Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

InaD-like protein

Gene

Inadl

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Scaffolding protein that may bring different proteins into adjacent positions at the cell membrane. May regulate protein targeting, cell polarity and integrity of tight junctions. May regulate the surface expression and/or function of ASIC3 in sensory neurons. May recruit ARHGEF18 to apical cell-cell boundaries (By similarity).By similarity1 Publication

Enzyme and pathway databases

ReactomeiR-MMU-420029. Tight junction interactions.

Names & Taxonomyi

Protein namesi
Recommended name:
InaD-like protein
Short name:
Inadl protein
Alternative name(s):
Channel-interacting PDZ domain-containing protein
Pals1-associated tight junction protein
Protein associated to tight junctions
Gene namesi
Name:Inadl
Synonyms:Cipp, PatjBy similarity
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 4

Organism-specific databases

MGIiMGI:1277960. Inadl.

Subcellular locationi

Isoform 3 :

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cell junction, Cell membrane, Cytoplasm, Membrane, Tight junction

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 18341834InaD-like proteinPRO_0000094593Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei455 – 4551PhosphoserineCombined sources
Modified residuei459 – 4591PhosphoserineBy similarity
Modified residuei482 – 4821PhosphoserineCombined sources
Modified residuei524 – 5241PhosphoserineCombined sources
Modified residuei647 – 6471PhosphoserineCombined sources
Modified residuei1215 – 12151PhosphoserineCombined sources
Modified residuei1543 – 15431PhosphothreonineBy similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ63ZW7.
PaxDbiQ63ZW7.
PeptideAtlasiQ63ZW7.
PRIDEiQ63ZW7.

PTM databases

iPTMnetiQ63ZW7.
PhosphoSiteiQ63ZW7.

Expressioni

Tissue specificityi

Expressed exclusively in brain and kidney. Isoform 3 might be brain-specific. In brain, high levels are detected in the cerebellum, inferior colliculus, vestibular nucleus, facial nucleus and thalamus. Also detected in deep cerebellar nuclei, superior colliculus, dorsal transition zone, brain stem, as well as the glomerular and mitral cell layers of the olfactory bulb. Within the cerebellum it is expressed in both Purkinje and granule cell layers.1 Publication

Gene expression databases

BgeeiENSMUSG00000061859.
CleanExiMM_INADL.
ExpressionAtlasiQ63ZW7. baseline and differential.
GenevisibleiQ63ZW7. MM.

Interactioni

Subunit structurei

Forms a ternary complex with MPP5 and CRB1. Interacts with TJP3/ZO-3 and CLDN1/claudin-1. Component of a complex whose core is composed of ARHGAP17, AMOT, MPP5/PALS1, INADL/PATJ and PARD3/PAR3 (By similarity). Interacts with ASIC3, KCNJ10, KCNJ15, GRIN2A, GRIN2B, GRIN2C, GRIN2D, NLGN2, MPP7 and HTR2A. Isoform 2 interacts with NRXN2. Directly interacts with HTR4. Interacts (via PDZ domain 8) with WWC1 (via the ADDV motif) (By similarity). Interacts with SLC6A4. Interacts (via C-terminus) with ARHGEF18 (By similarity).By similarity5 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
Asic3O352402EBI-8158524,EBI-982374From a different organism.
Grin2aP354364EBI-8366894,EBI-400115
Grin2bQ009604EBI-8366894,EBI-396905From a different organism.
Grin2cQ009612EBI-8366894,EBI-631045From a different organism.
Grin2dQ626453EBI-8366894,EBI-631067From a different organism.
KCNJ15Q997124EBI-8366894,EBI-7082607From a different organism.

Protein-protein interaction databases

BioGridi198715. 13 interactions.
DIPiDIP-41238N.
IntActiQ63ZW7. 14 interactions.
MINTiMINT-1777910.
STRINGi10090.ENSMUSP00000049176.

Structurei

Secondary structure

1
1834
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Helixi11 – 2616Combined sources
Helixi32 – 4312Combined sources
Helixi45 – 5612Combined sources

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
3UITX-ray2.05A/B/C/D1-68[»]
ProteinModelPortaliQ63ZW7.
SMRiQ63ZW7. Positions 8-68, 116-335, 362-452, 677-772, 1060-1173, 1220-1338, 1457-1563, 1565-1649, 1715-1798.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini1 – 6565L27PROSITE-ProRule annotationAdd
BLAST
Domaini134 – 22188PDZ 1PROSITE-ProRule annotationAdd
BLAST
Domaini248 – 32881PDZ 2PROSITE-ProRule annotationAdd
BLAST
Domaini365 – 45389PDZ 3PROSITE-ProRule annotationAdd
BLAST
Domaini555 – 64187PDZ 4PROSITE-ProRule annotationAdd
BLAST
Domaini688 – 77487PDZ 5PROSITE-ProRule annotationAdd
BLAST
Domaini1074 – 116693PDZ 6PROSITE-ProRule annotationAdd
BLAST
Domaini1245 – 132884PDZ 7PROSITE-ProRule annotationAdd
BLAST
Domaini1472 – 155584PDZ 8PROSITE-ProRule annotationAdd
BLAST
Domaini1568 – 165083PDZ 9PROSITE-ProRule annotationAdd
BLAST
Domaini1709 – 179587PDZ 10PROSITE-ProRule annotationAdd
BLAST

Domaini

The L27 domain (also called Maguk recruitment domain) is required for interaction with MPP5 and CRB3, and MPP5 localization to tight junctions.By similarity
The PDZ domain 6 mediates interaction with the C-terminus of TJP3 and is crucial for localization to the tight junctions. The PDZ domain 8 interacts with CLDN1 but is not required for proper localization (By similarity). The PDZ domain 2 of isoform 3 mediates interactions with KCNJ10, KCNJ15, GRIN2B and NLGN2. The PDZ domain 3 of isoform 3 mediates interactions with KCNJ15, GRIN2A, GRIN2B, GRIN2C, GRIN2D and NRXN2. The PDZ domain 4 of isoform 3 mediates interaction with ASIC3.By similarity2 Publications

Sequence similaritiesi

Contains 1 L27 domain.PROSITE-ProRule annotation
Contains 10 PDZ (DHR) domains.PROSITE-ProRule annotation

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiKOG0708. Eukaryota.
KOG3528. Eukaryota.
ENOG410Y9M6. LUCA.
GeneTreeiENSGT00760000119017.
HOVERGENiHBG080134.
InParanoidiQ63ZW7.
KOiK06092.
OMAiEAWEMHE.
OrthoDBiEOG091G0P7K.
PhylomeDBiQ63ZW7.
TreeFamiTF330709.

Family and domain databases

Gene3Di2.30.42.10. 10 hits.
InterProiIPR015132. L27_2.
IPR004172. L27_dom.
IPR001478. PDZ.
[Graphical view]
PfamiPF09045. L27_2. 1 hit.
PF00595. PDZ. 9 hits.
[Graphical view]
SMARTiSM00569. L27. 1 hit.
SM00228. PDZ. 10 hits.
[Graphical view]
SUPFAMiSSF101288. SSF101288. 1 hit.
SSF50156. SSF50156. 10 hits.
PROSITEiPS51022. L27. 1 hit.
PS50106. PDZ. 10 hits.
[Graphical view]

Sequences (6)i

Sequence statusi: Complete.

This entry describes 6 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q63ZW7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MPENPAAEKM QVLQVLDRLR GKLQEKGDTT QNEKLSAFYE TLKSPLFNQI
60 70 80 90 100
LTLQQSIKQL KGQLSHIPSD CSANFDFSRK GLLVFTDGSI TNGNAQRPCS
110 120 130 140 150
NVTASELLPW TQKSASEDFN SVIQQMAQGR HVEYIDIERP STGGLGFSVV
160 170 180 190 200
ALRSQSLGLI DIFVKEVHPG SVADRDHRLK ENDQILAIND TPLDQNISHQ
210 220 230 240 250
QAIALLQQAT GSLRLVVARE VGHTQGRAST SSADTTLPET VCWGHTEEVE
260 270 280 290 300
LINDGSGLGF GIVGGKSSGV VVRTIVPGGL ADRDGRLQTG DHILKIGGTN
310 320 330 340 350
VQGMTSEQVA QVLRNCGNSV RMLVARDPVG EIAVTPPTPV SLPVALPAVA
360 370 380 390 400
TRTLDSDRSP FETYSVELVK KDGQSLGIRI VGYVGTAHPG EASGIYVKSI
410 420 430 440 450
IPGSAAYHNG QIQVNDKIVA VDGVNIQGFA NQDVVEVLRN AGQVVHLTLV
460 470 480 490 500
RRKTSLSASP FEHSSSRETV AEPPKVPERA GSPKPEANLS VEAEEIGERL
510 520 530 540 550
DNLKNNTVQA LEKPDVYPEK VPGSPENELK SRWENLLGPD YEVMVATLDA
560 570 580 590 600
QIADDEELQK YSKLLPIHTL RLGMEVDSFD GHHYISSVAP GGPVDTLNLL
610 620 630 640 650
QPEDELLEVN GMQLYGKSRR EAVSFLKEVP PPFTLVCCRR LFDDEASVDE
660 670 680 690 700
PRTMEPALLE AEVDHSVDVN IEDDDDGELA LWSPEVKTVE LVKDCKGLGF
710 720 730 740 750
SILDYQDPLD PTRSVIVIRS LVADGVAERS GELLPGDRLV SVNEFSLDNA
760 770 780 790 800
TLAEAVEVLK AVPPGVVHLG ICKPLVEDEK EERFSLHSNN NGDSSEPADA
810 820 830 840 850
VHEIHSSLIL EAPQGFRDEP YLEELVDEPF LDLGKSLQFQ QKDVDSSSEA
860 870 880 890 900
WEMHEFLSPP LDGRGEEREM LVDEEYELYQ DHLRAMESNP PPPHIREAAP
910 920 930 940 950
ASPVLELQAG TQWLHANLSG GERLECHDAE SMMSAYPQEM QQYSYSTADM
960 970 980 990 1000
MEETFGLDSR APIPSSEGNG QHGRFDDMGH LHSLTSSSLD LGMMIPSDLQ
1010 1020 1030 1040 1050
GPGVLVDLPA VAQRREQEDL PLYRLPSARV VTKPSSHMGL VSSRHANAAC
1060 1070 1080 1090 1100
ELPEREEGEG EETPNFSHWG PPRIVEIFRE PNVSLGISIV GGQTVIKRLK
1110 1120 1130 1140 1150
NGEELKGIFI KQVLEDSPAG KTNALKTGDK ILEVSGVDLQ NASHAEAVEA
1160 1170 1180 1190 1200
IKSAGNPVVF VVQSLSSTPR VIPTVNNKGK TPAPNQDQNT QERKAKRHGT
1210 1220 1230 1240 1250
APPPMKLPPP YRAPSADMEG SEEDCALTDK KIRQRYADLP GELHIIELEK
1260 1270 1280 1290 1300
DKNGLGLSLA GNKDRSRMSI FVVGINPEGP AAADGRMRIG DELLEINNQI
1310 1320 1330 1340 1350
LYGRSHQNAS AIIKTAPTRV KLVFIRNEDA VSQMAVAPFP ELSHSPSPVE
1360 1370 1380 1390 1400
DLGGTELVSS EEESSVDAKH LPEPESSKPE DLSQVVDDNM VAEQQKESES
1410 1420 1430 1440 1450
PDSAACQIKQ QTYSTQVSSS SQDSPSSPAP LCQSAHADVT GSGNFQAPLP
1460 1470 1480 1490 1500
VDPAPLSVDP ATCPIVPGQE MIIEISKGRS GLGLSIVGGK DTPLDAIVIH
1510 1520 1530 1540 1550
EVYEEGAAAR DGRLWAGDQI LEVNGVDLRS SSHEEAITAL RQTPQKVRLV
1560 1570 1580 1590 1600
VYRDEAQYRD EENLEVFLVD LQKKTGRGLG LSIVGKRSGS GVFISDIVKG
1610 1620 1630 1640 1650
GAADLDGRLI RGDQILSVNG EDMRHASQET VATILKCVQG LVQLEIGRLR
1660 1670 1680 1690 1700
AGSWAASRKT SQNSQGDQHS AHSSCRPSFA PVITSLQNLV GTKRSSDPPQ
1710 1720 1730 1740 1750
KCTEEEPRTV EIIRELSDAL GISIAGGKGS PLGDIPIFIA MIQANGVAAR
1760 1770 1780 1790 1800
TQKLKVGDRI VSINGQPLDG LSHTDAVNLL KNAFGRIILQ VVADTNISAI
1810 1820 1830
ATQLEIMSAG SQLGSPTADR HPEDTEEQMQ RTAD
Length:1,834
Mass (Da):198,517
Last modified:June 21, 2005 - v2
Checksum:i177ADF8E12B82A30
GO
Isoform 2 (identifier: Q63ZW7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-573: Missing.

Show »
Length:1,261
Mass (Da):136,621
Checksum:i4A787DBB7088CC37
GO
Isoform 3 (identifier: Q63ZW7-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1222: Missing.
     1223-1230: EDCALTDK → MVHGGFPE

Show »
Length:612
Mass (Da):65,420
Checksum:i145DE1769F54BE56
GO
Isoform 4 (identifier: Q63ZW7-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1222: Missing.
     1223-1230: EDCALTDK → MVHGGFPE
     1792-1804: VADTNISAIATQL → FRSMENQLAEADK
     1805-1834: Missing.

Note: No experimental confirmation available.
Show »
Length:582
Mass (Da):62,372
Checksum:i9F3C4D154F62B7A6
GO
Isoform 5 (identifier: Q63ZW7-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     564-598: LLPIHTLRLGMEVDSFDGHHYISSVAPGGPVDTLN → WMLVLKAKAVPPSALHVVGSRAHIRRYKMALTAVF
     599-1834: Missing.

Note: No experimental confirmation available.
Show »
Length:598
Mass (Da):64,700
Checksum:i3853286E3870BF7B
GO
Isoform 6 (identifier: Q63ZW7-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     951-975: MEETFGLDSRAPIPSSEGNGQHGRF → VRLCDTATTCSPLCPHTPRSCYFHS
     976-1834: Missing.

Note: No experimental confirmation available.
Show »
Length:975
Mass (Da):106,626
Checksum:i9A1BE05E01FB2459
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti740 – 7401V → L in BAC36720 (PubMed:16141072).Curated
Sequence conflicti986 – 9861S → R in BAC36720 (PubMed:16141072).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 12221222Missing in isoform 3 and isoform 4. 2 PublicationsVSP_014210Add
BLAST
Alternative sequencei1 – 573573Missing in isoform 2. 1 PublicationVSP_014211Add
BLAST
Alternative sequencei564 – 59835LLPIH…VDTLN → WMLVLKAKAVPPSALHVVGS RAHIRRYKMALTAVF in isoform 5. 1 PublicationVSP_014212Add
BLAST
Alternative sequencei599 – 18341236Missing in isoform 5. 1 PublicationVSP_014213Add
BLAST
Alternative sequencei951 – 97525MEETF…QHGRF → VRLCDTATTCSPLCPHTPRS CYFHS in isoform 6. 1 PublicationVSP_014214Add
BLAST
Alternative sequencei976 – 1834859Missing in isoform 6. 1 PublicationVSP_014215Add
BLAST
Alternative sequencei1223 – 12308EDCALTDK → MVHGGFPE in isoform 3 and isoform 4. 2 PublicationsVSP_014216
Alternative sequencei1792 – 180413VADTN…IATQL → FRSMENQLAEADK in isoform 4. 1 PublicationVSP_014217Add
BLAST
Alternative sequencei1805 – 183430Missing in isoform 4. 1 PublicationVSP_014218Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF060539 mRNA. Translation: AAC40148.1.
AK077268 mRNA. Translation: BAC36720.1.
AL671229 Genomic DNA. Translation: CAM27361.1.
BC037607 mRNA. Translation: AAH37607.1.
BC050846 mRNA. Translation: AAH50846.1.
BC057124 mRNA. Translation: AAH57124.1.
BC062194 mRNA. Translation: AAH62194.1.
BC082787 mRNA. Translation: AAH82787.1.
CCDSiCCDS18375.1. [Q63ZW7-1]
CCDS18376.1. [Q63ZW7-3]
CCDS18377.1. [Q63ZW7-4]
RefSeqiNP_001005784.1. NM_001005784.1. [Q63ZW7-6]
NP_001005787.1. NM_001005787.1. [Q63ZW7-4]
NP_031730.1. NM_007704.2. [Q63ZW7-3]
NP_766284.2. NM_172696.2. [Q63ZW7-1]
XP_006502762.1. XM_006502699.1. [Q63ZW7-1]
XP_006502763.1. XM_006502700.1. [Q63ZW7-1]
XP_006502764.1. XM_006502701.1. [Q63ZW7-1]
UniGeneiMm.90218.

Genome annotation databases

EnsembliENSMUST00000030290; ENSMUSP00000030290; ENSMUSG00000061859. [Q63ZW7-4]
ENSMUST00000041284; ENSMUSP00000049176; ENSMUSG00000061859. [Q63ZW7-1]
ENSMUST00000102792; ENSMUSP00000099854; ENSMUSG00000061859. [Q63ZW7-3]
ENSMUST00000107029; ENSMUSP00000102644; ENSMUSG00000061859. [Q63ZW7-2]
ENSMUST00000107030; ENSMUSP00000102645; ENSMUSG00000061859. [Q63ZW7-5]
GeneIDi12695.
KEGGimmu:12695.
UCSCiuc008tub.1. mouse. [Q63ZW7-6]
uc008tuc.1. mouse. [Q63ZW7-1]
uc008tug.1. mouse. [Q63ZW7-4]
uc008tuh.1. mouse. [Q63ZW7-3]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF060539 mRNA. Translation: AAC40148.1.
AK077268 mRNA. Translation: BAC36720.1.
AL671229 Genomic DNA. Translation: CAM27361.1.
BC037607 mRNA. Translation: AAH37607.1.
BC050846 mRNA. Translation: AAH50846.1.
BC057124 mRNA. Translation: AAH57124.1.
BC062194 mRNA. Translation: AAH62194.1.
BC082787 mRNA. Translation: AAH82787.1.
CCDSiCCDS18375.1. [Q63ZW7-1]
CCDS18376.1. [Q63ZW7-3]
CCDS18377.1. [Q63ZW7-4]
RefSeqiNP_001005784.1. NM_001005784.1. [Q63ZW7-6]
NP_001005787.1. NM_001005787.1. [Q63ZW7-4]
NP_031730.1. NM_007704.2. [Q63ZW7-3]
NP_766284.2. NM_172696.2. [Q63ZW7-1]
XP_006502762.1. XM_006502699.1. [Q63ZW7-1]
XP_006502763.1. XM_006502700.1. [Q63ZW7-1]
XP_006502764.1. XM_006502701.1. [Q63ZW7-1]
UniGeneiMm.90218.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
3UITX-ray2.05A/B/C/D1-68[»]
ProteinModelPortaliQ63ZW7.
SMRiQ63ZW7. Positions 8-68, 116-335, 362-452, 677-772, 1060-1173, 1220-1338, 1457-1563, 1565-1649, 1715-1798.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi198715. 13 interactions.
DIPiDIP-41238N.
IntActiQ63ZW7. 14 interactions.
MINTiMINT-1777910.
STRINGi10090.ENSMUSP00000049176.

PTM databases

iPTMnetiQ63ZW7.
PhosphoSiteiQ63ZW7.

Proteomic databases

MaxQBiQ63ZW7.
PaxDbiQ63ZW7.
PeptideAtlasiQ63ZW7.
PRIDEiQ63ZW7.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000030290; ENSMUSP00000030290; ENSMUSG00000061859. [Q63ZW7-4]
ENSMUST00000041284; ENSMUSP00000049176; ENSMUSG00000061859. [Q63ZW7-1]
ENSMUST00000102792; ENSMUSP00000099854; ENSMUSG00000061859. [Q63ZW7-3]
ENSMUST00000107029; ENSMUSP00000102644; ENSMUSG00000061859. [Q63ZW7-2]
ENSMUST00000107030; ENSMUSP00000102645; ENSMUSG00000061859. [Q63ZW7-5]
GeneIDi12695.
KEGGimmu:12695.
UCSCiuc008tub.1. mouse. [Q63ZW7-6]
uc008tuc.1. mouse. [Q63ZW7-1]
uc008tug.1. mouse. [Q63ZW7-4]
uc008tuh.1. mouse. [Q63ZW7-3]

Organism-specific databases

CTDi12695.
MGIiMGI:1277960. Inadl.

Phylogenomic databases

eggNOGiKOG0708. Eukaryota.
KOG3528. Eukaryota.
ENOG410Y9M6. LUCA.
GeneTreeiENSGT00760000119017.
HOVERGENiHBG080134.
InParanoidiQ63ZW7.
KOiK06092.
OMAiEAWEMHE.
OrthoDBiEOG091G0P7K.
PhylomeDBiQ63ZW7.
TreeFamiTF330709.

Enzyme and pathway databases

ReactomeiR-MMU-420029. Tight junction interactions.

Miscellaneous databases

PROiQ63ZW7.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000061859.
CleanExiMM_INADL.
ExpressionAtlasiQ63ZW7. baseline and differential.
GenevisibleiQ63ZW7. MM.

Family and domain databases

Gene3Di2.30.42.10. 10 hits.
InterProiIPR015132. L27_2.
IPR004172. L27_dom.
IPR001478. PDZ.
[Graphical view]
PfamiPF09045. L27_2. 1 hit.
PF00595. PDZ. 9 hits.
[Graphical view]
SMARTiSM00569. L27. 1 hit.
SM00228. PDZ. 10 hits.
[Graphical view]
SUPFAMiSSF101288. SSF101288. 1 hit.
SSF50156. SSF50156. 10 hits.
PROSITEiPS51022. L27. 1 hit.
PS50106. PDZ. 10 hits.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiINADL_MOUSE
AccessioniPrimary (citable) accession number: Q63ZW7
Secondary accession number(s): A2ADS7
, O70471, Q5PRG3, Q6P6J1, Q80YR8, Q8BPB9
Entry historyi
Integrated into UniProtKB/Swiss-Prot: June 21, 2005
Last sequence update: June 21, 2005
Last modified: September 7, 2016
This is version 120 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.