Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q64518 (AT2A3_MOUSE) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 126. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (2) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Sarcoplasmic/endoplasmic reticulum calcium ATPase 3

Short name=SERCA3
Short name=SR Ca(2+)-ATPase 3
EC=3.6.3.8
Alternative name(s):
Calcium pump 3
Gene names
Name:Atp2a3
OrganismMus musculus (Mouse) [Reference proteome]
Taxonomic identifier10090 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus

Protein attributes

Sequence length1038 AA.
Sequence statusComplete.
Protein existenceEvidence at transcript level

General annotation (Comments)

Function

This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the transport of the calcium. Transports calcium ions from the cytosol into the sarcoplasmic/endoplasmic reticulum lumen. Contributes to calcium sequestration involved in muscular excitation/contraction.

Catalytic activity

ATP + H2O + Ca2+(Side 1) = ADP + phosphate + Ca2+(Side 2).

Subcellular location

Nucleus membrane; Multi-pass membrane protein By similarity. Endoplasmic reticulum membrane; Multi-pass membrane protein By similarity. Sarcoplasmic reticulum membrane; Multi-pass membrane protein By similarity.

Sequence similarities

Belongs to the cation transport ATPase (P-type) (TC 3.A.3) family. Type IIA subfamily. [View classification]

Alternative products

This entry describes 3 isoforms produced by alternative splicing. [Align] [Select]
Isoform SERCA3B (identifier: Q64518-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform SERCA3A (identifier: Q64518-2)

The sequence of this isoform differs from the canonical sequence as follows:
     994-1038: GVLGTFMQARSRQLPTTSRTPYHTGKKGPEVNPGSRGESPVWPSD → EKKDLK
Isoform SERCA3C (identifier: Q64518-3)

The sequence of this isoform differs from the canonical sequence as follows:
     1019-1038: KKGPEVNPGSRGESPVWPSD → LACKKKT

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 10381038Sarcoplasmic/endoplasmic reticulum calcium ATPase 3
PRO_0000046203

Regions

Topological domain1 – 4848Cytoplasmic By similarity
Transmembrane49 – 6921Helical; Name=1; By similarity
Topological domain70 – 8920Lumenal By similarity
Transmembrane90 – 11021Helical; Name=2; By similarity
Topological domain111 – 253143Cytoplasmic By similarity
Transmembrane254 – 27320Helical; Name=3; By similarity
Topological domain274 – 29522Lumenal By similarity
Transmembrane296 – 31318Helical; Name=4; By similarity
Topological domain314 – 757444Cytoplasmic By similarity
Transmembrane758 – 77720Helical; Name=5; By similarity
Topological domain778 – 78710Lumenal By similarity
Transmembrane788 – 80821Helical; Name=6; By similarity
Topological domain809 – 82820Cytoplasmic By similarity
Transmembrane829 – 85123Helical; Name=7; By similarity
Topological domain852 – 89746Lumenal By similarity
Transmembrane898 – 91720Helical; Name=8; By similarity
Topological domain918 – 93013Cytoplasmic By similarity
Transmembrane931 – 94919Helical; Name=9; By similarity
Topological domain950 – 96415Lumenal By similarity
Transmembrane965 – 98521Helical; Name=10; By similarity
Topological domain986 – 103853Cytoplasmic By similarity

Sites

Active site35114-aspartylphosphate intermediate By similarity
Metal binding3041Calcium 2; via carbonyl oxygen By similarity
Metal binding3051Calcium 2; via carbonyl oxygen By similarity
Metal binding3071Calcium 2; via carbonyl oxygen By similarity
Metal binding3091Calcium 2 By similarity
Metal binding7031Magnesium By similarity
Metal binding7071Magnesium By similarity
Metal binding7681Calcium 1 By similarity
Metal binding7711Calcium 1 By similarity
Metal binding7961Calcium 2 By similarity
Metal binding7991Calcium 1 By similarity
Metal binding8001Calcium 1 By similarity
Metal binding8001Calcium 2 By similarity
Metal binding9081Calcium 1 By similarity
Binding site5151ATP By similarity

Amino acid modifications

Modified residue11N-acetylmethionine By similarity
Modified residue6621Phosphoserine By similarity

Natural variations

Alternative sequence994 – 103845GVLGT…VWPSD → EKKDLK in isoform SERCA3A.
VSP_000369
Alternative sequence1019 – 103820KKGPE…VWPSD → LACKKKT in isoform SERCA3C.
VSP_000370

Experimental info

Sequence conflict8601T → A in AAB04098. Ref.1
Sequence conflict8601T → A in AAB04099. Ref.1

Sequences

Sequence LengthMass (Da)Tools
Isoform SERCA3B [UniParc].

Last modified July 27, 2011. Version 3.
Checksum: A7D6798E8B814F94

FASTA1,038113,638
        10         20         30         40         50         60 
MEEAHLLSAA DVLRRFSVTA EGGLSLEQVT DARERYGPNE LPTEEGKSLW ELVVEQFEDL 

        70         80         90        100        110        120 
LVRILLLAAL VSFVLAWFEE GEETTTAFVE PLVIMLILVA NAIVGVWQER NAESAIEALK 

       130        140        150        160        170        180 
EYEPEMGKVI RSDRKGVQRI RARDIVPGDI VEVAVGDKVP ADLRLIEIKS TTLRVDQSIL 

       190        200        210        220        230        240 
TGESVSVTKH TDAIPDPRAV NQDKKNMLFS GTNIASGKAL GVAVATGLQT ELGKIRSQMA 

       250        260        270        280        290        300 
AVEPERTPLQ RKLDEFGRQL SHAISVICVA VWVINIGHFA DPAHGGSWLR GAVYYFKIAV 

       310        320        330        340        350        360 
ALAVAAIPEG LPAVITTCLA LGTRRMARKN AIVRSLPSVE TLGCTSVICS DKTGTLTTNQ 

       370        380        390        400        410        420 
MSVCRMFVVA EAEAGTCRLH EFTISGTTYT PEGEVRQGEQ PVRCGQFDGL VELATICALC 

       430        440        450        460        470        480 
NDSALDYNEA KGVYEKVGEA TETALTCLVE KMNVFDTDLK GLSRVERAGA CNSVIKQLMR 

       490        500        510        520        530        540 
KEFTLEFSRD RKSMSVYCTP TRADPKVQGS KMFVKGAPES VIERCSSVRV GSRTAPLSTT 

       550        560        570        580        590        600 
SREHILAKIR DWGSGSDTLR CLALATRDTP PRKEDMHLDD CSRFVQYETD LTFVGCVGML 

       610        620        630        640        650        660 
DPPRPEVAAC ITRCSRAGIR VVMITGDNKG TAVAICRRLG IFGDTEDVLG KAYTGREFDD 

       670        680        690        700        710        720 
LSPEQQRQAC RTARCFARVE PAHKSRIVEN LQSFNEITAM TGDGVNDAPA LKKAEIGIAM 

       730        740        750        760        770        780 
GSGTAVAKSA AEMVLSDDNF ASIVAAVEEG RAIYNNMKQF IRYLISSNVG EVVCIFLTAI 

       790        800        810        820        830        840 
LGLPEALIPV QLLWVNLVTD GLPATALGFN PPDLDIMEKP PRNPREALIS GWLFFRYLAI 

       850        860        870        880        890        900 
GVYVGLATVA AATWWFLYDT EGPQVTFYQL RNFLKCSEDN PLFAGIDCKV FESRFPTTMA 

       910        920        930        940        950        960 
LSVLVTIEMC NALNSVSENQ SLLRMPPWLN PWLLGAVVMS MALHFLILLV PPLPLIFQVT 

       970        980        990       1000       1010       1020 
PLSGRQWGVV LQMSLPVILL DEALKYLSRN HMDGVLGTFM QARSRQLPTT SRTPYHTGKK 

      1030 
GPEVNPGSRG ESPVWPSD 

« Hide

Isoform SERCA3A [UniParc].

Checksum: F64B7046E792B6E7
Show »

FASTA999109,530
Isoform SERCA3C [UniParc].

Checksum: 29A928D4B3F278F0
Show »

FASTA1,025112,306

References

« Hide 'large scale' references
[1]Tokuyama Y., Chen X., Roe M.W., Bell G.I.
Submitted (JUL-1996) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS SERCA3A AND SERCA3B).
Strain: C57BL/6.
[2]Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[3]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA].
Strain: FVB/N.
Tissue: Salivary gland.
[4]"Structure of the human sarco/endoplasmic reticulum Ca2+-ATPase 3 gene. Promoter analysis and alternative splicing of the SERCA3 pre-mRNA."
Dode L., De Greef C., Mountian I., Attard M., Town M.M., Casteels R., Wuytack F.
J. Biol. Chem. 273:13982-13994(1998) [PubMed] [Europe PMC] [Abstract]
Cited for: PARTIAL NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM SERCA3A), ALTERNATIVE SPLICING.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
U49394 mRNA. Translation: AAB04099.1.
U49393 mRNA. Translation: AAB04098.1.
CH466596 Genomic DNA. Translation: EDL12704.1.
BC017639 mRNA. Translation: AAH17639.1.
Y15734, Y15735 Genomic DNA. Translation: CAA75744.1.
Y15734, Y15735 Genomic DNA. Translation: CAA75745.1.
Y15734, Y15735 Genomic DNA. Translation: CAA75743.1.
Y15736 Genomic DNA. Translation: CAA75746.1.
CCDSCCDS24991.1. [Q64518-1]
CCDS48843.1. [Q64518-2]
RefSeqNP_001156809.1. NM_001163337.1.
NP_058025.2. NM_016745.3. [Q64518-1]
UniGeneMm.6306.

3D structure databases

ProteinModelPortalQ64518.
SMRQ64518. Positions 1-994.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid207277. 1 interaction.
IntActQ64518. 1 interaction.
MINTMINT-4088610.

PTM databases

PhosphoSiteQ64518.

Proteomic databases

MaxQBQ64518.
PaxDbQ64518.
PRIDEQ64518.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENSMUST00000021142; ENSMUSP00000021142; ENSMUSG00000020788. [Q64518-1]
ENSMUST00000108485; ENSMUSP00000104125; ENSMUSG00000020788. [Q64518-2]
GeneID53313.
KEGGmmu:53313.
UCSCuc007jzo.2. mouse. [Q64518-1]

Organism-specific databases

CTD489.
MGIMGI:1194503. Atp2a3.

Phylogenomic databases

eggNOGCOG0474.
GeneTreeENSGT00560000076887.
HOGENOMHOG000265621.
HOVERGENHBG105648.
InParanoidQ8VD16.
KOK05853.
OMAACITRCY.
TreeFamTF300651.

Gene expression databases

ArrayExpressQ64518.
BgeeQ64518.
CleanExMM_ATP2A3.
GenevestigatorQ64518.

Family and domain databases

Gene3D1.20.1110.10. 2 hits.
2.70.150.10. 2 hits.
3.40.1110.10. 1 hit.
InterProIPR005782. ATPase_P-typ_Ca-transp_IIA.
IPR006068. ATPase_P-typ_cation-transptr_C.
IPR004014. ATPase_P-typ_cation-transptr_N.
IPR023299. ATPase_P-typ_cyto_domN.
IPR018303. ATPase_P-typ_P_site.
IPR023298. ATPase_P-typ_TM_dom.
IPR008250. ATPase_P-typ_transduc_dom_A.
IPR001757. Cation_transp_P_typ_ATPase.
IPR023214. HAD-like_dom.
[Graphical view]
PfamPF00689. Cation_ATPase_C. 1 hit.
PF00690. Cation_ATPase_N. 1 hit.
PF00122. E1-E2_ATPase. 1 hit.
PF00702. Hydrolase. 1 hit.
[Graphical view]
PRINTSPR00119. CATATPASE.
SMARTSM00831. Cation_ATPase_N. 1 hit.
[Graphical view]
SUPFAMSSF56784. SSF56784. 1 hit.
SSF81660. SSF81660. 1 hit.
TIGRFAMsTIGR01116. ATPase-IIA1_Ca. 1 hit.
TIGR01494. ATPase_P-type. 3 hits.
PROSITEPS00154. ATPASE_E1_E2. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSATP2A3. mouse.
NextBio310097.
PROQ64518.
SOURCESearch...

Entry information

Entry nameAT2A3_MOUSE
AccessionPrimary (citable) accession number: Q64518
Secondary accession number(s): O70625, Q64517, Q8VD16
Entry history
Integrated into UniProtKB/Swiss-Prot: October 18, 2001
Last sequence update: July 27, 2011
Last modified: July 9, 2014
This is version 126 of the entry and version 3 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Relevant documents

SIMILARITY comments

Index of protein domains and families

MGD cross-references

Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot