Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q64518

- AT2A3_MOUSE

UniProt

Q64518 - AT2A3_MOUSE

Protein

Sarcoplasmic/endoplasmic reticulum calcium ATPase 3

Gene

Atp2a3

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 127 (01 Oct 2014)
      Sequence version 3 (27 Jul 2011)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the transport of the calcium. Transports calcium ions from the cytosol into the sarcoplasmic/endoplasmic reticulum lumen. Contributes to calcium sequestration involved in muscular excitation/contraction.

    Catalytic activityi

    ATP + H2O + Ca2+(Side 1) = ADP + phosphate + Ca2+(Side 2).

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Metal bindingi304 – 3041Calcium 2; via carbonyl oxygenBy similarity
    Metal bindingi305 – 3051Calcium 2; via carbonyl oxygenBy similarity
    Metal bindingi307 – 3071Calcium 2; via carbonyl oxygenBy similarity
    Metal bindingi309 – 3091Calcium 2By similarity
    Active sitei351 – 35114-aspartylphosphate intermediateBy similarity
    Binding sitei515 – 5151ATPBy similarity
    Metal bindingi703 – 7031MagnesiumBy similarity
    Metal bindingi707 – 7071MagnesiumBy similarity
    Metal bindingi768 – 7681Calcium 1By similarity
    Metal bindingi771 – 7711Calcium 1By similarity
    Metal bindingi796 – 7961Calcium 2By similarity
    Metal bindingi799 – 7991Calcium 1By similarity
    Metal bindingi800 – 8001Calcium 1By similarity
    Metal bindingi800 – 8001Calcium 2By similarity
    Metal bindingi908 – 9081Calcium 1By similarity

    GO - Molecular functioni

    1. ATP binding Source: UniProtKB-KW
    2. calcium-transporting ATPase activity Source: UniProtKB-EC
    3. metal ion binding Source: UniProtKB-KW

    Keywords - Molecular functioni

    Hydrolase

    Keywords - Biological processi

    Calcium transport, Ion transport, Transport

    Keywords - Ligandi

    ATP-binding, Calcium, Magnesium, Metal-binding, Nucleotide-binding

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Sarcoplasmic/endoplasmic reticulum calcium ATPase 3 (EC:3.6.3.8)
    Short name:
    SERCA3
    Short name:
    SR Ca(2+)-ATPase 3
    Alternative name(s):
    Calcium pump 3
    Gene namesi
    Name:Atp2a3
    OrganismiMus musculus (Mouse)
    Taxonomic identifieri10090 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
    ProteomesiUP000000589: Chromosome 11

    Organism-specific databases

    MGIiMGI:1194503. Atp2a3.

    Subcellular locationi

    GO - Cellular componenti

    1. endoplasmic reticulum Source: MGI
    2. integral component of membrane Source: UniProtKB-KW
    3. nuclear membrane Source: UniProtKB-SubCell
    4. sarcoplasmic reticulum membrane Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Endoplasmic reticulum, Membrane, Nucleus, Sarcoplasmic reticulum

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 10381038Sarcoplasmic/endoplasmic reticulum calcium ATPase 3PRO_0000046203Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei1 – 11N-acetylmethionineBy similarity
    Modified residuei662 – 6621PhosphoserineBy similarity

    Keywords - PTMi

    Acetylation, Phosphoprotein

    Proteomic databases

    MaxQBiQ64518.
    PaxDbiQ64518.
    PRIDEiQ64518.

    PTM databases

    PhosphoSiteiQ64518.

    Expressioni

    Gene expression databases

    ArrayExpressiQ64518.
    BgeeiQ64518.
    CleanExiMM_ATP2A3.
    GenevestigatoriQ64518.

    Interactioni

    Protein-protein interaction databases

    BioGridi207277. 1 interaction.
    IntActiQ64518. 1 interaction.
    MINTiMINT-4088610.

    Structurei

    3D structure databases

    ProteinModelPortaliQ64518.
    SMRiQ64518. Positions 1-994.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini1 – 4848CytoplasmicBy similarityAdd
    BLAST
    Topological domaini70 – 8920LumenalBy similarityAdd
    BLAST
    Topological domaini111 – 253143CytoplasmicBy similarityAdd
    BLAST
    Topological domaini274 – 29522LumenalBy similarityAdd
    BLAST
    Topological domaini314 – 757444CytoplasmicBy similarityAdd
    BLAST
    Topological domaini778 – 78710LumenalBy similarity
    Topological domaini809 – 82820CytoplasmicBy similarityAdd
    BLAST
    Topological domaini852 – 89746LumenalBy similarityAdd
    BLAST
    Topological domaini918 – 93013CytoplasmicBy similarityAdd
    BLAST
    Topological domaini950 – 96415LumenalBy similarityAdd
    BLAST
    Topological domaini986 – 103853CytoplasmicBy similarityAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei49 – 6921Helical; Name=1By similarityAdd
    BLAST
    Transmembranei90 – 11021Helical; Name=2By similarityAdd
    BLAST
    Transmembranei254 – 27320Helical; Name=3By similarityAdd
    BLAST
    Transmembranei296 – 31318Helical; Name=4By similarityAdd
    BLAST
    Transmembranei758 – 77720Helical; Name=5By similarityAdd
    BLAST
    Transmembranei788 – 80821Helical; Name=6By similarityAdd
    BLAST
    Transmembranei829 – 85123Helical; Name=7By similarityAdd
    BLAST
    Transmembranei898 – 91720Helical; Name=8By similarityAdd
    BLAST
    Transmembranei931 – 94919Helical; Name=9By similarityAdd
    BLAST
    Transmembranei965 – 98521Helical; Name=10By similarityAdd
    BLAST

    Family & Domainsi

    Sequence similaritiesi

    Keywords - Domaini

    Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiCOG0474.
    GeneTreeiENSGT00560000076887.
    HOGENOMiHOG000265621.
    HOVERGENiHBG105648.
    InParanoidiQ8VD16.
    KOiK05853.
    OMAiACITRCY.
    TreeFamiTF300651.

    Family and domain databases

    Gene3Di1.20.1110.10. 2 hits.
    2.70.150.10. 2 hits.
    3.40.1110.10. 1 hit.
    InterProiIPR005782. ATPase_P-typ_Ca-transp_IIA.
    IPR006068. ATPase_P-typ_cation-transptr_C.
    IPR004014. ATPase_P-typ_cation-transptr_N.
    IPR023299. ATPase_P-typ_cyto_domN.
    IPR018303. ATPase_P-typ_P_site.
    IPR023298. ATPase_P-typ_TM_dom.
    IPR008250. ATPase_P-typ_transduc_dom_A.
    IPR001757. Cation_transp_P_typ_ATPase.
    IPR023214. HAD-like_dom.
    [Graphical view]
    PfamiPF00689. Cation_ATPase_C. 1 hit.
    PF00690. Cation_ATPase_N. 1 hit.
    PF00122. E1-E2_ATPase. 1 hit.
    PF00702. Hydrolase. 1 hit.
    [Graphical view]
    PRINTSiPR00119. CATATPASE.
    SMARTiSM00831. Cation_ATPase_N. 1 hit.
    [Graphical view]
    SUPFAMiSSF56784. SSF56784. 1 hit.
    SSF81660. SSF81660. 1 hit.
    TIGRFAMsiTIGR01116. ATPase-IIA1_Ca. 1 hit.
    TIGR01494. ATPase_P-type. 3 hits.
    PROSITEiPS00154. ATPASE_E1_E2. 1 hit.
    [Graphical view]

    Sequences (3)i

    Sequence statusi: Complete.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform SERCA3B (identifier: Q64518-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MEEAHLLSAA DVLRRFSVTA EGGLSLEQVT DARERYGPNE LPTEEGKSLW     50
    ELVVEQFEDL LVRILLLAAL VSFVLAWFEE GEETTTAFVE PLVIMLILVA 100
    NAIVGVWQER NAESAIEALK EYEPEMGKVI RSDRKGVQRI RARDIVPGDI 150
    VEVAVGDKVP ADLRLIEIKS TTLRVDQSIL TGESVSVTKH TDAIPDPRAV 200
    NQDKKNMLFS GTNIASGKAL GVAVATGLQT ELGKIRSQMA AVEPERTPLQ 250
    RKLDEFGRQL SHAISVICVA VWVINIGHFA DPAHGGSWLR GAVYYFKIAV 300
    ALAVAAIPEG LPAVITTCLA LGTRRMARKN AIVRSLPSVE TLGCTSVICS 350
    DKTGTLTTNQ MSVCRMFVVA EAEAGTCRLH EFTISGTTYT PEGEVRQGEQ 400
    PVRCGQFDGL VELATICALC NDSALDYNEA KGVYEKVGEA TETALTCLVE 450
    KMNVFDTDLK GLSRVERAGA CNSVIKQLMR KEFTLEFSRD RKSMSVYCTP 500
    TRADPKVQGS KMFVKGAPES VIERCSSVRV GSRTAPLSTT SREHILAKIR 550
    DWGSGSDTLR CLALATRDTP PRKEDMHLDD CSRFVQYETD LTFVGCVGML 600
    DPPRPEVAAC ITRCSRAGIR VVMITGDNKG TAVAICRRLG IFGDTEDVLG 650
    KAYTGREFDD LSPEQQRQAC RTARCFARVE PAHKSRIVEN LQSFNEITAM 700
    TGDGVNDAPA LKKAEIGIAM GSGTAVAKSA AEMVLSDDNF ASIVAAVEEG 750
    RAIYNNMKQF IRYLISSNVG EVVCIFLTAI LGLPEALIPV QLLWVNLVTD 800
    GLPATALGFN PPDLDIMEKP PRNPREALIS GWLFFRYLAI GVYVGLATVA 850
    AATWWFLYDT EGPQVTFYQL RNFLKCSEDN PLFAGIDCKV FESRFPTTMA 900
    LSVLVTIEMC NALNSVSENQ SLLRMPPWLN PWLLGAVVMS MALHFLILLV 950
    PPLPLIFQVT PLSGRQWGVV LQMSLPVILL DEALKYLSRN HMDGVLGTFM 1000
    QARSRQLPTT SRTPYHTGKK GPEVNPGSRG ESPVWPSD 1038
    Length:1,038
    Mass (Da):113,638
    Last modified:July 27, 2011 - v3
    Checksum:iA7D6798E8B814F94
    GO
    Isoform SERCA3A (identifier: Q64518-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         994-1038: GVLGTFMQARSRQLPTTSRTPYHTGKKGPEVNPGSRGESPVWPSD → EKKDLK

    Show »
    Length:999
    Mass (Da):109,530
    Checksum:iF64B7046E792B6E7
    GO
    Isoform SERCA3C (identifier: Q64518-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1019-1038: KKGPEVNPGSRGESPVWPSD → LACKKKT

    Show »
    Length:1,025
    Mass (Da):112,306
    Checksum:i29A928D4B3F278F0
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti860 – 8601T → A in AAB04098. 1 PublicationCurated
    Sequence conflicti860 – 8601T → A in AAB04099. 1 PublicationCurated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei994 – 103845GVLGT…VWPSD → EKKDLK in isoform SERCA3A. 1 PublicationVSP_000369Add
    BLAST
    Alternative sequencei1019 – 103820KKGPE…VWPSD → LACKKKT in isoform SERCA3C. CuratedVSP_000370Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    U49394 mRNA. Translation: AAB04099.1.
    U49393 mRNA. Translation: AAB04098.1.
    CH466596 Genomic DNA. Translation: EDL12704.1.
    BC017639 mRNA. Translation: AAH17639.1.
    Y15734, Y15735 Genomic DNA. Translation: CAA75744.1.
    Y15734, Y15735 Genomic DNA. Translation: CAA75745.1.
    Y15734, Y15735 Genomic DNA. Translation: CAA75743.1.
    Y15736 Genomic DNA. Translation: CAA75746.1.
    CCDSiCCDS24991.1. [Q64518-1]
    CCDS48843.1. [Q64518-2]
    RefSeqiNP_001156809.1. NM_001163337.1.
    NP_058025.2. NM_016745.3. [Q64518-1]
    UniGeneiMm.6306.

    Genome annotation databases

    EnsembliENSMUST00000021142; ENSMUSP00000021142; ENSMUSG00000020788. [Q64518-1]
    ENSMUST00000108485; ENSMUSP00000104125; ENSMUSG00000020788. [Q64518-2]
    GeneIDi53313.
    KEGGimmu:53313.
    UCSCiuc007jzo.2. mouse. [Q64518-1]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    U49394 mRNA. Translation: AAB04099.1 .
    U49393 mRNA. Translation: AAB04098.1 .
    CH466596 Genomic DNA. Translation: EDL12704.1 .
    BC017639 mRNA. Translation: AAH17639.1 .
    Y15734 , Y15735 Genomic DNA. Translation: CAA75744.1 .
    Y15734 , Y15735 Genomic DNA. Translation: CAA75745.1 .
    Y15734 , Y15735 Genomic DNA. Translation: CAA75743.1 .
    Y15736 Genomic DNA. Translation: CAA75746.1 .
    CCDSi CCDS24991.1. [Q64518-1 ]
    CCDS48843.1. [Q64518-2 ]
    RefSeqi NP_001156809.1. NM_001163337.1.
    NP_058025.2. NM_016745.3. [Q64518-1 ]
    UniGenei Mm.6306.

    3D structure databases

    ProteinModelPortali Q64518.
    SMRi Q64518. Positions 1-994.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 207277. 1 interaction.
    IntActi Q64518. 1 interaction.
    MINTi MINT-4088610.

    PTM databases

    PhosphoSitei Q64518.

    Proteomic databases

    MaxQBi Q64518.
    PaxDbi Q64518.
    PRIDEi Q64518.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENSMUST00000021142 ; ENSMUSP00000021142 ; ENSMUSG00000020788 . [Q64518-1 ]
    ENSMUST00000108485 ; ENSMUSP00000104125 ; ENSMUSG00000020788 . [Q64518-2 ]
    GeneIDi 53313.
    KEGGi mmu:53313.
    UCSCi uc007jzo.2. mouse. [Q64518-1 ]

    Organism-specific databases

    CTDi 489.
    MGIi MGI:1194503. Atp2a3.

    Phylogenomic databases

    eggNOGi COG0474.
    GeneTreei ENSGT00560000076887.
    HOGENOMi HOG000265621.
    HOVERGENi HBG105648.
    InParanoidi Q8VD16.
    KOi K05853.
    OMAi ACITRCY.
    TreeFami TF300651.

    Miscellaneous databases

    ChiTaRSi ATP2A3. mouse.
    NextBioi 310097.
    PROi Q64518.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q64518.
    Bgeei Q64518.
    CleanExi MM_ATP2A3.
    Genevestigatori Q64518.

    Family and domain databases

    Gene3Di 1.20.1110.10. 2 hits.
    2.70.150.10. 2 hits.
    3.40.1110.10. 1 hit.
    InterProi IPR005782. ATPase_P-typ_Ca-transp_IIA.
    IPR006068. ATPase_P-typ_cation-transptr_C.
    IPR004014. ATPase_P-typ_cation-transptr_N.
    IPR023299. ATPase_P-typ_cyto_domN.
    IPR018303. ATPase_P-typ_P_site.
    IPR023298. ATPase_P-typ_TM_dom.
    IPR008250. ATPase_P-typ_transduc_dom_A.
    IPR001757. Cation_transp_P_typ_ATPase.
    IPR023214. HAD-like_dom.
    [Graphical view ]
    Pfami PF00689. Cation_ATPase_C. 1 hit.
    PF00690. Cation_ATPase_N. 1 hit.
    PF00122. E1-E2_ATPase. 1 hit.
    PF00702. Hydrolase. 1 hit.
    [Graphical view ]
    PRINTSi PR00119. CATATPASE.
    SMARTi SM00831. Cation_ATPase_N. 1 hit.
    [Graphical view ]
    SUPFAMi SSF56784. SSF56784. 1 hit.
    SSF81660. SSF81660. 1 hit.
    TIGRFAMsi TIGR01116. ATPase-IIA1_Ca. 1 hit.
    TIGR01494. ATPase_P-type. 3 hits.
    PROSITEi PS00154. ATPASE_E1_E2. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. Tokuyama Y., Chen X., Roe M.W., Bell G.I.
      Submitted (JUL-1996) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS SERCA3A AND SERCA3B).
      Strain: C57BL/6.
    2. Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.
      Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA].
      Strain: FVB/N.
      Tissue: Salivary gland.
    4. "Structure of the human sarco/endoplasmic reticulum Ca2+-ATPase 3 gene. Promoter analysis and alternative splicing of the SERCA3 pre-mRNA."
      Dode L., De Greef C., Mountian I., Attard M., Town M.M., Casteels R., Wuytack F.
      J. Biol. Chem. 273:13982-13994(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: PARTIAL NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM SERCA3A), ALTERNATIVE SPLICING.

    Entry informationi

    Entry nameiAT2A3_MOUSE
    AccessioniPrimary (citable) accession number: Q64518
    Secondary accession number(s): O70625, Q64517, Q8VD16
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: October 18, 2001
    Last sequence update: July 27, 2011
    Last modified: October 1, 2014
    This is version 127 of the entry and version 3 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. MGD cross-references
      Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
    2. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3