Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q64373

- B2CL1_MOUSE

UniProt

Q64373 - B2CL1_MOUSE

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Bcl-2-like protein 1

Gene

Bcl2l1

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Potent inhibitor of cell death. Inhibits activation of caspases. Appears to regulate cell death by blocking the voltage-dependent anion channel (VDAC) by binding to it and preventing the release of the caspase activator, CYC1, from the mitochondrial membrane. Also acts as a regulator of G2 checkpoint and progression to cytokinesis during mitosis.1 Publication
Isoform Bcl-X(L) also regulates presynaptic plasticity, including neurotransmitter release and recovery, number of axonal mitochondria as well as size and number of synaptic vesicle clusters. During synaptic stimulation, increases ATP availability from mitochondria through regulation of mitochondrial membrane ATP synthase F1F0 activity and regulates endocytic vesicle retrieval in hippocampal neurons through association with DMN1L and stimulation of its GTPase activity in synaptic vesicles (By similarity).By similarity
Isoform Bcl-X(S) promotes apoptosis.By similarity

GO - Molecular functioni

  1. protein heterodimerization activity Source: MGI
  2. protein homodimerization activity Source: RefGenome

GO - Biological processi

  1. apoptotic process in bone marrow Source: MGI
  2. cell proliferation Source: MGI
  3. cellular process regulating host cell cycle in response to virus Source: MGI
  4. cellular response to alkaloid Source: MGI
  5. cellular response to amino acid stimulus Source: MGI
  6. cellular response to gamma radiation Source: MGI
  7. cytokinesis Source: UniProtKB
  8. extrinsic apoptotic signaling pathway in absence of ligand Source: MGI
  9. fertilization Source: MGI
  10. germ cell development Source: MGI
  11. growth Source: MGI
  12. hepatocyte apoptotic process Source: MGI
  13. intrinsic apoptotic signaling pathway in response to DNA damage Source: MGI
  14. in utero embryonic development Source: MGI
  15. male gonad development Source: MGI
  16. mitochondrion morphogenesis Source: MGI
  17. mitotic cell cycle checkpoint Source: UniProtKB
  18. negative regulation of anoikis Source: Ensembl
  19. negative regulation of apoptotic process Source: MGI
  20. negative regulation of establishment of protein localization to plasma membrane Source: Ensembl
  21. negative regulation of execution phase of apoptosis Source: Ensembl
  22. negative regulation of intrinsic apoptotic signaling pathway Source: RefGenome
  23. negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage Source: Ensembl
  24. negative regulation of neuron apoptotic process Source: MGI
  25. negative regulation of release of cytochrome c from mitochondria Source: Ensembl
  26. neuron apoptotic process Source: MGI
  27. ovarian follicle development Source: MGI
  28. positive regulation of apoptotic process Source: MGI
  29. positive regulation of cell proliferation Source: MGI
  30. regulation of mitochondrial membrane permeability Source: Ensembl
  31. regulation of mitochondrial membrane potential Source: Ensembl
  32. release of cytochrome c from mitochondria Source: MGI
  33. response to cycloheximide Source: MGI
  34. response to cytokine Source: MGI
  35. response to radiation Source: MGI
  36. response to virus Source: MGI
  37. spermatogenesis Source: MGI
  38. suppression by virus of host apoptotic process Source: MGI
Complete GO annotation...

Keywords - Biological processi

Apoptosis

Enzyme and pathway databases

ReactomeiREACT_198658. The NLRP1 inflammasome.
REACT_223399. BH3-only proteins associate with and inactivate anti-apoptotic BCL-2 members.

Names & Taxonomyi

Protein namesi
Recommended name:
Bcl-2-like protein 1
Short name:
Bcl2-L-1
Alternative name(s):
Apoptosis regulator Bcl-X
Gene namesi
Name:Bcl2l1
Synonyms:Bcl2l, Bclx
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589: Chromosome 2

Organism-specific databases

MGIiMGI:88139. Bcl2l1.

Subcellular locationi

Mitochondrion membrane 1 Publication; Single-pass membrane protein 1 Publication. Nucleus membrane By similarity; Single-pass membrane protein By similarity; Cytoplasmic side By similarity. Cytoplasmcytoskeletonmicrotubule organizing centercentrosome 1 Publication
Note: Localizes to the centrosome when phosphorylated at Ser-49.
Isoform Bcl-X(L) : Mitochondrion inner membrane. Mitochondrion outer membrane. Mitochondrion matrix By similarity. Cytoplasmic vesiclesecretory vesiclesynaptic vesicle membrane By similarity. Cytoplasmcytosol By similarity
Note: After neuronal stimulation, translocates from cytosol to synaptic vesicle and mitochondrion membrane in a calmodulin-dependent manner.By similarity

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transmembranei210 – 22617HelicalSequence AnalysisAdd
BLAST

GO - Cellular componenti

  1. Bcl-2 family protein complex Source: Ensembl
  2. cell junction Source: UniProtKB-KW
  3. centrosome Source: UniProtKB
  4. cytoplasmic vesicle Source: UniProtKB-KW
  5. cytosol Source: MGI
  6. integral component of membrane Source: UniProtKB-KW
  7. intracellular Source: MGI
  8. mitochondrial inner membrane Source: UniProtKB-KW
  9. mitochondrial membrane Source: MGI
  10. mitochondrial outer membrane Source: MGI
  11. mitochondrion Source: MGI
  12. nucleolus Source: Ensembl
  13. synapse Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Cell junction, Cytoplasm, Cytoplasmic vesicle, Cytoskeleton, Membrane, Mitochondrion, Mitochondrion inner membrane, Mitochondrion outer membrane, Nucleus, Synapse

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 233233Bcl-2-like protein 1PRO_0000143063Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei49 – 491Phosphoserine; by PLK3By similarity
Modified residuei62 – 621Phosphoserine; by CDK1By similarity

Post-translational modificationi

Proteolytically cleaved by caspases during apoptosis. The cleaved protein, lacking the BH4 motif, has pro-apoptotic activity.By similarity
Phosphorylated on Ser-62 by CDK1. This phosphorylation is partial in normal mitotic cells, but complete in G2-arrested cells upon DNA-damage, thus promoting subsequent apoptosis probably by triggering caspases-mediated proteolysis. Phosphorylated by PLK3, leading to regulate the G2 checkpoint and progression to cytokinesis during mitosis. Phosphorylation at Ser-49 appears during the S phase and G2, disappears rapidly in early mitosis during prometaphase, metaphase and early anaphase, and re-appears during telophase and cytokinesis (By similarity).By similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ64373.
PaxDbiQ64373.
PRIDEiQ64373.

PTM databases

PhosphoSiteiQ64373.

Miscellaneous databases

PMAP-CutDBQ64373.

Expressioni

Tissue specificityi

Widely expressed, with highest levels in the brain, thymus, bone marrow, and kidney. Bcl-X(L) and Bcl-X(delta-TM) expression is enhanced in B- and T-lymphocytes that have been activated.1 Publication

Developmental stagei

Bcl-X(beta) is expressed in both embryonal and postnatal tissues, whereas Bcl-X(L) is predominantly found in postnatal tissues.1 Publication

Gene expression databases

BgeeiQ64373.
CleanExiMM_BCL2L1.
ExpressionAtlasiQ64373. baseline and differential.
GenevestigatoriQ64373.

Interactioni

Subunit structurei

Homodimer. Isoform Bcl-X(L) forms heterodimers with BAX, BAK or BCL2. Heterodimerization with BAX does not seem to be required for anti-apoptotic activity. Interacts with BCL2L11. Interacts with BAD. Interacts (isoform Bcl-X(L)) with SIVA1 (isoform 1); the interaction inhibits the anti-apoptotic activity. Interacts with BECN1 and PGAM5. Isoform Bcl-X(L) interacts with IKZF3. Interacts with HEBP2. Isoform Bcl-X(L) interacts with BOP. Interacts with p53/TP53 and BBC3; interaction with BBC3 disrupts the interaction with p53/TP53. Isoform Bcl-X(L) interacts with DNM1L and CLTA; DNM1L and BCL2L1 isoform BCL-X(L) may form a complex in synaptic vesicles that also contains clathrin and MFF. Interacts with ATP5A and ATP5B; the interactions mediate the association of isoform Bcl-X(L) with the mitochondrial membrane ATP synthase F1F0 ATP synthase (By similarity).By similarity

Binary interactionsi

WithEntry#Exp.IntActNotes
BadQ613372EBI-526380,EBI-400328

Protein-protein interaction databases

BioGridi198323. 6 interactions.
IntActiQ64373. 8 interactions.
MINTiMINT-87027.

Structurei

Secondary structure

233
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Helixi1 – 2020Combined sources
Helixi24 – 263Combined sources
Helixi83 – 10119Combined sources
Helixi102 – 1054Combined sources
Helixi106 – 1127Combined sources
Turni116 – 1183Combined sources
Helixi120 – 1278Combined sources
Helixi128 – 1314Combined sources
Helixi137 – 15620Combined sources
Helixi162 – 17716Combined sources
Helixi179 – 1846Combined sources
Helixi187 – 1959Combined sources

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
1PQ0X-ray2.20A1-196[»]
1PQ1X-ray1.65A1-196[»]
2BZWX-ray2.30A1-211[»]
3IHCX-ray1.85A1-196[»]
3IHDX-ray1.88A1-196[»]
3IHEX-ray3.00A1-196[»]
3IHFX-ray2.28A/B/C/D1-196[»]
3IIGX-ray2.30A1-196[»]
3IIHX-ray2.75A1-196[»]
3ILBX-ray2.38A/N1-196[»]
3ILCX-ray1.64A1-196[»]
ProteinModelPortaliQ64373.
SMRiQ64373. Positions 1-210.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ64373.

Family & Domainsi

Motif

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Motifi4 – 2421BH4Add
BLAST
Motifi86 – 10015BH3Add
BLAST
Motifi129 – 14820BH1Add
BLAST
Motifi180 – 19516BH2Add
BLAST

Domaini

The BH4 motif is required for anti-apoptotic activity. The BH1 and BH2 motifs are required for both heterodimerization with other Bcl-2 family members and for repression of cell death.

Sequence similaritiesi

Belongs to the Bcl-2 family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG300479.
GeneTreeiENSGT00530000062935.
HOGENOMiHOG000056452.
InParanoidiQ64373.
KOiK04570.
OMAiNGSPSWH.
OrthoDBiEOG70GMGD.
TreeFamiTF315834.

Family and domain databases

InterProiIPR013279. Apop_reg_BclX.
IPR002475. Bcl2-like.
IPR004725. Bcl2/BclX.
IPR020717. Bcl2_BH1_motif_CS.
IPR020726. Bcl2_BH2_motif_CS.
IPR020728. Bcl2_BH3_motif_CS.
IPR003093. Bcl2_BH4.
IPR020731. Bcl2_BH4_motif_CS.
IPR026298. Blc2_fam.
[Graphical view]
PANTHERiPTHR11256. PTHR11256. 1 hit.
PTHR11256:SF12. PTHR11256:SF12. 1 hit.
PfamiPF00452. Bcl-2. 1 hit.
PF02180. BH4. 1 hit.
[Graphical view]
PRINTSiPR01864. APOPREGBCLX.
PR01862. BCL2FAMILY.
SMARTiSM00265. BH4. 1 hit.
[Graphical view]
TIGRFAMsiTIGR00865. bcl-2. 1 hit.
PROSITEiPS50062. BCL2_FAMILY. 1 hit.
PS01080. BH1. 1 hit.
PS01258. BH2. 1 hit.
PS01259. BH3. 1 hit.
PS01260. BH4_1. 1 hit.
PS50063. BH4_2. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. Align

Isoform Bcl-X(L) (identifier: Q64373-1) [UniParc]FASTAAdd to Basket

Also known as: Bcl-xL

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSQSNRELVV DFLSYKLSQK GYSWSQFSDV EENRTEAPEE TEAERETPSA
60 70 80 90 100
INGNPSWHLA DSPAVNGATG HSSSLDAREV IPMAAVKQAL REAGDEFELR
110 120 130 140 150
YRRAFSDLTS QLHITPGTAY QSFEQVVNEL FRDGVNWGRI VAFFSFGGAL
160 170 180 190 200
CVESVDKEMQ VLVSRIASWM ATYLNDHLEP WIQENGGWDT FVDLYGNNAA
210 220 230
AESRKGQERF NRWFLTGMTV AGVVLLGSLF SRK
Length:233
Mass (Da):26,132
Last modified:November 1, 1996 - v1
Checksum:i24D2AC79887E072E
GO
Isoform Bcl-X(S) (identifier: Q64373-2) [UniParc]FASTAAdd to Basket

Also known as: Bcl-xS

The sequence of this isoform differs from the canonical sequence as follows:
     126-188: Missing.

Show »
Length:170
Mass (Da):18,961
Checksum:i2C12D8EC7F735D52
GO
Isoform Bcl-X(beta) (identifier: Q64373-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     189-233: DTFVDLYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK → VRTTPLVCPPLACVSLLCEHP

Show »
Length:209
Mass (Da):23,357
Checksum:iDC53895D8014B5DD
GO
Isoform Bcl-X(delta-TM) (identifier: Q64373-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     194-233: LYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK → GHDCGWCGSAGLTLQSEVTRH

Show »
Length:214
Mass (Da):23,900
Checksum:i4FAECDC42B064B4A
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti207 – 2093QER → KEG in AAC53459. (PubMed:9390687)Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei126 – 18863Missing in isoform Bcl-X(S). CuratedVSP_000517Add
BLAST
Alternative sequencei189 – 23345DTFVD…LFSRK → VRTTPLVCPPLACVSLLCEH P in isoform Bcl-X(beta). CuratedVSP_000518Add
BLAST
Alternative sequencei194 – 23340LYGNN…LFSRK → GHDCGWCGSAGLTLQSEVTR H in isoform Bcl-X(delta-TM). CuratedVSP_000519Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X83574 mRNA. Translation: CAA58557.1.
L35049 mRNA. Translation: AAA51039.1.
L35048 mRNA. Translation: AAA51040.1.
U10102 mRNA. Translation: AAA82174.1.
U10101 mRNA. Translation: AAA82173.1.
U10100 mRNA. Translation: AAA82172.1.
U51278 mRNA. Translation: AAC53459.1.
U51279 mRNA. Translation: AAC53460.1.
U78031, U78030 Genomic DNA. Translation: AAB96881.1.
CCDSiCCDS16899.1. [Q64373-1]
PIRiI49055.
I49056.
I49057.
RefSeqiNP_001276645.1. NM_001289716.1. [Q64373-1]
NP_001276646.1. NM_001289717.1. [Q64373-1]
NP_033873.3. NM_009743.5. [Q64373-1]
XP_006498672.1. XM_006498609.1. [Q64373-1]
XP_006498674.1. XM_006498611.1. [Q64373-1]
XP_006498675.1. XM_006498612.1. [Q64373-1]
UniGeneiMm.238213.

Genome annotation databases

EnsembliENSMUST00000007803; ENSMUSP00000007803; ENSMUSG00000007659. [Q64373-1]
ENSMUST00000109820; ENSMUSP00000105445; ENSMUSG00000007659. [Q64373-1]
ENSMUST00000134902; ENSMUSP00000134614; ENSMUSG00000007659. [Q64373-3]
ENSMUST00000140436; ENSMUSP00000134596; ENSMUSG00000007659. [Q64373-3]
GeneIDi12048.
KEGGimmu:12048.
UCSCiuc008ngi.1. mouse. [Q64373-2]
uc008ngj.1. mouse. [Q64373-1]
uc008ngn.1. mouse. [Q64373-3]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X83574 mRNA. Translation: CAA58557.1 .
L35049 mRNA. Translation: AAA51039.1 .
L35048 mRNA. Translation: AAA51040.1 .
U10102 mRNA. Translation: AAA82174.1 .
U10101 mRNA. Translation: AAA82173.1 .
U10100 mRNA. Translation: AAA82172.1 .
U51278 mRNA. Translation: AAC53459.1 .
U51279 mRNA. Translation: AAC53460.1 .
U78031 , U78030 Genomic DNA. Translation: AAB96881.1 .
CCDSi CCDS16899.1. [Q64373-1 ]
PIRi I49055.
I49056.
I49057.
RefSeqi NP_001276645.1. NM_001289716.1. [Q64373-1 ]
NP_001276646.1. NM_001289717.1. [Q64373-1 ]
NP_033873.3. NM_009743.5. [Q64373-1 ]
XP_006498672.1. XM_006498609.1. [Q64373-1 ]
XP_006498674.1. XM_006498611.1. [Q64373-1 ]
XP_006498675.1. XM_006498612.1. [Q64373-1 ]
UniGenei Mm.238213.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
1PQ0 X-ray 2.20 A 1-196 [» ]
1PQ1 X-ray 1.65 A 1-196 [» ]
2BZW X-ray 2.30 A 1-211 [» ]
3IHC X-ray 1.85 A 1-196 [» ]
3IHD X-ray 1.88 A 1-196 [» ]
3IHE X-ray 3.00 A 1-196 [» ]
3IHF X-ray 2.28 A/B/C/D 1-196 [» ]
3IIG X-ray 2.30 A 1-196 [» ]
3IIH X-ray 2.75 A 1-196 [» ]
3ILB X-ray 2.38 A/N 1-196 [» ]
3ILC X-ray 1.64 A 1-196 [» ]
ProteinModelPortali Q64373.
SMRi Q64373. Positions 1-210.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 198323. 6 interactions.
IntActi Q64373. 8 interactions.
MINTi MINT-87027.

PTM databases

PhosphoSitei Q64373.

Proteomic databases

MaxQBi Q64373.
PaxDbi Q64373.
PRIDEi Q64373.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENSMUST00000007803 ; ENSMUSP00000007803 ; ENSMUSG00000007659 . [Q64373-1 ]
ENSMUST00000109820 ; ENSMUSP00000105445 ; ENSMUSG00000007659 . [Q64373-1 ]
ENSMUST00000134902 ; ENSMUSP00000134614 ; ENSMUSG00000007659 . [Q64373-3 ]
ENSMUST00000140436 ; ENSMUSP00000134596 ; ENSMUSG00000007659 . [Q64373-3 ]
GeneIDi 12048.
KEGGi mmu:12048.
UCSCi uc008ngi.1. mouse. [Q64373-2 ]
uc008ngj.1. mouse. [Q64373-1 ]
uc008ngn.1. mouse. [Q64373-3 ]

Organism-specific databases

CTDi 598.
MGIi MGI:88139. Bcl2l1.

Phylogenomic databases

eggNOGi NOG300479.
GeneTreei ENSGT00530000062935.
HOGENOMi HOG000056452.
InParanoidi Q64373.
KOi K04570.
OMAi NGSPSWH.
OrthoDBi EOG70GMGD.
TreeFami TF315834.

Enzyme and pathway databases

Reactomei REACT_198658. The NLRP1 inflammasome.
REACT_223399. BH3-only proteins associate with and inactivate anti-apoptotic BCL-2 members.

Miscellaneous databases

EvolutionaryTracei Q64373.
NextBioi 280335.
PMAP-CutDB Q64373.
PROi Q64373.
SOURCEi Search...

Gene expression databases

Bgeei Q64373.
CleanExi MM_BCL2L1.
ExpressionAtlasi Q64373. baseline and differential.
Genevestigatori Q64373.

Family and domain databases

InterProi IPR013279. Apop_reg_BclX.
IPR002475. Bcl2-like.
IPR004725. Bcl2/BclX.
IPR020717. Bcl2_BH1_motif_CS.
IPR020726. Bcl2_BH2_motif_CS.
IPR020728. Bcl2_BH3_motif_CS.
IPR003093. Bcl2_BH4.
IPR020731. Bcl2_BH4_motif_CS.
IPR026298. Blc2_fam.
[Graphical view ]
PANTHERi PTHR11256. PTHR11256. 1 hit.
PTHR11256:SF12. PTHR11256:SF12. 1 hit.
Pfami PF00452. Bcl-2. 1 hit.
PF02180. BH4. 1 hit.
[Graphical view ]
PRINTSi PR01864. APOPREGBCLX.
PR01862. BCL2FAMILY.
SMARTi SM00265. BH4. 1 hit.
[Graphical view ]
TIGRFAMsi TIGR00865. bcl-2. 1 hit.
PROSITEi PS50062. BCL2_FAMILY. 1 hit.
PS01080. BH1. 1 hit.
PS01258. BH2. 1 hit.
PS01259. BH3. 1 hit.
PS01260. BH4_1. 1 hit.
PS50063. BH4_2. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

  1. "IL-5 inhibits anti-IgM-induced apoptosis in an immature B cell line through inductin of bcl-Xl."
    Kamesaki H., Michaud G.Y., Takatsu K., Okuma M.
    Submitted (MAR-1995) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM BCL-X(L)).
    Strain: 2A4B.
  2. "bcl-XL is the major bcl-x mRNA form expressed during murine development and its product localizes to mitochondria."
    Gonzalez-Garcia M., Perez-Ballestero R., Ding L., Duan L., Boise L.H., Thompson C.B., Nunez G.
    Development 120:3033-3042(1994) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS BCL-X(L) AND BCL-X(BETA)), DEVELOPMENTAL STAGE, SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
    Strain: C57BL/6.
    Tissue: Brain.
  3. "Cloning and molecular characterization of mouse bcl-x in B and T lymphocytes."
    Fang W., Rivard J.J., Mueller D.L., Behrens T.W.
    J. Immunol. 153:4388-4398(1994) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS BCL-X(L); BCL-X(S) AND BCL-X(DELTA-TM)).
    Tissue: Pre-B cell.
  4. "A novel Bcl-x isoform connected to the T cell receptor regulates apoptosis in T cells."
    Yang X.-F., Weber G.F., Cantor H.
    Immunity 7:629-639(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS BCL-X(L) AND BCL-X(BETA)), FUNCTION.
    Strain: C57BL/6 X CBA.
    Tissue: Thymus.
  5. "Genomic organization, promoter region analysis, and chromosome localization of the mouse bcl-x gene."
    Grillot D.A., Gonzalez-Garcia M., Ekhterae D., Duan L., Inohara N., Ohta S., Seldin M.F., Nunez G.
    J. Immunol. 158:4750-4757(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
  6. "The structure of a Bcl-xL/Bim fragment complex: implications for Bim function."
    Liu X., Dai S., Zhu Y., Marrack P., Kappler J.W.
    Immunity 19:341-352(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: X-RAY CRYSTALLOGRAPHY (1.65 ANGSTROMS) OF 1-196 IN COMPLEX WITH BCL2L11.

Entry informationi

Entry nameiB2CL1_MOUSE
AccessioniPrimary (citable) accession number: Q64373
Secondary accession number(s): O35844
, Q60657, Q60658, Q61338
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: November 1, 1996
Last modified: November 26, 2014
This is version 148 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3