFVKGAPES VIERCSSVRV GSRTAPLSTT SREHILAKIR
560 570 580 590 600
DWGSGSDTLR CLALATRDTP PRKEDMHLDD CSRFVQYETD LTFVGCVGML
610 620 630 640 650
DPPRPEVAAC ITRCSRAGIR VVMITGDNKG TAVAICRRLG IFGDTEDVLG
660 670 680 690 700
KAYTGREFDD LSPEQQRQAC RTARCFARVE PAHKSRIVEN LQSFNEITAM
710 720 730 740 750
TGDGVNDAPA LKKAEIGIAM GSGTAVAKSA AEMVLSDDNF ASIVAAVEEG
760 770 780 790 800
RAIYNNMKQF IRYLISSNVG EVVCIFLTAI LGLPEALIPV QLLWVNLVTD
810 820 830 840 850
GLPATALGFN PPDLDIMEKP PRNPREALIS GWLFFRYLAI GVYVGLATVA
860 870 880 890 900
AATWWFLYDT EGPQVTFYQL RNFLKCSEDN PLFAGIDCKV FESRFPTTMA
910 920 930 940 950
LSVLVTIEMC NALNSVSENQ SLLRMPPWLN PWLLGAVVMS MALHFLILLV
960 970 980 990 1000
PPLPLIFQVT PLSGRQWGVV LQMSLPVILL DEALKYLSRN HMDGVLGTFM
1010 1020 1030
QARSRQLPTT SRTPYHTGKK GPEVNPGSRG ESPVWPSD
Length:1,038
Mass (Da):113,638
Last modified:July 27, 2011 - v3
Checksum:iA7D6798E8B814F94
GO
Isoform SERCA3A (identifier: Q64518-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     994-1038: GVLGTFMQARSRQLPTTSRTPYHTGKKGPEVNPGSRGESPVWPSD → EKKDLK

Show »
Length:999
Mass (Da):109,530
Checksum:iF64B7046E792B6E7
GO
Isoform SERCA3C (identifier: Q64518-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1019-1038: KKGPEVNPGSRGESPVWPSD → LACKKKT

Show »
Length:1,025
Mass (Da):112,306
Checksum:i29A928D4B3F278F0
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti860 – 8601T → A in AAB04098. 1 PublicationCurated
Sequence conflicti860 – 8601T → A in AAB04099. 1 PublicationCurated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei994 – 103845GVLGT…VWPSD → EKKDLK in isoform SERCA3A. 1 PublicationVSP_000369Add
BLAST
Alternative sequencei1019 – 103820KKGPE…VWPSD → LACKKKT in isoform SERCA3C. CuratedVSP_000370Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U49394 mRNA. Translation: AAB04099.1.
U49393 mRNA. Translation: AAB04098.1.
CH466596 Genomic DNA. Translation: EDL12704.1.
BC017639 mRNA. Translation: AAH17639.1.
Y15734, Y15735 Genomic DNA. Translation: CAA75744.1.
Y15734, Y15735 Genomic DNA. Translation: CAA75745.1.
Y15734, Y15735 Genomic DNA. Translation: CAA75743.1.
Y15736 Genomic DNA. Translation: CAA75746.1.
CCDSiCCDS24991.1. [Q64518-1]
CCDS48843.1. [Q64518-2]
RefSeqiNP_001156809.1. NM_001163337.1.
NP_058025.2. NM_016745.3. [Q64518-1]
UniGeneiMm.6306.

Genome annotation databases

EnsembliENSMUST00000021142; ENSMUSP00000021142; ENSMUSG00000020788. [Q64518-1]
ENSMUST00000108485; ENSMUSP00000104125; ENSMUSG00000020788. [Q64518-2]
GeneIDi53313.
KEGGimmu:53313.
UCSCiuc007jzo.2. mouse. [Q64518-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U49394 mRNA. Translation: AAB04099.1 .
U49393 mRNA. Translation: AAB04098.1 .
CH466596 Genomic DNA. Translation: EDL12704.1 .
BC017639 mRNA. Translation: AAH17639.1 .
Y15734 , Y15735 Genomic DNA. Translation: CAA75744.1 .
Y15734 , Y15735 Genomic DNA. Translation: CAA75745.1 .
Y15734 , Y15735 Genomic DNA. Translation: CAA75743.1 .
Y15736 Genomic DNA. Translation: CAA75746.1 .
CCDSi CCDS24991.1. [Q64518-1 ]
CCDS48843.1. [Q64518-2 ]
RefSeqi NP_001156809.1. NM_001163337.1.
NP_058025.2. NM_016745.3. [Q64518-1 ]
UniGenei Mm.6306.

3D structure databases

ProteinModelPortali Q64518.
SMRi Q64518. Positions 1-994.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 207277. 1 interaction.
IntActi Q64518. 1 interaction.
MINTi MINT-4088610.

PTM databases

PhosphoSitei Q64518.

Proteomic databases

MaxQBi Q64518.
PaxDbi Q64518.
PRIDEi Q64518.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENSMUST00000021142 ; ENSMUSP00000021142 ; ENSMUSG00000020788 . [Q64518-1 ]
ENSMUST00000108485 ; ENSMUSP00000104125 ; ENSMUSG00000020788 . [Q64518-2 ]
GeneIDi 53313.
KEGGi mmu:53313.
UCSCi uc007jzo.2. mouse. [Q64518-1 ]

Organism-specific databases

CTDi 489.
MGIi MGI:1194503. Atp2a3.

Phylogenomic databases

eggNOGi COG0474.
GeneTreei ENSGT00760000119003.
HOGENOMi HOG000265621.
HOVERGENi HBG105648.
InParanoidi Q64518.
KOi K05853.
OMAi ACITRCY.
TreeFami TF300651.

Enzyme and pathway databases

Reactomei REACT_247905. Reduction of cytosolic Ca++ levels.
REACT_250224. Ion transport by P-type ATPases.

Miscellaneous databases

ChiTaRSi Atp2a3. mouse.
NextBioi 310097.
PROi Q64518.
SOURCEi Search...

Gene expression databases

Bgeei Q64518.
CleanExi MM_ATP2A3.
ExpressionAtlasi Q64518. baseline and differential.
Genevestigatori Q64518.

Family and domain databases

Gene3Di 1.20.1110.10. 2 hits.
2.70.150.10. 2 hits.
3.40.1110.10. 1 hit.
InterProi IPR005782. ATPase_P-typ_Ca-transp_IIA.
IPR006068. ATPase_P-typ_cation-transptr_C.
IPR004014. ATPase_P-typ_cation-transptr_N.
IPR023299. ATPase_P-typ_cyto_domN.
IPR018303. ATPase_P-typ_P_site.
IPR023298. ATPase_P-typ_TM_dom.
IPR008250. ATPase_P-typ_transduc_dom_A.
IPR001757. Cation_transp_P_typ_ATPase.
IPR023214. HAD-like_dom.
[Graphical view ]
Pfami PF00689. Cation_ATPase_C. 1 hit.
PF00690. Cation_ATPase_N. 1 hit.
PF00122. E1-E2_ATPase. 1 hit.
PF00702. Hydrolase. 1 hit.
[Graphical view ]
PRINTSi PR00119. CATATPASE.
SMARTi SM00831. Cation_ATPase_N. 1 hit.
[Graphical view ]
SUPFAMi SSF56784. SSF56784. 1 hit.
SSF81660. SSF81660. 1 hit.
TIGRFAMsi TIGR01116. ATPase-IIA1_Ca. 1 hit.
TIGR01494. ATPase_P-type. 3 hits.
PROSITEi PS00154. ATPASE_E1_E2. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. Tokuyama Y., Chen X., Roe M.W., Bell G.I.
    Submitted (JUL-1996) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS SERCA3A AND SERCA3B).
    Strain: C57BL/6.
  2. Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.
    Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA].
    Strain: FVB/N.
    Tissue: Salivary gland.
  4. "Structure of the human sarco/endoplasmic reticulum Ca2+-ATPase 3 gene. Promoter analysis and alternative splicing of the SERCA3 pre-mRNA."
    Dode L., De Greef C., Mountian I., Attard M., Town M.M., Casteels R., Wuytack F.
    J. Biol. Chem. 273:13982-13994(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: PARTIAL NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM SERCA3A), ALTERNATIVE SPLICING.

Entry informationi

Entry nameiAT2A3_MOUSE
AccessioniPrimary (citable) accession number: Q64518
Secondary accession number(s): O70625, Q64517, Q8VD16
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 18, 2001
Last sequence update: July 27, 2011
Last modified: November 26, 2014
This is version 129 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3