Q64373 (B2CL1_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 119.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Bcl-2-like protein 1 Short name=Bcl2-L-1 Alternative name(s): Apoptosis regulator Bcl-X | ||||
| Gene names |
| ||||
| Organism | Mus musculus (Mouse) | ||||
| Taxonomic identifier | 10090 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus |
Protein attributes
| Sequence length | 233 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Potent inhibitor of cell death. Inhibits activation of caspases By similarity. Appears to regulate cell death by blocking the voltage-dependent anion channnel (VDAC) by binding to it and preventing the release of the caspase activator, CYC1, from the mitochondrial membrane. Also acts as a regulator of G2 checkpoint and progression to cytokinesis during mitosis. Ref.4 Isoform Bcl-X(S) promotes apoptosis By similarity. Ref.4 |
| Subunit structure | Homodimer By similarity. Isoform Bcl-X(L) forms heterodimers with BAX, BAK or BCL2. Heterodimerization with BAX does not seem to be required for anti-apoptotic activity. Interacts with DMN1L; the interaction stimulates the GTPase activity of DMN1L in synapses and increases the number of axonal mitochondria and the size and number of synaptic vesicle clusters. Interacts with BAD and BBC3. Interacts (isoform Bcl-X(L)) with SIVA1 (isoform 1); the interaction inhibits the anti-apoptotic activity. Interacts with BECN1 and PGAM5. Interacts (isoform Bcl-X(L)) with BAX (isoform Sigma) By similarity. Interacts with BCL2L11. Isoform Bcl-X(L) interacts with IKZF3. Interacts with HEBP2 By similarity. |
| Subcellular location | Isoform Bcl-X(L): Mitochondrion membrane. Cytoplasm › cytoskeleton › centrosome By similarity. Note: Mitochondrial membranes and perinuclear envelope. Ref.2 Isoform Bcl-X(delta-TM): Cytoplasm Ref.2. |
| Tissue specificity | Widely expressed, with highest levels in the brain, thymus, bone marrow, and kidney. Bcl-X(L) and Bcl-X(delta-TM) expression is enhanced in B- and T-lymphocytes that have been activated. Ref.2 |
| Developmental stage | Bcl-X(beta) is expressed in both embryonal and postnatal tissues, whereas Bcl-X(L) is predominantly found in postnatal tissues. Ref.2 |
| Domain | The BH4 motif is required for anti-apoptotic activity. The BH1 and BH2 motifs are required for both heterodimerization with other Bcl-2 family members and for repression of cell death. |
| Post-translational modification | Proteolytically cleaved by caspases during apoptosis By similarity. The cleaved protein, lacking the BH4 motif, has pro-apoptotic activity By similarity. Phosphorylated on Ser-62 by CDK1. This phosphorylation is partial in normal mitotic cells, but complete in G2-arrested cells upon DNA-damage, thus promoting subsequent apoptosis probably by triggering caspases-mediated proteolysis. Phosphorylated by PLK3, leading to regulate the G2 checkpoint and progression to cytokinesis during mitosis. Phosphorylation at Ser-49 appears during the S phase and G2, disappears rapidly in early mitosis during prometaphase, metaphase and early anaphase, and re-appears during telophase and cytokinesis By similarity. |
| Sequence similarities | Belongs to the Bcl-2 family. |
Ontologies
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform Bcl-X(L) (identifier: Q64373-1) Also known as: Bcl-xL; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform Bcl-X(S) (identifier: Q64373-2) Also known as: Bcl-xS; The sequence of this isoform differs from the canonical sequence as follows: 126-188: Missing. | ||||||
| Isoform Bcl-X(beta) (identifier: Q64373-3) The sequence of this isoform differs from the canonical sequence as follows: 189-233: DTFVDLYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK → VRTTPLVCPPLACVSLLCEHP | ||||||
| Isoform Bcl-X(delta-TM) (identifier: Q64373-4) The sequence of this isoform differs from the canonical sequence as follows: 194-233: LYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK → GHDCGWCGSAGLTLQSEVTRH |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 233 | 233 | Bcl-2-like protein 1 | PRO_0000143063 | ||||||||||||||||||||||
Regions | ||||||||||||||||||||||||||
| Transmembrane | 210 – 226 | 17 | Helical; Potential | |||||||||||||||||||||||
| Motif | 4 – 24 | 21 | BH4 | |||||||||||||||||||||||
| Motif | 86 – 100 | 15 | BH3 | |||||||||||||||||||||||
| Motif | 129 – 148 | 20 | BH1 | |||||||||||||||||||||||
| Motif | 180 – 195 | 16 | BH2 | |||||||||||||||||||||||
Amino acid modifications | ||||||||||||||||||||||||||
| Modified residue | 49 | 1 | Phosphoserine; by PLK3 By similarity | |||||||||||||||||||||||
| Modified residue | 62 | 1 | Phosphoserine; by CDK1 By similarity | |||||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||||
| Alternative sequence | 126 – 188 | 63 | Missing in isoform Bcl-X(S). | VSP_000517 | ||||||||||||||||||||||
| Alternative sequence | 189 – 233 | 45 | DTFVD…LFSRK → VRTTPLVCPPLACVSLLCEH P in isoform Bcl-X(beta). | VSP_000518 | ||||||||||||||||||||||
| Alternative sequence | 194 – 233 | 40 | LYGNN…LFSRK → GHDCGWCGSAGLTLQSEVTR H in isoform Bcl-X(delta-TM). | VSP_000519 | ||||||||||||||||||||||
Experimental info | ||||||||||||||||||||||||||
| Sequence conflict | 207 – 209 | 3 | QER → KEG in AAC53459. Ref.4 | |||||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||||
| Helix | 3 – 19 | 17 | ||||||||||||||||||||||||
| Helix | 84 – 100 | 17 | ||||||||||||||||||||||||
| Helix | 106 – 112 | 7 | ||||||||||||||||||||||||
| Helix | 120 – 128 | 9 | ||||||||||||||||||||||||
| Helix | 129 – 131 | 3 | ||||||||||||||||||||||||
| Helix | 137 – 156 | 20 | ||||||||||||||||||||||||
| Helix | 162 – 177 | 16 | ||||||||||||||||||||||||
| Helix | 179 – 184 | 6 | ||||||||||||||||||||||||
| Helix | 187 – 195 | 9 | ||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| [1] | "IL-5 inhibits anti-IgM-induced apoptosis in an immature B cell line through inductin of bcl-Xl." Kamesaki H., Michaud G.Y., Takatsu K., Okuma M. Submitted (MAR-1995) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM BCL-X(L)). Strain: 2A4B. |
| [2] | "bcl-XL is the major bcl-x mRNA form expressed during murine development and its product localizes to mitochondria." Gonzalez-Garcia M., Perez-Ballestero R., Ding L., Duan L., Boise L.H., Thompson C.B., Nunez G. Development 120:3033-3042(1994) [PubMed: 7607090] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS BCL-X(L) AND BCL-X(BETA)), DEVELOPMENTAL STAGE, SUBCELLULAR LOCATION, TISSUE SPECIFICITY. Strain: C57BL/6. Tissue: Brain. |
| [3] | "Cloning and molecular characterization of mouse bcl-x in B and T lymphocytes." Fang W., Rivard J.J., Mueller D.L., Behrens T.W. J. Immunol. 153:4388-4398(1994) [PubMed: 7963517] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS BCL-X(L); BCL-X(S) AND BCL-X(DELTA-TM)). Tissue: Pre-B cell. |
| [4] | "A novel Bcl-x isoform connected to the T cell receptor regulates apoptosis in T cells." Yang X.-F., Weber G.F., Cantor H. Immunity 7:629-639(1997) [PubMed: 9390687] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS BCL-X(L) AND BCL-X(BETA)), FUNCTION. Strain: C57BL/6 X CBA. Tissue: Thymus. |
| [5] | "Genomic organization, promoter region analysis, and chromosome localization of the mouse bcl-x gene." Grillot D.A., Gonzalez-Garcia M., Ekhterae D., Duan L., Inohara N., Ohta S., Seldin M.F., Nunez G. J. Immunol. 158:4750-4757(1997) [PubMed: 9144489] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. |
| [6] | "The structure of a Bcl-xL/Bim fragment complex: implications for Bim function." Liu X., Dai S., Zhu Y., Marrack P., Kappler J.W. Immunity 19:341-352(2003) [PubMed: 14499110] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (1.65 ANGSTROMS) OF 1-196 IN COMPLEX WITH BCL2L11. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | X83574 mRNA. Translation: CAA58557.1. L35049 mRNA. Translation: AAA51039.1. L35048 mRNA. Translation: AAA51040.1. U10102 mRNA. Translation: AAA82174.1. U10101 mRNA. Translation: AAA82173.1. U10100 mRNA. Translation: AAA82172.1. U51278 mRNA. Translation: AAC53459.1. U51279 mRNA. Translation: AAC53460.1. U78031, U78030 Genomic DNA. Translation: AAB96881.1. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| IPI | IPI00133454. IPI00227922. IPI00227924. IPI00406354. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PIR | I49055. I49056. I49057. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| RefSeq | NP_033873.3. NM_009743.4. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| UniGene | Mm.238213. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ProteinModelPortal | Q64373. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SMR | Q64373. Positions 1-210. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| IntAct | Q64373. 6 interactions. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| MINT | MINT-87027. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| STRING | Q64373. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PhosphoSite | Q64373. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PRIDE | Q64373. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Ensembl | ENSMUST00000007803; ENSMUSP00000007803; ENSMUSG00000007659. ENSMUST00000109820; ENSMUSP00000105445; ENSMUSG00000007659. ENSMUST00000134902; ENSMUSP00000134614; ENSMUSG00000007659. ENSMUST00000140436; ENSMUSP00000134596; ENSMUSG00000007659. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GeneID | 12048. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| KEGG | mmu:12048. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| UCSC | uc008ngi.1. mouse. uc008ngn.1. mouse. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| CTD | 598. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| MGI | MGI:88139. Bcl2l1. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| OMA | NGSPSWH. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| OrthoDB | EOG47PX6Z. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ArrayExpress | Q64373. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Bgee | Q64373. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| CleanEx | MM_BCL2L1. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Genevestigator | Q64373. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GermOnline | ENSMUSG00000007659. Mus musculus. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| InterPro | IPR013279. Apop_reg_BclX. IPR002475. Bcl2-like_apoptosis. IPR000712. Bcl2_BH. IPR020717. Bcl2_BH1_motif_CS. IPR020726. Bcl2_BH2_motif_CS. IPR020728. Bcl2_BH3_motif_CS. IPR003093. Bcl2_BH4. IPR020731. Bcl2_BH4_motif_CS. IPR004725. Bcl2_reg. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| KO | K04570. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Pfam | PF00452. Bcl-2. 1 hit. PF02180. BH4. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PRINTS | PR01864. APOPREGBCLX. PR01862. BCL2FAMILY. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SMART | SM00337. BCL. 1 hit. SM00265. BH4. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| TIGRFAMs | TIGR00865. Bcl-2. 1 hit. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PROSITE | PS50062. BCL2_FAMILY. 1 hit. PS01080. BH1. 1 hit. PS01258. BH2. 1 hit. PS01259. BH3. 1 hit. PS01260. BH4_1. 1 hit. PS50063. BH4_2. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Other | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| NextBio | 280335. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PMAP-CutDB | Q64373. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entry information
| Entry name | B2CL1_MOUSE | ||||||||
| Accession | Primary (citable) accession number: Q64373 Secondary accession number(s): O35844 Q61338 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with