Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q63HR2

- TENC1_HUMAN

UniProt

Q63HR2 - TENC1_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Tensin-like C1 domain-containing phosphatase

Gene

TENC1

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Regulates cell motility and proliferation. May have phosphatase activity. Reduces AKT1 phosphorylation. Lowers AKT1 kinase activity and interferes with AKT1 signaling.1 Publication

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Active sitei231 – 2311Phosphocysteine intermediateCurated

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri31 – 7949Phorbol-ester/DAG-typePROSITE-ProRule annotationAdd
BLAST

GO - Molecular functioni

  1. metal ion binding Source: UniProtKB-KW
  2. phosphoprotein phosphatase activity Source: UniProtKB-KW

GO - Biological processi

  1. cellular homeostasis Source: Ensembl
  2. collagen metabolic process Source: Ensembl
  3. intracellular signal transduction Source: InterPro
  4. kidney development Source: Ensembl
  5. multicellular organismal homeostasis Source: Ensembl
  6. multicellular organism growth Source: Ensembl
  7. negative regulation of cell proliferation Source: UniProtKB
  8. response to muscle activity Source: Ensembl
Complete GO annotation...

Keywords - Molecular functioni

Hydrolase, Protein phosphatase

Keywords - Ligandi

Metal-binding, Zinc

Enzyme and pathway databases

SignaLinkiQ63HR2.

Names & Taxonomyi

Protein namesi
Recommended name:
Tensin-like C1 domain-containing phosphatase (EC:3.1.3.-)
Alternative name(s):
C1 domain-containing phosphatase and tensin homolog
Short name:
C1-TEN
Tensin-2
Gene namesi
Name:TENC1
Synonyms:KIAA1075, TNS2
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 12

Organism-specific databases

HGNCiHGNC:19737. TENC1.

Subcellular locationi

Cell junctionfocal adhesion 1 Publication. Cell membrane 1 Publication; Peripheral membrane protein 1 Publication; Cytoplasmic side 1 Publication
Note: Detected at the end of actin stress fibers.

GO - Cellular componenti

  1. focal adhesion Source: UniProtKB
  2. plasma membrane Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Cell junction, Cell membrane, Membrane

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi231 – 2311C → S: Abolishes inhibition of AKT1 kinase activity. 1 Publication

Organism-specific databases

PharmGKBiPA134976096.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 14091409Tensin-like C1 domain-containing phosphatasePRO_0000292987Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei483 – 4831PhosphotyrosineBy similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ63HR2.
PaxDbiQ63HR2.
PRIDEiQ63HR2.

PTM databases

PhosphoSiteiQ63HR2.

Expressioni

Tissue specificityi

Detected in heart, kidney, brain, thymus, spleen, liver, placenta, lung, skeletal muscle and small intestine.2 Publications

Gene expression databases

BgeeiQ63HR2.
ExpressionAtlasiQ63HR2. baseline and differential.
GenevestigatoriQ63HR2.

Organism-specific databases

HPAiHPA034659.

Interactioni

Subunit structurei

Interacts with AXL.1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
ERBB2P046264EBI-949753,EBI-641062
ERBB3P218603EBI-949753,EBI-720706
KITP107212EBI-949753,EBI-1379503
METP085812EBI-949753,EBI-1039152

Protein-protein interaction databases

BioGridi116951. 11 interactions.
IntActiQ63HR2. 10 interactions.
MINTiMINT-2870924.

Structurei

Secondary structure

1
1409
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Helixi1137 – 11404Combined sources
Beta strandi1141 – 11444Combined sources
Helixi1147 – 11548Combined sources
Beta strandi1161 – 11666Combined sources
Beta strandi1168 – 11703Combined sources
Beta strandi1173 – 11797Combined sources
Beta strandi1184 – 11896Combined sources
Beta strandi1190 – 11923Combined sources
Helixi1194 – 11985Combined sources
Beta strandi1199 – 12057Combined sources
Beta strandi1210 – 12134Combined sources
Beta strandi1222 – 12243Combined sources
Helixi1225 – 12306Combined sources
Turni1231 – 12344Combined sources
Beta strandi1237 – 12415Combined sources
Helixi1266 – 12727Combined sources
Beta strandi1274 – 128512Combined sources
Helixi1291 – 130414Combined sources
Beta strandi1305 – 13073Combined sources
Beta strandi1312 – 13198Combined sources
Beta strandi1322 – 13298Combined sources
Beta strandi1332 – 13398Combined sources
Helixi1340 – 13423Combined sources
Beta strandi1343 – 13486Combined sources
Beta strandi1350 – 13523Combined sources
Beta strandi1354 – 13563Combined sources
Turni1358 – 13603Combined sources
Beta strandi1362 – 137211Combined sources
Beta strandi1375 – 138511Combined sources
Beta strandi1389 – 13913Combined sources
Helixi1393 – 140513Combined sources

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
2DKQNMR-A1263-1409[»]
2KNONMR-A1135-1249[»]
2L6KNMR-A1135-1248[»]
2LOZNMR-A1263-1409[»]
3HQCX-ray1.80A1264-1409[»]
ProteinModelPortaliQ63HR2.
SMRiQ63HR2. Positions 126-467, 1135-1249, 1263-1409.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ63HR2.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini122 – 294173Phosphatase tensin-typePROSITE-ProRule annotationAdd
BLAST
Domaini299 – 425127C2 tensin-typePROSITE-ProRule annotationAdd
BLAST
Domaini1140 – 1247108SH2PROSITE-ProRule annotationAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi489 – 53345Pro-richAdd
BLAST
Compositional biasi724 – 1122399Pro-richAdd
BLAST

Sequence similaritiesi

Contains 1 C2 tensin-type domain.PROSITE-ProRule annotation
Contains 1 phorbol-ester/DAG-type zinc finger.PROSITE-ProRule annotation
Contains 1 phosphatase tensin-type domain.PROSITE-ProRule annotation
Contains 1 SH2 domain.PROSITE-ProRule annotation

Zinc finger

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri31 – 7949Phorbol-ester/DAG-typePROSITE-ProRule annotationAdd
BLAST

Keywords - Domaini

SH2 domain, Zinc-finger

Phylogenomic databases

eggNOGiCOG2453.
GeneTreeiENSGT00760000119113.
HOVERGENiHBG108559.
InParanoidiQ63HR2.
KOiK18080.
OMAiRQGYREP.
OrthoDBiEOG7ZPNJ6.
PhylomeDBiQ63HR2.
TreeFamiTF315996.

Family and domain databases

Gene3Di2.30.29.30. 1 hit.
3.30.505.10. 1 hit.
3.90.190.10. 1 hit.
InterProiIPR000008. C2_dom.
IPR002219. PE/DAG-bd.
IPR011993. PH_like_dom.
IPR029021. Prot-tyrosine_phosphatase-like.
IPR013625. PTB.
IPR006020. PTB/PI_dom.
IPR000980. SH2.
IPR014020. Tensin_C2-dom.
IPR029023. Tensin_lipid_phosphatase_dom.
[Graphical view]
PfamiPF08416. PTB. 1 hit.
PF10409. PTEN_C2. 1 hit.
PF00017. SH2. 1 hit.
[Graphical view]
SMARTiSM00109. C1. 1 hit.
SM00462. PTB. 1 hit.
SM00252. SH2. 1 hit.
[Graphical view]
SUPFAMiSSF49562. SSF49562. 1 hit.
SSF52799. SSF52799. 1 hit.
SSF55550. SSF55550. 1 hit.
PROSITEiPS51182. C2_TENSIN. 1 hit.
PS51181. PPASE_TENSIN. 1 hit.
PS50001. SH2. 1 hit.
PS00479. ZF_DAG_PE_1. 1 hit.
PS50081. ZF_DAG_PE_2. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q63HR2-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MKSSGPVERL LRALGRRDSS RAASRPRKAE PHSFREKVFR KKPPVCAVCK
60 70 80 90 100
VTIDGTGVSC RVCKVATHRK CEAKVTSACQ ALPPVELRRN TAPVRRIEHL
110 120 130 140 150
GSTKSLNHSK QRSTLPRSFS LDPLMERRWD LDLTYVTERI LAAAFPARPD
160 170 180 190 200
EQRHRGHLRE LAHVLQSKHR DKYLLFNLSE KRHDLTRLNP KVQDFGWPEL
210 220 230 240 250
HAPPLDKLCS ICKAMETWLS ADPQHVVVLY CKGNKGKLGV IVSAYMHYSK
260 270 280 290 300
ISAGADQALA TLTMRKFCED KVATELQPSQ RRYISYFSGL LSGSIRMNSS
310 320 330 340 350
PLFLHYVLIP MLPAFEPGTG FQPFLKIYQS MQLVYTSGVY HIAGPGPQQL
360 370 380 390 400
CISLEPALLL KGDVMVTCYH KGGRGTDRTL VFRVQFHTCT IHGPQLTFPK
410 420 430 440 450
DQLDEAWTDE RFPFQASVEF VFSSSPEKIK GSTPRNDPSV SVDYNTTEPA
460 470 480 490 500
VRWDSYENFN QHHEDSVDGS LTHTRGPLDG SPYAQVQRPP RQTPPAPSPE
510 520 530 540 550
PPPPPMLSVS SDSGHSSTLT TEPAAESPGR PPPTAAERQE LDRLLGGCGV
560 570 580 590 600
ASGGRGAGRE TAILDDEEQP TVGGGPHLGV YPGHRPGLSR HCSCRQGYRE
610 620 630 640 650
PCGVPNGGYY RPEGTLERRR LAYGGYEGSP QGYAEASMEK RRLCRSLSEG
660 670 680 690 700
LYPYPPEMGK PATGDFGYRA PGYREVVILE DPGLPALYPC PACEEKLALP
710 720 730 740 750
TAALYGLRLE REAGEGWASE AGKPLLHPVR PGHPLPLLLP ACGHHHAPMP
760 770 780 790 800
DYSCLKPPKA GEEGHEGCSY TMCPEGRYGH PGYPALVTYS YGGAVPSYCP
810 820 830 840 850
AYGRVPHSCG SPGEGRGYPS PGAHSPRAGS ISPGSPPYPQ SRKLSYEIPT
860 870 880 890 900
EEGGDRYPLP GHLASAGPLA SAESLEPVSW REGPSGHSTL PRSPRDAPCS
910 920 930 940 950
ASSELSGPST PLHTSSPVQG KESTRRQDTR SPTSAPTQRL SPGEALPPVS
960 970 980 990 1000
QAGTGKAPEL PSGSGPEPLA PSPVSPTFPP SSPSDWPQER SPGGHSDGAS
1010 1020 1030 1040 1050
PRSPVPTTLP GLRHAPWQGP RGPPDSPDGS PLTPVPSQMP WLVASPEPPQ
1060 1070 1080 1090 1100
SSPTPAFPLA ASYDTNGLSQ PPLPEKRHLP GPGQQPGPWG PEQASSPARG
1110 1120 1130 1140 1150
ISHHVTFAPL LSDNVPQTPE PPTQESQSNV KFVQDTSKFW YKPHLSRDQA
1160 1170 1180 1190 1200
IALLKDKDPG AFLIRDSHSF QGAYGLALKV ATPPPSAQPW KGDPVEQLVR
1210 1220 1230 1240 1250
HFLIETGPKG VKIKGCPSEP YFGSLSALVS QHSISPISLP CCLRIPSKDP
1260 1270 1280 1290 1300
LEETPEAPVP TNMSTAADLL RQGAACSVLY LTSVETESLT GPQAVARASS
1310 1320 1330 1340 1350
AALSCSPRPT PAVVHFKVSA QGITLTDNQR KLFFRRHYPV NSITFSSTDP
1360 1370 1380 1390 1400
QDRRWTNPDG TTSKIFGFVA KKPGSPWENV CHLFAELDPD QPAGAIVTFI

TKVLLGQRK
Length:1,409
Mass (Da):152,580
Last modified:June 26, 2007 - v2
Checksum:i67824299A1382140
GO
Isoform 2 (identifier: Q63HR2-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     776-872: Missing.

Show »
Length:1,312
Mass (Da):142,685
Checksum:iBD63FB8C01E97D9A
GO
Isoform 4 (identifier: Q63HR2-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-25: MKSSGPVERLLRALGRRDSSRAASR → MDGGGVCVGRGDLLSSPQALGQLLRKESRPRRAMK

Show »
Length:1,419
Mass (Da):153,564
Checksum:i7F26C74F3E88A801
GO
Isoform 5 (identifier: Q63HR2-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-124: Missing.

Show »
Length:1,285
Mass (Da):138,828
Checksum:iF52B6ED198BEE396
GO
Isoform 6 (identifier: Q63HR2-6) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1273-1274: Missing.

Show »
Length:1,407
Mass (Da):152,452
Checksum:iC19BCA8F1535E663
GO

Sequence cautioni

The sequence AAI29829.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence AAI29830.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence AAI31504.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence BAA83027.2 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence CAH56176.1 differs from that shown. Reason: Intron retention.Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti702 – 7021A → V in AAH54099. (PubMed:15489334)Curated
Sequence conflicti898 – 8981P → Q in AAH54099. (PubMed:15489334)Curated
Sequence conflicti1036 – 10361P → L in CAB70815. (PubMed:17974005)Curated
Sequence conflicti1083 – 10831G → E in AAI29830. (PubMed:15489334)Curated
Sequence conflicti1119 – 11191P → S in AAH54099. (PubMed:15489334)Curated
Sequence conflicti1148 – 11481D → G in AAH54099. (PubMed:15489334)Curated
Sequence conflicti1236 – 12361P → L in CAH56176. (PubMed:17974005)Curated
Sequence conflicti1246 – 12461P → L in AAM74225. (PubMed:12470648)Curated
Sequence conflicti1246 – 12461P → L in AAN03866. (PubMed:12470648)Curated
Sequence conflicti1246 – 12461P → L in AAL14641. (PubMed:11792844)Curated
Sequence conflicti1246 – 12461P → L in BAA83027. (PubMed:10470851)Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti353 – 3531S → T.
Corresponds to variant rs11170389 [ dbSNP | Ensembl ].
VAR_033043
Natural varianti670 – 6701A → T.
Corresponds to variant rs11558984 [ dbSNP | Ensembl ].
VAR_052547

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 124124Missing in isoform 5. 2 PublicationsVSP_026457Add
BLAST
Alternative sequencei1 – 2525MKSSG…RAASR → MDGGGVCVGRGDLLSSPQAL GQLLRKESRPRRAMK in isoform 4. 1 PublicationVSP_026458Add
BLAST
Alternative sequencei776 – 87297Missing in isoform 2. 1 PublicationVSP_026460Add
BLAST
Alternative sequencei1273 – 12742Missing in isoform 6. 1 PublicationVSP_026461

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF518729 mRNA. Translation: AAM74225.1.
AF518728 mRNA. Translation: AAN03866.1.
AF417490 mRNA. Translation: AAL14641.1.
AB028998 mRNA. Translation: BAA83027.2. Different initiation.
AL137564 mRNA. Translation: CAB70815.1.
BX647126 mRNA. Translation: CAH56176.1. Sequence problems.
BC054099 mRNA. Translation: AAH54099.1.
BC110854 mRNA. Translation: AAI10855.1.
BC129828 mRNA. Translation: AAI29829.1. Different initiation.
BC129829 mRNA. Translation: AAI29830.1. Different initiation.
BC131503 mRNA. Translation: AAI31504.1. Different initiation.
BC142668 mRNA. Translation: AAI42669.1.
BC142712 mRNA. Translation: AAI42713.1.
CCDSiCCDS8842.1. [Q63HR2-4]
CCDS8843.1. [Q63HR2-1]
CCDS8844.1. [Q63HR2-5]
PIRiT46500.
RefSeqiNP_056134.2. NM_015319.2. [Q63HR2-4]
NP_736610.2. NM_170754.2. [Q63HR2-1]
NP_938072.1. NM_198316.1. [Q63HR2-5]
UniGeneiHs.343334.
Hs.6147.

Genome annotation databases

EnsembliENST00000314250; ENSP00000319684; ENSG00000111077. [Q63HR2-1]
ENST00000314276; ENSP00000319756; ENSG00000111077. [Q63HR2-4]
ENST00000379902; ENSP00000369232; ENSG00000111077. [Q63HR2-5]
ENST00000546602; ENSP00000449363; ENSG00000111077. [Q63HR2-2]
ENST00000552570; ENSP00000447021; ENSG00000111077. [Q63HR2-6]
GeneIDi23371.
KEGGihsa:23371.
UCSCiuc001sbl.3. human. [Q63HR2-1]
uc001sbn.3. human. [Q63HR2-4]
uc001sbq.3. human. [Q63HR2-2]
uc009zmr.3. human. [Q63HR2-6]

Polymorphism databases

DMDMi150416153.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF518729 mRNA. Translation: AAM74225.1 .
AF518728 mRNA. Translation: AAN03866.1 .
AF417490 mRNA. Translation: AAL14641.1 .
AB028998 mRNA. Translation: BAA83027.2 . Different initiation.
AL137564 mRNA. Translation: CAB70815.1 .
BX647126 mRNA. Translation: CAH56176.1 . Sequence problems.
BC054099 mRNA. Translation: AAH54099.1 .
BC110854 mRNA. Translation: AAI10855.1 .
BC129828 mRNA. Translation: AAI29829.1 . Different initiation.
BC129829 mRNA. Translation: AAI29830.1 . Different initiation.
BC131503 mRNA. Translation: AAI31504.1 . Different initiation.
BC142668 mRNA. Translation: AAI42669.1 .
BC142712 mRNA. Translation: AAI42713.1 .
CCDSi CCDS8842.1. [Q63HR2-4 ]
CCDS8843.1. [Q63HR2-1 ]
CCDS8844.1. [Q63HR2-5 ]
PIRi T46500.
RefSeqi NP_056134.2. NM_015319.2. [Q63HR2-4 ]
NP_736610.2. NM_170754.2. [Q63HR2-1 ]
NP_938072.1. NM_198316.1. [Q63HR2-5 ]
UniGenei Hs.343334.
Hs.6147.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
2DKQ NMR - A 1263-1409 [» ]
2KNO NMR - A 1135-1249 [» ]
2L6K NMR - A 1135-1248 [» ]
2LOZ NMR - A 1263-1409 [» ]
3HQC X-ray 1.80 A 1264-1409 [» ]
ProteinModelPortali Q63HR2.
SMRi Q63HR2. Positions 126-467, 1135-1249, 1263-1409.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 116951. 11 interactions.
IntActi Q63HR2. 10 interactions.
MINTi MINT-2870924.

PTM databases

PhosphoSitei Q63HR2.

Polymorphism databases

DMDMi 150416153.

Proteomic databases

MaxQBi Q63HR2.
PaxDbi Q63HR2.
PRIDEi Q63HR2.

Protocols and materials databases

DNASUi 23371.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000314250 ; ENSP00000319684 ; ENSG00000111077 . [Q63HR2-1 ]
ENST00000314276 ; ENSP00000319756 ; ENSG00000111077 . [Q63HR2-4 ]
ENST00000379902 ; ENSP00000369232 ; ENSG00000111077 . [Q63HR2-5 ]
ENST00000546602 ; ENSP00000449363 ; ENSG00000111077 . [Q63HR2-2 ]
ENST00000552570 ; ENSP00000447021 ; ENSG00000111077 . [Q63HR2-6 ]
GeneIDi 23371.
KEGGi hsa:23371.
UCSCi uc001sbl.3. human. [Q63HR2-1 ]
uc001sbn.3. human. [Q63HR2-4 ]
uc001sbq.3. human. [Q63HR2-2 ]
uc009zmr.3. human. [Q63HR2-6 ]

Organism-specific databases

CTDi 23371.
GeneCardsi GC12P053440.
HGNCi HGNC:19737. TENC1.
HPAi HPA034659.
MIMi 607717. gene.
neXtProti NX_Q63HR2.
PharmGKBi PA134976096.
HUGEi Search...
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG2453.
GeneTreei ENSGT00760000119113.
HOVERGENi HBG108559.
InParanoidi Q63HR2.
KOi K18080.
OMAi RQGYREP.
OrthoDBi EOG7ZPNJ6.
PhylomeDBi Q63HR2.
TreeFami TF315996.

Enzyme and pathway databases

SignaLinki Q63HR2.

Miscellaneous databases

ChiTaRSi TENC1. human.
EvolutionaryTracei Q63HR2.
GeneWikii TENC1.
GenomeRNAii 23371.
NextBioi 45448.
PROi Q63HR2.
SOURCEi Search...

Gene expression databases

Bgeei Q63HR2.
ExpressionAtlasi Q63HR2. baseline and differential.
Genevestigatori Q63HR2.

Family and domain databases

Gene3Di 2.30.29.30. 1 hit.
3.30.505.10. 1 hit.
3.90.190.10. 1 hit.
InterProi IPR000008. C2_dom.
IPR002219. PE/DAG-bd.
IPR011993. PH_like_dom.
IPR029021. Prot-tyrosine_phosphatase-like.
IPR013625. PTB.
IPR006020. PTB/PI_dom.
IPR000980. SH2.
IPR014020. Tensin_C2-dom.
IPR029023. Tensin_lipid_phosphatase_dom.
[Graphical view ]
Pfami PF08416. PTB. 1 hit.
PF10409. PTEN_C2. 1 hit.
PF00017. SH2. 1 hit.
[Graphical view ]
SMARTi SM00109. C1. 1 hit.
SM00462. PTB. 1 hit.
SM00252. SH2. 1 hit.
[Graphical view ]
SUPFAMi SSF49562. SSF49562. 1 hit.
SSF52799. SSF52799. 1 hit.
SSF55550. SSF55550. 1 hit.
PROSITEi PS51182. C2_TENSIN. 1 hit.
PS51181. PPASE_TENSIN. 1 hit.
PS50001. SH2. 1 hit.
PS00479. ZF_DAG_PE_1. 1 hit.
PS50081. ZF_DAG_PE_2. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Interaction of Axl receptor tyrosine kinase with C1-TEN, a novel C1 domain-containing protein with homology to tensin."
    Hafizi S., Alindri F., Karlsson R., Dahlbaeck B.
    Biochem. Biophys. Res. Commun. 299:793-800(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 4), INTERACTION WITH AXL, TISSUE SPECIFICITY.
    Tissue: Kidney.
  2. "Tensin1 and a previously undocumented family member, tensin2, positively regulate cell migration."
    Chen H., Duncan I.C., Bozorgchami H., Lo S.H.
    Proc. Natl. Acad. Sci. U.S.A. 99:733-738(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 5), SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
  3. "Prediction of the coding sequences of unidentified human genes. XIV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
    Kikuno R., Nagase T., Ishikawa K., Hirosawa M., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O.
    DNA Res. 6:197-205(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Brain.
  4. "Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones."
    Nakajima D., Okazaki N., Yamakawa H., Kikuno R., Ohara O., Nagase T.
    DNA Res. 9:99-106(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: SEQUENCE REVISION.
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 759-1409 (ISOFORM 6).
    Tissue: Colon endothelium and Testis.
  6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 5), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 364-1398 (ISOFORM 2).
    Tissue: Brain and Uterus.
  7. "C1-TEN is a negative regulator of the Akt/PKB signal transduction pathway and inhibits cell survival, proliferation, and migration."
    Hafizi S., Ibraimi F., Dahlbaeck B.
    FASEB J. 19:971-973(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, MUTAGENESIS OF CYS-231.
  8. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  9. "Solution structure of the PTB domain of KIAA1075 protein from human."
    RIKEN structural genomics initiative (RSGI)
    Submitted (OCT-2006) to the PDB data bank
    Cited for: STRUCTURE BY NMR OF 1263-1409.

Entry informationi

Entry nameiTENC1_HUMAN
AccessioniPrimary (citable) accession number: Q63HR2
Secondary accession number(s): A2VDF2
, A2VDF3, A2VDI8, A5PKY4, Q2NL80, Q76MW6, Q7Z5T9, Q8NFF9, Q8NFG0, Q96P25, Q9NT29, Q9UPS7
Entry historyi
Integrated into UniProtKB/Swiss-Prot: June 26, 2007
Last sequence update: June 26, 2007
Last modified: November 26, 2014
This is version 96 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3