Reviewed,
UniProtKB/Swiss-Prot Q64518 (AT2A3_MOUSE)
Last modified
February 9, 2010.
Version 92.
History...
Clusters with 100%,
90%,
50% identity |
Documents (2) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Sarcoplasmic/endoplasmic reticulum calcium ATPase 3 Short name=SR Ca(2+)-ATPase 3 Short name=SERCA3 EC=3.6.3.8 Alternative name(s): Calcium pump 3 | ||
| Gene names |
| ||
| Organism | Mus musculus (Mouse) | ||
| Taxonomic identifier | 10090 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus |
Protein attributes
| Sequence length | 1038 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level. |
General annotation (Comments)
| Function | This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the transport of the calcium. Transports calcium ions from the cytosol into the sarcoplasmic/endoplasmic reticulum lumen. Contributes to calcium sequestration involved in muscular excitation/contraction. |
| Catalytic activity | ATP + H2O + Ca2+(Cis) = ADP + phosphate + Ca2+(Trans). |
| Subcellular location | Nucleus membrane; Multi-pass membrane protein By similarity. Endoplasmic reticulum membrane; Multi-pass membrane protein By similarity. Sarcoplasmic reticulum membrane; Multi-pass membrane protein By similarity. |
| Sequence similarities | Belongs to the cation transport ATPase (P-type) family. Type IIA subfamily. |
Ontologies
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform SERCA3B (identifier: Q64518-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform SERCA3A (identifier: Q64518-2) The sequence of this isoform differs from the canonical sequence as follows: 994-1038: GVLGTFMQARSRQLPTTSRTPYHTGKKGPEVNPGSRGESPVWPSD → EKKDLK | ||||||
| Isoform SERCA3C (identifier: Q64518-3) The sequence of this isoform differs from the canonical sequence as follows: 1019-1038: KKGPEVNPGSRGESPVWPSD → LACKKKT |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1038 | 1038 | Sarcoplasmic/endoplasmic reticulum calcium ATPase 3 | PRO_0000046203 | |||||
Regions | |||||||||
| Topological domain | 1 – 48 | 48 | Cytoplasmic By similarity | ||||||
| Transmembrane | 49 – 69 | 21 | 1 By similarity | ||||||
| Topological domain | 70 – 89 | 20 | Lumenal By similarity | ||||||
| Transmembrane | 90 – 110 | 21 | 2 By similarity | ||||||
| Topological domain | 111 – 253 | 143 | Cytoplasmic By similarity | ||||||
| Transmembrane | 254 – 273 | 20 | 3 By similarity | ||||||
| Topological domain | 274 – 295 | 22 | Lumenal By similarity | ||||||
| Transmembrane | 296 – 313 | 18 | 4 By similarity | ||||||
| Topological domain | 314 – 757 | 444 | Cytoplasmic By similarity | ||||||
| Transmembrane | 758 – 777 | 20 | 5 By similarity | ||||||
| Topological domain | 778 – 787 | 10 | Lumenal By similarity | ||||||
| Transmembrane | 788 – 808 | 21 | 6 By similarity | ||||||
| Topological domain | 809 – 828 | 20 | Cytoplasmic By similarity | ||||||
| Transmembrane | 829 – 851 | 23 | 7 By similarity | ||||||
| Topological domain | 852 – 897 | 46 | Lumenal By similarity | ||||||
| Transmembrane | 898 – 917 | 20 | 8 By similarity | ||||||
| Topological domain | 918 – 930 | 13 | Cytoplasmic By similarity | ||||||
| Transmembrane | 931 – 949 | 19 | 9 By similarity | ||||||
| Topological domain | 950 – 964 | 15 | Lumenal By similarity | ||||||
| Transmembrane | 965 – 985 | 21 | 10 By similarity | ||||||
| Topological domain | 986 – 1038 | 53 | Cytoplasmic By similarity | ||||||
Sites | |||||||||
| Active site | 351 | 1 | 4-aspartylphosphate intermediate By similarity | ||||||
| Metal binding | 304 | 1 | Calcium 2; via carbonyl oxygen By similarity | ||||||
| Metal binding | 305 | 1 | Calcium 2; via carbonyl oxygen By similarity | ||||||
| Metal binding | 307 | 1 | Calcium 2; via carbonyl oxygen By similarity | ||||||
| Metal binding | 309 | 1 | Calcium 2 By similarity | ||||||
| Metal binding | 703 | 1 | Magnesium By similarity | ||||||
| Metal binding | 707 | 1 | Magnesium By similarity | ||||||
| Metal binding | 768 | 1 | Calcium 1 By similarity | ||||||
| Metal binding | 771 | 1 | Calcium 1 By similarity | ||||||
| Metal binding | 796 | 1 | Calcium 2 By similarity | ||||||
| Metal binding | 799 | 1 | Calcium 1 By similarity | ||||||
| Metal binding | 800 | 1 | Calcium 1 By similarity | ||||||
| Metal binding | 800 | 1 | Calcium 2 By similarity | ||||||
| Metal binding | 908 | 1 | Calcium 1 By similarity | ||||||
| Binding site | 515 | 1 | ATP By similarity | ||||||
Amino acid modifications | |||||||||
| Modified residue | 1 | 1 | N-acetylmethionine By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 994 – 1038 | 45 | GVLGT…VWPSD → EKKDLK in isoform SERCA3A. | VSP_000369 | |||||
| Alternative sequence | 1019 – 1038 | 20 | KKGPE…VWPSD → LACKKKT in isoform SERCA3C. | VSP_000370 | |||||
Sequences
| ||||||||||||||||||||||||||||||
References
| [1] | Tokuyama Y., Chen X., Roe M.W., Bell G.I. Submitted (JUL-1996) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS SERCA3A AND SERCA3B). Strain: C57BL/6. |
| [2] | "Structure of the human sarco/endoplasmic reticulum Ca2+-ATPase 3 gene. Promoter analysis and alternative splicing of the SERCA3 pre-mRNA." Dode L., De Greef C., Mountian I., Attard M., Town M.M., Casteels R., Wuytack F. J. Biol. Chem. 273:13982-13994(1998) [PubMed: 9593748] [Abstract] Cited for: PARTIAL NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM SERCA3A), ALTERNATIVE SPLICING. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | U49394 mRNA. Translation: AAB04099.1. U49393 mRNA. Translation: AAB04098.1. Y15734, Y15735 Genomic DNA. Translation: CAA75744.1. Y15734, Y15735 Genomic DNA. Translation: CAA75745.1. Y15734, Y15735 Genomic DNA. Translation: CAA75743.1. Y15736 Genomic DNA. Translation: CAA75746.1. |
| IPI | IPI00311200. IPI00336889. IPI00944111. |
| RefSeq | NP_001156809.1. NP_058025.2. |
| UniGene | Mm.6306 |
3D structure databases | |
| SMR | Q64518. Positions 1-994. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | Q64518. |
Proteomic databases | |
| PRIDE | Q64518. |
Genome annotation databases | |
| Ensembl | ENSMUST00000021142; ENSMUSP00000021142; ENSMUSG00000020788; Mus musculus. [Genome view] ENSMUST00000108485; ENSMUSP00000104125; ENSMUSG00000020788; Mus musculus. [Genome view] |
| GeneID | 53313. |
Organism-specific databases | |
| CTD | 53313. |
| MGI | MGI:1194503. Atp2a3. |
Phylogenomic databases | |
| eggNOG | maNOG16465. |
| HOGENOM | HBG456486. |
| HOVERGEN | Q64518. |
| InParanoid | Q64518. |
| PhylomeDB | Q64518. |
Enzyme and pathway databases | |
| BRENDA | 3.6.3.8. 244. |
Gene expression databases | |
| ArrayExpress | Q64518. |
| Bgee | Q64518. |
| CleanEx | MM_ATP2A3. |
| Genevestigator | Q64518. |
| GermOnline | ENSMUSG00000020788. Mus musculus. |
Family and domain databases | |
| InterPro | IPR008250. ATPase_P-typ_ATPase-assoc-dom. IPR005782. ATPase_P-typ_Ca-transp. IPR006068. ATPase_P-typ_cation-transptr_C. IPR004014. ATPase_P-typ_cation-transptr_N. IPR001757. ATPase_P-typ_ion-transptr. IPR018303. ATPase_P-typ_P_site. IPR005834. Dehalogen-like_hydro. [Graphical view] |
| PANTHER | PTHR11939. ATPase_P. 1 hit. |
| Pfam | PF00689. Cation_ATPase_C. 1 hit. PF00690. Cation_ATPase_N. 1 hit. PF00122. E1-E2_ATPase. 1 hit. PF00702. Hydrolase. 1 hit. [Graphical view] |
| PRINTS | PR00119. CATATPASE. |
| SMART | SM00831. Cation_ATPase_N. 1 hit. [Graphical view] |
| TIGRFAMs | TIGR01116. ATPase-IIA1_Ca. 1 hit. TIGR01494. ATPase_P-type. 4 hits. |
| PROSITE | PS00154. ATPASE_E1_E2. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| SOURCE | Search... |
Entry information
| Entry name | AT2A3_MOUSE | ||||||||
| Accession | Primary (citable) accession number: Q64518 Secondary accession number(s): O70625, Q64517 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with


