Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Sarcoplasmic/endoplasmic reticulum calcium ATPase 3

Gene

Atp2a3

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the transport of calcium. Transports calcium ions from the cytosol into the sarcoplasmic/endoplasmic reticulum lumen. Contributes to calcium sequestration involved in muscular excitation/contraction.By similarity

Catalytic activityi

ATP + H2O + Ca2+(Side 1) = ADP + phosphate + Ca2+(Side 2).

Enzyme regulationi

Inhibited by sarcolipin (SLN), phospholamban (PLN) and myoregulin (MRLN) (By similarity). Enhanced by DWORF; DWORF increases activity by displacing sarcolipin (SLN), phospholamban (PLN) and myoregulin (MRLN) (By similarity).By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Metal bindingi304Calcium 2; via carbonyl oxygenBy similarity1
Metal bindingi305Calcium 2; via carbonyl oxygenBy similarity1
Metal bindingi307Calcium 2; via carbonyl oxygenBy similarity1
Metal bindingi309Calcium 2By similarity1
Active sitei3514-aspartylphosphate intermediateBy similarity1
Binding sitei515ATPBy similarity1
Metal bindingi703MagnesiumBy similarity1
Metal bindingi707MagnesiumBy similarity1
Metal bindingi768Calcium 1By similarity1
Metal bindingi771Calcium 1By similarity1
Metal bindingi796Calcium 2By similarity1
Metal bindingi799Calcium 1By similarity1
Metal bindingi800Calcium 1By similarity1
Metal bindingi800Calcium 2By similarity1
Metal bindingi908Calcium 1By similarity1

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Hydrolase

Keywords - Biological processi

Calcium transport, Ion transport, Transport

Keywords - Ligandi

ATP-binding, Calcium, Magnesium, Metal-binding, Nucleotide-binding

Enzyme and pathway databases

ReactomeiR-MMU-418359. Reduction of cytosolic Ca++ levels.
R-MMU-5578775. Ion homeostasis.
R-MMU-936837. Ion transport by P-type ATPases.

Names & Taxonomyi

Protein namesi
Recommended name:
Sarcoplasmic/endoplasmic reticulum calcium ATPase 3 (EC:3.6.3.8)
Short name:
SERCA3
Short name:
SR Ca(2+)-ATPase 3
Alternative name(s):
Calcium pump 3
Gene namesi
Name:Atp2a3
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 11

Organism-specific databases

MGIiMGI:1194503. Atp2a3.

Subcellular locationi

  • Endoplasmic reticulum membrane By similarity; Multi-pass membrane protein By similarity
  • Sarcoplasmic reticulum membrane By similarity; Multi-pass membrane protein By similarity

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 48CytoplasmicBy similarityAdd BLAST48
Transmembranei49 – 69Helical; Name=1By similarityAdd BLAST21
Topological domaini70 – 89LumenalBy similarityAdd BLAST20
Transmembranei90 – 110Helical; Name=2By similarityAdd BLAST21
Topological domaini111 – 253CytoplasmicBy similarityAdd BLAST143
Transmembranei254 – 273Helical; Name=3By similarityAdd BLAST20
Topological domaini274 – 295LumenalBy similarityAdd BLAST22
Transmembranei296 – 313Helical; Name=4By similarityAdd BLAST18
Topological domaini314 – 757CytoplasmicBy similarityAdd BLAST444
Transmembranei758 – 777Helical; Name=5By similarityAdd BLAST20
Topological domaini778 – 787LumenalBy similarity10
Transmembranei788 – 808Helical; Name=6By similarityAdd BLAST21
Topological domaini809 – 828CytoplasmicBy similarityAdd BLAST20
Transmembranei829 – 851Helical; Name=7By similarityAdd BLAST23
Topological domaini852 – 897LumenalBy similarityAdd BLAST46
Transmembranei898 – 917Helical; Name=8By similarityAdd BLAST20
Topological domaini918 – 930CytoplasmicBy similarityAdd BLAST13
Transmembranei931 – 949Helical; Name=9By similarityAdd BLAST19
Topological domaini950 – 964LumenalBy similarityAdd BLAST15
Transmembranei965 – 985Helical; Name=10By similarityAdd BLAST21
Topological domaini986 – 1038CytoplasmicBy similarityAdd BLAST53

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Endoplasmic reticulum, Membrane, Sarcoplasmic reticulum

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000462031 – 1038Sarcoplasmic/endoplasmic reticulum calcium ATPase 3Add BLAST1038

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei1N-acetylmethionineBy similarity1
Modified residuei17PhosphoserineCombined sources1
Modified residuei19PhosphothreonineCombined sources1
Modified residuei25PhosphoserineCombined sources1
Modified residuei415PhosphothreonineCombined sources1
Modified residuei662PhosphoserineBy similarity1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

PaxDbiQ64518.
PRIDEiQ64518.

PTM databases

iPTMnetiQ64518.
PhosphoSitePlusiQ64518.
SwissPalmiQ64518.

Expressioni

Gene expression databases

BgeeiENSMUSG00000020788.
CleanExiMM_ATP2A3.
ExpressionAtlasiQ64518. baseline and differential.
GenevisibleiQ64518. MM.

Interactioni

Subunit structurei

Interacts with sarcolipin (SLN) (By similarity). Interacts with phospholamban (PLN) (By similarity). Interacts with myoregulin (MRLN). Interacts with DWORF (By similarity).By similarity

Protein-protein interaction databases

BioGridi207277. 1 interactor.
IntActiQ64518. 1 interactor.
MINTiMINT-4088610.
STRINGi10090.ENSMUSP00000021142.

Structurei

3D structure databases

ProteinModelPortaliQ64518.
SMRiQ64518.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni370 – 400Interaction with phospholamban 1By similarityAdd BLAST31
Regioni788 – 808Interaction with phospholamban 2By similarityAdd BLAST21

Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG0202. Eukaryota.
COG0474. LUCA.
GeneTreeiENSGT00850000132256.
HOGENOMiHOG000265621.
HOVERGENiHBG105648.
InParanoidiQ64518.
KOiK05853.
OMAiFAPEGHI.
OrthoDBiEOG091G01LE.
TreeFamiTF300651.

Family and domain databases

Gene3Di1.20.1110.10. 2 hits.
2.70.150.10. 2 hits.
3.40.1110.10. 1 hit.
InterProiIPR006068. ATPase_P-typ_cation-transptr_C.
IPR004014. ATPase_P-typ_cation-transptr_N.
IPR023299. ATPase_P-typ_cyto_domN.
IPR018303. ATPase_P-typ_P_site.
IPR023298. ATPase_P-typ_TM_dom.
IPR008250. ATPase_P-typ_transduc_dom_A.
IPR023214. HAD-like_dom.
IPR005782. P-type_ATPase_IIA.
IPR001757. P_typ_ATPase.
IPR030330. SERCA3.
[Graphical view]
PANTHERiPTHR24093:SF295. PTHR24093:SF295. 2 hits.
PfamiPF00689. Cation_ATPase_C. 1 hit.
PF00690. Cation_ATPase_N. 1 hit.
PF00122. E1-E2_ATPase. 1 hit.
PF08282. Hydrolase_3. 1 hit.
[Graphical view]
SMARTiSM00831. Cation_ATPase_N. 1 hit.
[Graphical view]
SUPFAMiSSF56784. SSF56784. 1 hit.
SSF81660. SSF81660. 1 hit.
TIGRFAMsiTIGR01116. ATPase-IIA1_Ca. 1 hit.
TIGR01494. ATPase_P-type. 3 hits.
PROSITEiPS00154. ATPASE_E1_E2. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform SERCA3B (identifier: Q64518-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MEEAHLLSAA DVLRRFSVTA EGGLSLEQVT DARERYGPNE LPTEEGKSLW
60 70 80 90 100
ELVVEQFEDL LVRILLLAAL VSFVLAWFEE GEETTTAFVE PLVIMLILVA
110 120 130 140 150
NAIVGVWQER NAESAIEALK EYEPEMGKVI RSDRKGVQRI RARDIVPGDI
160 170 180 190 200
VEVAVGDKVP ADLRLIEIKS TTLRVDQSIL TGESVSVTKH TDAIPDPRAV
210 220 230 240 250
NQDKKNMLFS GTNIASGKAL GVAVATGLQT ELGKIRSQMA AVEPERTPLQ
260 270 280 290 300
RKLDEFGRQL SHAISVICVA VWVINIGHFA DPAHGGSWLR GAVYYFKIAV
310 320 330 340 350
ALAVAAIPEG LPAVITTCLA LGTRRMARKN AIVRSLPSVE TLGCTSVICS
360 370 380 390 400
DKTGTLTTNQ MSVCRMFVVA EAEAGTCRLH EFTISGTTYT PEGEVRQGEQ
410 420 430 440 450
PVRCGQFDGL VELATICALC NDSALDYNEA KGVYEKVGEA TETALTCLVE
460 470 480 490 500
KMNVFDTDLK GLSRVERAGA CNSVIKQLMR KEFTLEFSRD RKSMSVYCTP
510 520 530 540 550
TRADPKVQGS KMFVKGAPES VIERCSSVRV GSRTAPLSTT SREHILAKIR
560 570 580 590 600
DWGSGSDTLR CLALATRDTP PRKEDMHLDD CSRFVQYETD LTFVGCVGML
610 620 630 640 650
DPPRPEVAAC ITRCSRAGIR VVMITGDNKG TAVAICRRLG IFGDTEDVLG
660 670 680 690 700
KAYTGREFDD LSPEQQRQAC RTARCFARVE PAHKSRIVEN LQSFNEITAM
710 720 730 740 750
TGDGVNDAPA LKKAEIGIAM GSGTAVAKSA AEMVLSDDNF ASIVAAVEEG
760 770 780 790 800
RAIYNNMKQF IRYLISSNVG EVVCIFLTAI LGLPEALIPV QLLWVNLVTD
810 820 830 840 850
GLPATALGFN PPDLDIMEKP PRNPREALIS GWLFFRYLAI GVYVGLATVA
860 870 880 890 900
AATWWFLYDT EGPQVTFYQL RNFLKCSEDN PLFAGIDCKV FESRFPTTMA
910 920 930 940 950
LSVLVTIEMC NALNSVSENQ SLLRMPPWLN PWLLGAVVMS MALHFLILLV
960 970 980 990 1000
PPLPLIFQVT PLSGRQWGVV LQMSLPVILL DEALKYLSRN HMDGVLGTFM
1010 1020 1030
QARSRQLPTT SRTPYHTGKK GPEVNPGSRG ESPVWPSD
Length:1,038
Mass (Da):113,638
Last modified:July 27, 2011 - v3
Checksum:iA7D6798E8B814F94
GO
Isoform SERCA3A (identifier: Q64518-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     994-1038: GVLGTFMQARSRQLPTTSRTPYHTGKKGPEVNPGSRGESPVWPSD → EKKDLK

Show »
Length:999
Mass (Da):109,530
Checksum:iF64B7046E792B6E7
GO
Isoform SERCA3C (identifier: Q64518-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1019-1038: KKGPEVNPGSRGESPVWPSD → LACKKKT

Show »
Length:1,025
Mass (Da):112,306
Checksum:i29A928D4B3F278F0
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti860T → A in AAB04098 (Ref. 1) Curated1
Sequence conflicti860T → A in AAB04099 (Ref. 1) Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_000369994 – 1038GVLGT…VWPSD → EKKDLK in isoform SERCA3A. 1 PublicationAdd BLAST45
Alternative sequenceiVSP_0003701019 – 1038KKGPE…VWPSD → LACKKKT in isoform SERCA3C. CuratedAdd BLAST20

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U49394 mRNA. Translation: AAB04099.1.
U49393 mRNA. Translation: AAB04098.1.
CH466596 Genomic DNA. Translation: EDL12704.1.
BC017639 mRNA. Translation: AAH17639.1.
Y15734, Y15735 Genomic DNA. Translation: CAA75744.1.
Y15734, Y15735 Genomic DNA. Translation: CAA75745.1.
Y15734, Y15735 Genomic DNA. Translation: CAA75743.1.
Y15736 Genomic DNA. Translation: CAA75746.1.
CCDSiCCDS24991.1. [Q64518-1]
CCDS48843.1. [Q64518-2]
RefSeqiNP_001156809.1. NM_001163337.1.
NP_058025.2. NM_016745.3. [Q64518-1]
UniGeneiMm.6306.

Genome annotation databases

EnsembliENSMUST00000021142; ENSMUSP00000021142; ENSMUSG00000020788. [Q64518-1]
ENSMUST00000108485; ENSMUSP00000104125; ENSMUSG00000020788. [Q64518-2]
GeneIDi53313.
KEGGimmu:53313.
UCSCiuc007jzo.2. mouse. [Q64518-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U49394 mRNA. Translation: AAB04099.1.
U49393 mRNA. Translation: AAB04098.1.
CH466596 Genomic DNA. Translation: EDL12704.1.
BC017639 mRNA. Translation: AAH17639.1.
Y15734, Y15735 Genomic DNA. Translation: CAA75744.1.
Y15734, Y15735 Genomic DNA. Translation: CAA75745.1.
Y15734, Y15735 Genomic DNA. Translation: CAA75743.1.
Y15736 Genomic DNA. Translation: CAA75746.1.
CCDSiCCDS24991.1. [Q64518-1]
CCDS48843.1. [Q64518-2]
RefSeqiNP_001156809.1. NM_001163337.1.
NP_058025.2. NM_016745.3. [Q64518-1]
UniGeneiMm.6306.

3D structure databases

ProteinModelPortaliQ64518.
SMRiQ64518.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi207277. 1 interactor.
IntActiQ64518. 1 interactor.
MINTiMINT-4088610.
STRINGi10090.ENSMUSP00000021142.

PTM databases

iPTMnetiQ64518.
PhosphoSitePlusiQ64518.
SwissPalmiQ64518.

Proteomic databases

PaxDbiQ64518.
PRIDEiQ64518.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000021142; ENSMUSP00000021142; ENSMUSG00000020788. [Q64518-1]
ENSMUST00000108485; ENSMUSP00000104125; ENSMUSG00000020788. [Q64518-2]
GeneIDi53313.
KEGGimmu:53313.
UCSCiuc007jzo.2. mouse. [Q64518-1]

Organism-specific databases

CTDi489.
MGIiMGI:1194503. Atp2a3.

Phylogenomic databases

eggNOGiKOG0202. Eukaryota.
COG0474. LUCA.
GeneTreeiENSGT00850000132256.
HOGENOMiHOG000265621.
HOVERGENiHBG105648.
InParanoidiQ64518.
KOiK05853.
OMAiFAPEGHI.
OrthoDBiEOG091G01LE.
TreeFamiTF300651.

Enzyme and pathway databases

ReactomeiR-MMU-418359. Reduction of cytosolic Ca++ levels.
R-MMU-5578775. Ion homeostasis.
R-MMU-936837. Ion transport by P-type ATPases.

Miscellaneous databases

ChiTaRSiAtp2a3. mouse.
PROiQ64518.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000020788.
CleanExiMM_ATP2A3.
ExpressionAtlasiQ64518. baseline and differential.
GenevisibleiQ64518. MM.

Family and domain databases

Gene3Di1.20.1110.10. 2 hits.
2.70.150.10. 2 hits.
3.40.1110.10. 1 hit.
InterProiIPR006068. ATPase_P-typ_cation-transptr_C.
IPR004014. ATPase_P-typ_cation-transptr_N.
IPR023299. ATPase_P-typ_cyto_domN.
IPR018303. ATPase_P-typ_P_site.
IPR023298. ATPase_P-typ_TM_dom.
IPR008250. ATPase_P-typ_transduc_dom_A.
IPR023214. HAD-like_dom.
IPR005782. P-type_ATPase_IIA.
IPR001757. P_typ_ATPase.
IPR030330. SERCA3.
[Graphical view]
PANTHERiPTHR24093:SF295. PTHR24093:SF295. 2 hits.
PfamiPF00689. Cation_ATPase_C. 1 hit.
PF00690. Cation_ATPase_N. 1 hit.
PF00122. E1-E2_ATPase. 1 hit.
PF08282. Hydrolase_3. 1 hit.
[Graphical view]
SMARTiSM00831. Cation_ATPase_N. 1 hit.
[Graphical view]
SUPFAMiSSF56784. SSF56784. 1 hit.
SSF81660. SSF81660. 1 hit.
TIGRFAMsiTIGR01116. ATPase-IIA1_Ca. 1 hit.
TIGR01494. ATPase_P-type. 3 hits.
PROSITEiPS00154. ATPASE_E1_E2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiAT2A3_MOUSE
AccessioniPrimary (citable) accession number: Q64518
Secondary accession number(s): O70625, Q64517, Q8VD16
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 18, 2001
Last sequence update: July 27, 2011
Last modified: November 2, 2016
This is version 149 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.