Reviewed,
UniProtKB/Swiss-Prot Q64373 (B2CL1_MOUSE)
Last modified
June 16, 2009.
Version 93.
History...
Clusters with 100%,
90%,
50% identity |
Documents (3) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Bcl-2-like protein 1 Short name=Bcl2-L-1 Alternative name(s): Apoptosis regulator Bcl-X | ||||
| Gene names |
| ||||
| Organism | Mus musculus (Mouse) | ||||
| Taxonomic identifier | 10090 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus |
Protein attributes
| Sequence length | 233 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Potent inhibitor of cell death. Isoform Bcl-X(L) anti-apoptotic activity is inhibited by association with SIVA isoform 1. Inhibits activation of caspases By similarity. Appears to regulate cell death by binding and blocking the voltage-dependent anion channnel (VDAC), thus preventing the release of the caspase activator, cytochrome c, from the mitochondrial membrane. The Bcl-X(S) isoform promotes apoptosis. |
| Subunit structure | Bcl-X(L) forms heterodimers with BAX, BAK and BCL2 By similarity. Heterodimerization with BAX does not seem to be required for anti-apoptotic activity By similarity. Also interacts with BBC3 By similarity. Isoform Bcl-X(L) binds to binds to Siva isoform 1. Interacts with BECN1 and PGAM5 By similarity. Interacts with BCL2L11. |
| Subcellular location | Isoform Bcl-X(L): Mitochondrion membrane. Note: Mitochondrial membranes and perinuclear envelope for Bcl-X(L). Isoform Bcl-X(delta-TM): Cytoplasm. |
| Tissue specificity | Widely expressed, with highest levels in the brain, thymus, bone marrow, and kidney. Bcl-X(L) and Bcl-X(delta-TM) expression is enhanced in B- and T-lymphocytes that have been activated. |
| Developmental stage | Bcl-X(beta) is expressed in both embryonal and postnatal tissues, whereas Bcl-X(L) is predominantly found in postnatal tissues. |
| Domain | The BH4 motif is required for anti-apoptotic activity. The BH1 and BH2 motifs are required for both heterodimerization with other Bcl-2 family members and for repression of cell death. |
| Post-translational modification | Proteolytically cleaved by caspases during apoptosis By similarity. The cleaved protein, lacking the BH4 motif, has pro-apoptotic activity By similarity. |
| Sequence similarities | Belongs to the Bcl-2 family. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| BCL2L1 | Q07817-1 | 1 | EBI-526380,EBI-287195 | From a different organism. |
| Bcl2l11 | O54918 | 1 | EBI-526361,EBI-526067 | |
| Ppp1cc | P63087-1 | 1 | EBI-526361,EBI-450267 | |
| Siva1 | O54926 | 1 | EBI-526380,EBI-1393169 |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform Bcl-X(L) (identifier: Q64373-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Note: Mitochondrial membranes and perinuclear envelope for Bcl-X(L). | ||||||
| Isoform Bcl-X(S) (identifier: Q64373-2) The sequence of this isoform differs from the canonical sequence as follows: 126-188: Missing. | ||||||
| Isoform Bcl-X(beta) (identifier: Q64373-3) The sequence of this isoform differs from the canonical sequence as follows: 189-233: DTFVDLYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK → VRTTPLVCPPLACVSLLCEHP | ||||||
| Isoform Bcl-X(delta-TM) (identifier: Q64373-4) The sequence of this isoform differs from the canonical sequence as follows: 194-233: LYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK → GHDCGWCGSAGLTLQSEVTRH |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 233 | 233 | Bcl-2-like protein 1 | PRO_0000143063 | ||||||||||||||||||||||
Regions | ||||||||||||||||||||||||||
| Transmembrane | 210 – 226 | 17 | Potential | |||||||||||||||||||||||
| Motif | 4 – 24 | 21 | BH4 | |||||||||||||||||||||||
| Motif | 86 – 100 | 15 | BH3 | |||||||||||||||||||||||
| Motif | 129 – 148 | 20 | BH1 | |||||||||||||||||||||||
| Motif | 180 – 195 | 16 | BH2 | |||||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||||
| Alternative sequence | 126 – 188 | 63 | Missing in isoform Bcl-X(S). | VSP_000517 | ||||||||||||||||||||||
| Alternative sequence | 189 – 233 | 45 | DTFVD…LFSRK → VRTTPLVCPPLACVSLLCEH P in isoform Bcl-X(beta). | VSP_000518 | ||||||||||||||||||||||
| Alternative sequence | 194 – 233 | 40 | LYGNN…LFSRK → GHDCGWCGSAGLTLQSEVTR H in isoform Bcl-X(delta-TM). | VSP_000519 | ||||||||||||||||||||||
Experimental info | ||||||||||||||||||||||||||
| Sequence conflict | 207 – 209 | 3 | QER → KEG in AAC53459. Ref.4 | |||||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||||
| Helix | 3 – 19 | 17 | ||||||||||||||||||||||||
| Helix | 84 – 100 | 17 | ||||||||||||||||||||||||
| Helix | 106 – 112 | 7 | ||||||||||||||||||||||||
| Helix | 120 – 128 | 9 | ||||||||||||||||||||||||
| Helix | 129 – 131 | 3 | ||||||||||||||||||||||||
| Helix | 137 – 156 | 20 | ||||||||||||||||||||||||
| Helix | 162 – 177 | 16 | ||||||||||||||||||||||||
| Helix | 179 – 184 | 6 | ||||||||||||||||||||||||
| Helix | 187 – 195 | 9 | ||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| [1] | Kamesaki H., Michaud G.Y., Takatsu K., Okuma M. Submitted (MAR-1995) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE (ISOFORM BCL-X(L)). Strain: 2A4B. |
| [2] | "bcl-XL is the major bcl-x mRNA form expressed during murine development and its product localizes to mitochondria." Gonzalez-Garcia M., Perez-Ballestero R., Ding L., Duan L., Boise L.H., Thompson C.B., Nunez G. Development 120:3033-3042(1994) [PubMed: 7607090] [Abstract] Cited for: NUCLEOTIDE SEQUENCE (ISOFORMS BCL-X(L) AND BCL-X(BETA)). Strain: C57BL/6. Tissue: Brain. |
| [3] | "Cloning and molecular characterization of mouse bcl-x in B and T lymphocytes." Fang W., Rivard J.J., Mueller D.L., Behrens T.W. J. Immunol. 153:4388-4398(1994) [PubMed: 7963517] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS BCL-X(L); BCL-X(S) AND BCL-X(DELTA-TM)). Tissue: Pre-B cell. |
| [4] | "A novel Bcl-x isoform connected to the T cell receptor regulates apoptosis in T cells." Yang X.-F., Weber G.F., Cantor H. Immunity 7:629-639(1997) [PubMed: 9390687] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS BCL-X(L) AND BCL-X(BETA)). Strain: C57BL/6 X CBA. Tissue: Thymus. |
| [5] | "Genomic organization, promoter region analysis, and chromosome localization of the mouse bcl-x gene." Grillot D.A., Gonzalez-Garcia M., Ekhterae D., Duan L., Inohara N., Ohta S., Seldin M.F., Nunez G. J. Immunol. 158:4750-4757(1997) [PubMed: 9144489] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. |
| [6] | "The structure of a Bcl-xL/Bim fragment complex: implications for Bim function." Liu X., Dai S., Zhu Y., Marrack P., Kappler J.W. Immunity 19:341-352(2003) [PubMed: 14499110] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (1.65 ANGSTROMS) OF 1-196 IN COMPLEX WITH BCL2L11. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| X83574 mRNA. Translation: CAA58557.1. L35049 mRNA. Translation: AAA51039.1. L35048 mRNA. Translation: AAA51040.1. U10102 mRNA. Translation: AAA82174.1. U10101 mRNA. Translation: AAA82173.1. U10100 mRNA. Translation: AAA82172.1. U51278 mRNA. Translation: AAC53459.1. U51279 mRNA. Translation: AAC53460.1. U78031, U78030 Genomic DNA. Translation: AAB96881.1. | |||||||||||||||||||||||||
| IPI | IPI00133454. IPI00227922. IPI00227924. IPI00406354. | ||||||||||||||||||||||||
| PIR | I49055. I49056. I49057. | ||||||||||||||||||||||||
| RefSeq | NP_033873.3. | ||||||||||||||||||||||||
| UniGene | Mm.238213 | ||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||
| |||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||
| IntAct | Q64373. 9 interactions. | ||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||
| PhosphoSite | Q64373. | ||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||
| Ensembl | ENSMUSG00000007659. Mus musculus. [Contig view] | ||||||||||||||||||||||||
| GeneID | 12048. | ||||||||||||||||||||||||
| KEGG | mmu:12048. | ||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||
| MGI | MGI:88139. Bcl2l1. | ||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||
| HOVERGEN | Q64373. | ||||||||||||||||||||||||
| OMA | Q64373. RTEASEG. | ||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||
| ArrayExpress | Q64373. | ||||||||||||||||||||||||
| Bgee | Q64373. | ||||||||||||||||||||||||
| CleanEx | MM_BCL2L1. | ||||||||||||||||||||||||
| GermOnline | ENSMUSG00000007659. Mus musculus. | ||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||
| InterPro | IPR013279. Apop_reg_BclX. IPR002475. BCL2_apoptsis. IPR000712. Bcl2_BH. IPR003093. Bcl2_BH4. IPR004725. Bcl2_reg. [Graphical view] | ||||||||||||||||||||||||
| Pfam | PF00452. Bcl-2. 1 hit. PF02180. BH4. 1 hit. [Graphical view] | ||||||||||||||||||||||||
| PRINTS | PR01864. APOPREGBCLX. PR01862. BCL2FAMILY. | ||||||||||||||||||||||||
| SMART | SM00337. BCL. 1 hit. SM00265. BH4. 1 hit. [Graphical view] | ||||||||||||||||||||||||
| TIGRFAMs | TIGR00865. bcl-2. 1 hit. | ||||||||||||||||||||||||
| PROSITE | PS50062. BCL2_FAMILY. 1 hit. PS01080. BH1. 1 hit. PS01258. BH2. 1 hit. PS01259. BH3. 1 hit. PS01260. BH4_1. 1 hit. PS50063. BH4_2. 1 hit. [Graphical view] | ||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||
Other Resources | |||||||||||||||||||||||||
| NextBio | 280335. | ||||||||||||||||||||||||
| PMAP-CutDB | Q64373. | ||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||
Entry information
| Entry name | B2CL1_MOUSE | ||||||||
| Accession | Primary (citable) accession number: Q64373 Secondary accession number(s): O35844 Q61338 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with


