Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Tensin-2

Gene

TNS2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Regulates cell motility and proliferation. May have phosphatase activity. Reduces AKT1 phosphorylation. Lowers AKT1 kinase activity and interferes with AKT1 signaling.1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Active sitei231Phosphocysteine intermediateCurated1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri31 – 79Phorbol-ester/DAG-typePROSITE-ProRule annotationAdd BLAST49

GO - Molecular functioni

  • kinase binding Source: UniProtKB
  • metal ion binding Source: UniProtKB-KW
  • phosphoprotein phosphatase activity Source: UniProtKB-KW

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Hydrolase, Protein phosphatase

Keywords - Ligandi

Metal-binding, Zinc

Enzyme and pathway databases

SignaLinkiQ63HR2.

Names & Taxonomyi

Protein namesi
Recommended name:
Tensin-2 (EC:3.1.3.-)
Alternative name(s):
C1 domain-containing phosphatase and tensin homolog
Short name:
C1-TEN
Tensin-like C1 domain-containing phosphatase
Gene namesi
Name:TNS2
Synonyms:KIAA1075, TENC1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 12

Organism-specific databases

HGNCiHGNC:19737. TNS2.

Subcellular locationi

GO - Cellular componenti

  • focal adhesion Source: UniProtKB
  • intracellular Source: GOC
  • plasma membrane Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Cell junction, Cell membrane, Membrane

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi231C → S: Abolishes inhibition of AKT1 kinase activity. 1 Publication1

Organism-specific databases

DisGeNETi23371.
OpenTargetsiENSG00000111077.
PharmGKBiPA134976096.

Polymorphism and mutation databases

BioMutaiTENC1.
DMDMi150416153.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002929871 – 1409Tensin-2Add BLAST1409

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei91PhosphothreonineCombined sources1
Modified residuei118PhosphoserineBy similarity1
Modified residuei120PhosphoserineCombined sources1
Modified residuei455PhosphoserineCombined sources1
Modified residuei456PhosphotyrosineCombined sources1
Modified residuei466PhosphoserineCombined sources1
Modified residuei474PhosphothreonineCombined sources1
Modified residuei481PhosphoserineBy similarity1
Modified residuei483PhosphotyrosineBy similarity1
Modified residuei555Omega-N-methylarginineBy similarity1
Modified residuei820PhosphoserineCombined sources1
Modified residuei825PhosphoserineCombined sources1
Modified residuei830PhosphoserineCombined sources1
Modified residuei832PhosphoserineCombined sources1
Modified residuei835PhosphoserineCombined sources1
Modified residuei845PhosphoserineCombined sources1
Modified residuei910PhosphothreonineBy similarity1
Modified residuei931PhosphoserineCombined sources1
Modified residuei941PhosphoserineCombined sources1
Modified residuei972PhosphoserineCombined sources1
Modified residuei977PhosphothreonineCombined sources1
Modified residuei991PhosphoserineCombined sources1
Modified residuei1003PhosphoserineCombined sources1
Modified residuei1182PhosphothreonineCombined sources1
Modified residuei1247PhosphoserineCombined sources1

Keywords - PTMi

Methylation, Phosphoprotein

Proteomic databases

EPDiQ63HR2.
MaxQBiQ63HR2.
PaxDbiQ63HR2.
PeptideAtlasiQ63HR2.
PRIDEiQ63HR2.

PTM databases

DEPODiQ63HR2.
iPTMnetiQ63HR2.
PhosphoSitePlusiQ63HR2.

Expressioni

Tissue specificityi

Detected in heart, kidney, brain, thymus, spleen, liver, placenta, lung, skeletal muscle and small intestine.2 Publications

Gene expression databases

BgeeiENSG00000111077.
ExpressionAtlasiQ63HR2. baseline and differential.
GenevisibleiQ63HR2. HS.

Organism-specific databases

HPAiHPA034659.

Interactioni

Subunit structurei

Interacts with AXL. Interacts with SYK; leading to its phosphorylation (PubMed:22019427).2 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
Q9NWL93EBI-949753,EBI-10315054
C11orf87Q6NUJ23EBI-949753,EBI-6660291
ERBB2P046264EBI-949753,EBI-641062
ERBB3P218603EBI-949753,EBI-720706
KITP107212EBI-949753,EBI-1379503
KPRPQ5T7496EBI-949753,EBI-10981970
KRTAP10-5P603703EBI-949753,EBI-10172150
KRTAP10-7P604093EBI-949753,EBI-10172290
KRTAP10-8P604103EBI-949753,EBI-10171774
KRTAP12-2P599915EBI-949753,EBI-10176379
METP085812EBI-949753,EBI-1039152
NUBP2Q9Y5Y23EBI-949753,EBI-1048886
OTX1P322426EBI-949753,EBI-740446
PKP1Q138353EBI-949753,EBI-2513407
REEP6Q96HR95EBI-949753,EBI-750345
RELQ048643EBI-949753,EBI-307352
RYDENQ9NUL54EBI-949753,EBI-10313866
TEKT5Q96M295EBI-949753,EBI-10239812
ZNF250P15622-33EBI-949753,EBI-10177272
ZNF417Q8TAU35EBI-949753,EBI-740727
ZNF497Q6ZNH54EBI-949753,EBI-10486136
ZNF587Q96SQ57EBI-949753,EBI-6427977

GO - Molecular functioni

  • kinase binding Source: UniProtKB

Protein-protein interaction databases

BioGridi116951. 73 interactors.
IntActiQ63HR2. 129 interactors.
MINTiMINT-2870924.
STRINGi9606.ENSP00000319756.

Structurei

Secondary structure

11409
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Helixi1137 – 1140Combined sources4
Beta strandi1141 – 1144Combined sources4
Helixi1147 – 1154Combined sources8
Beta strandi1161 – 1166Combined sources6
Beta strandi1168 – 1170Combined sources3
Beta strandi1173 – 1179Combined sources7
Beta strandi1184 – 1189Combined sources6
Beta strandi1190 – 1192Combined sources3
Helixi1194 – 1198Combined sources5
Beta strandi1199 – 1205Combined sources7
Beta strandi1210 – 1213Combined sources4
Beta strandi1222 – 1224Combined sources3
Helixi1225 – 1230Combined sources6
Turni1231 – 1234Combined sources4
Beta strandi1237 – 1241Combined sources5
Helixi1266 – 1272Combined sources7
Beta strandi1274 – 1285Combined sources12
Helixi1291 – 1304Combined sources14
Beta strandi1305 – 1307Combined sources3
Beta strandi1312 – 1319Combined sources8
Beta strandi1322 – 1329Combined sources8
Beta strandi1332 – 1339Combined sources8
Helixi1340 – 1342Combined sources3
Beta strandi1343 – 1348Combined sources6
Beta strandi1350 – 1352Combined sources3
Beta strandi1354 – 1356Combined sources3
Turni1358 – 1360Combined sources3
Beta strandi1362 – 1372Combined sources11
Beta strandi1375 – 1385Combined sources11
Beta strandi1389 – 1391Combined sources3
Helixi1393 – 1405Combined sources13

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2DKQNMR-A1263-1409[»]
2KNONMR-A1135-1249[»]
2L6KNMR-A1135-1248[»]
2LOZNMR-A1263-1409[»]
3HQCX-ray1.80A1264-1409[»]
ProteinModelPortaliQ63HR2.
SMRiQ63HR2.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ63HR2.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini122 – 294Phosphatase tensin-typePROSITE-ProRule annotationAdd BLAST173
Domaini299 – 425C2 tensin-typePROSITE-ProRule annotationAdd BLAST127
Domaini1140 – 1247SH2PROSITE-ProRule annotationAdd BLAST108

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi489 – 533Pro-richAdd BLAST45
Compositional biasi724 – 1122Pro-richAdd BLAST399

Sequence similaritiesi

Contains 1 C2 tensin-type domain.PROSITE-ProRule annotation
Contains 1 phorbol-ester/DAG-type zinc finger.PROSITE-ProRule annotation
Contains 1 phosphatase tensin-type domain.PROSITE-ProRule annotation
Contains 1 SH2 domain.PROSITE-ProRule annotation

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri31 – 79Phorbol-ester/DAG-typePROSITE-ProRule annotationAdd BLAST49

Keywords - Domaini

SH2 domain, Zinc-finger

Phylogenomic databases

eggNOGiKOG1930. Eukaryota.
KOG2283. Eukaryota.
ENOG410YFRV. LUCA.
GeneTreeiENSGT00760000119113.
HOVERGENiHBG108559.
InParanoidiQ63HR2.
KOiK18080.
OMAiRQGYREP.
OrthoDBiEOG091G00II.
PhylomeDBiQ63HR2.
TreeFamiTF315996.

Family and domain databases

CDDicd00029. C1. 1 hit.
cd01213. PTB_tensin. 1 hit.
Gene3Di2.30.29.30. 1 hit.
3.30.505.10. 1 hit.
3.90.190.10. 1 hit.
InterProiIPR000008. C2_dom.
IPR002219. PE/DAG-bd.
IPR011993. PH_dom-like.
IPR029021. Prot-tyrosine_phosphatase-like.
IPR013625. PTB.
IPR006020. PTB/PI_dom.
IPR000980. SH2.
IPR014020. Tensin_C2-dom.
IPR029023. Tensin_lipid_phosphatase_dom.
IPR033929. Tensin_PTB.
[Graphical view]
PfamiPF08416. PTB. 1 hit.
PF10409. PTEN_C2. 1 hit.
PF00017. SH2. 1 hit.
[Graphical view]
SMARTiSM00109. C1. 1 hit.
SM00462. PTB. 1 hit.
SM01326. PTEN_C2. 1 hit.
SM00252. SH2. 1 hit.
[Graphical view]
SUPFAMiSSF49562. SSF49562. 1 hit.
SSF50729. SSF50729. 1 hit.
SSF52799. SSF52799. 1 hit.
SSF55550. SSF55550. 1 hit.
PROSITEiPS51182. C2_TENSIN. 1 hit.
PS51181. PPASE_TENSIN. 1 hit.
PS50001. SH2. 1 hit.
PS00479. ZF_DAG_PE_1. 1 hit.
PS50081. ZF_DAG_PE_2. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q63HR2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MKSSGPVERL LRALGRRDSS RAASRPRKAE PHSFREKVFR KKPPVCAVCK
60 70 80 90 100
VTIDGTGVSC RVCKVATHRK CEAKVTSACQ ALPPVELRRN TAPVRRIEHL
110 120 130 140 150
GSTKSLNHSK QRSTLPRSFS LDPLMERRWD LDLTYVTERI LAAAFPARPD
160 170 180 190 200
EQRHRGHLRE LAHVLQSKHR DKYLLFNLSE KRHDLTRLNP KVQDFGWPEL
210 220 230 240 250
HAPPLDKLCS ICKAMETWLS ADPQHVVVLY CKGNKGKLGV IVSAYMHYSK
260 270 280 290 300
ISAGADQALA TLTMRKFCED KVATELQPSQ RRYISYFSGL LSGSIRMNSS
310 320 330 340 350
PLFLHYVLIP MLPAFEPGTG FQPFLKIYQS MQLVYTSGVY HIAGPGPQQL
360 370 380 390 400
CISLEPALLL KGDVMVTCYH KGGRGTDRTL VFRVQFHTCT IHGPQLTFPK
410 420 430 440 450
DQLDEAWTDE RFPFQASVEF VFSSSPEKIK GSTPRNDPSV SVDYNTTEPA
460 470 480 490 500
VRWDSYENFN QHHEDSVDGS LTHTRGPLDG SPYAQVQRPP RQTPPAPSPE
510 520 530 540 550
PPPPPMLSVS SDSGHSSTLT TEPAAESPGR PPPTAAERQE LDRLLGGCGV
560 570 580 590 600
ASGGRGAGRE TAILDDEEQP TVGGGPHLGV YPGHRPGLSR HCSCRQGYRE
610 620 630 640 650
PCGVPNGGYY RPEGTLERRR LAYGGYEGSP QGYAEASMEK RRLCRSLSEG
660 670 680 690 700
LYPYPPEMGK PATGDFGYRA PGYREVVILE DPGLPALYPC PACEEKLALP
710 720 730 740 750
TAALYGLRLE REAGEGWASE AGKPLLHPVR PGHPLPLLLP ACGHHHAPMP
760 770 780 790 800
DYSCLKPPKA GEEGHEGCSY TMCPEGRYGH PGYPALVTYS YGGAVPSYCP
810 820 830 840 850
AYGRVPHSCG SPGEGRGYPS PGAHSPRAGS ISPGSPPYPQ SRKLSYEIPT
860 870 880 890 900
EEGGDRYPLP GHLASAGPLA SAESLEPVSW REGPSGHSTL PRSPRDAPCS
910 920 930 940 950
ASSELSGPST PLHTSSPVQG KESTRRQDTR SPTSAPTQRL SPGEALPPVS
960 970 980 990 1000
QAGTGKAPEL PSGSGPEPLA PSPVSPTFPP SSPSDWPQER SPGGHSDGAS
1010 1020 1030 1040 1050
PRSPVPTTLP GLRHAPWQGP RGPPDSPDGS PLTPVPSQMP WLVASPEPPQ
1060 1070 1080 1090 1100
SSPTPAFPLA ASYDTNGLSQ PPLPEKRHLP GPGQQPGPWG PEQASSPARG
1110 1120 1130 1140 1150
ISHHVTFAPL LSDNVPQTPE PPTQESQSNV KFVQDTSKFW YKPHLSRDQA
1160 1170 1180 1190 1200
IALLKDKDPG AFLIRDSHSF QGAYGLALKV ATPPPSAQPW KGDPVEQLVR
1210 1220 1230 1240 1250
HFLIETGPKG VKIKGCPSEP YFGSLSALVS QHSISPISLP CCLRIPSKDP
1260 1270 1280 1290 1300
LEETPEAPVP TNMSTAADLL RQGAACSVLY LTSVETESLT GPQAVARASS
1310 1320 1330 1340 1350
AALSCSPRPT PAVVHFKVSA QGITLTDNQR KLFFRRHYPV NSITFSSTDP
1360 1370 1380 1390 1400
QDRRWTNPDG TTSKIFGFVA KKPGSPWENV CHLFAELDPD QPAGAIVTFI

TKVLLGQRK
Length:1,409
Mass (Da):152,580
Last modified:June 26, 2007 - v2
Checksum:i67824299A1382140
GO
Isoform 2 (identifier: Q63HR2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     776-872: Missing.

Show »
Length:1,312
Mass (Da):142,685
Checksum:iBD63FB8C01E97D9A
GO
Isoform 4 (identifier: Q63HR2-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-25: MKSSGPVERLLRALGRRDSSRAASR → MDGGGVCVGRGDLLSSPQALGQLLRKESRPRRAMK

Show »
Length:1,419
Mass (Da):153,564
Checksum:i7F26C74F3E88A801
GO
Isoform 5 (identifier: Q63HR2-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-124: Missing.

Show »
Length:1,285
Mass (Da):138,828
Checksum:iF52B6ED198BEE396
GO
Isoform 6 (identifier: Q63HR2-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1273-1274: Missing.

Show »
Length:1,407
Mass (Da):152,452
Checksum:iC19BCA8F1535E663
GO

Sequence cautioni

The sequence AAI29829 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence AAI29830 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence AAI31504 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence BAA83027 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence CAH56176 differs from that shown. Intron retention.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti702A → V in AAH54099 (PubMed:15489334).Curated1
Sequence conflicti898P → Q in AAH54099 (PubMed:15489334).Curated1
Sequence conflicti1036P → L in CAB70815 (PubMed:17974005).Curated1
Sequence conflicti1083G → E in AAI29830 (PubMed:15489334).Curated1
Sequence conflicti1119P → S in AAH54099 (PubMed:15489334).Curated1
Sequence conflicti1148D → G in AAH54099 (PubMed:15489334).Curated1
Sequence conflicti1236P → L in CAH56176 (PubMed:17974005).Curated1
Sequence conflicti1246P → L in AAM74225 (PubMed:12470648).Curated1
Sequence conflicti1246P → L in AAN03866 (PubMed:12470648).Curated1
Sequence conflicti1246P → L in AAL14641 (PubMed:11792844).Curated1
Sequence conflicti1246P → L in BAA83027 (PubMed:10470851).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_033043353S → T.Corresponds to variant rs11170389dbSNPEnsembl.1
Natural variantiVAR_052547670A → T.Corresponds to variant rs11558984dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0264571 – 124Missing in isoform 5. 2 PublicationsAdd BLAST124
Alternative sequenceiVSP_0264581 – 25MKSSG…RAASR → MDGGGVCVGRGDLLSSPQAL GQLLRKESRPRRAMK in isoform 4. 1 PublicationAdd BLAST25
Alternative sequenceiVSP_026460776 – 872Missing in isoform 2. 1 PublicationAdd BLAST97
Alternative sequenceiVSP_0264611273 – 1274Missing in isoform 6. 1 Publication2

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF518729 mRNA. Translation: AAM74225.1.
AF518728 mRNA. Translation: AAN03866.1.
AF417490 mRNA. Translation: AAL14641.1.
AB028998 mRNA. Translation: BAA83027.2. Different initiation.
AL137564 mRNA. Translation: CAB70815.1.
BX647126 mRNA. Translation: CAH56176.1. Sequence problems.
BC054099 mRNA. Translation: AAH54099.1.
BC110854 mRNA. Translation: AAI10855.1.
BC129828 mRNA. Translation: AAI29829.1. Different initiation.
BC129829 mRNA. Translation: AAI29830.1. Different initiation.
BC131503 mRNA. Translation: AAI31504.1. Different initiation.
BC142668 mRNA. Translation: AAI42669.1.
BC142712 mRNA. Translation: AAI42713.1.
CCDSiCCDS8842.1. [Q63HR2-4]
CCDS8843.1. [Q63HR2-1]
CCDS8844.1. [Q63HR2-5]
PIRiT46500.
RefSeqiNP_056134.2. NM_015319.2. [Q63HR2-4]
NP_736610.2. NM_170754.2. [Q63HR2-1]
NP_938072.1. NM_198316.1. [Q63HR2-5]
UniGeneiHs.343334.
Hs.6147.

Genome annotation databases

EnsembliENST00000314250; ENSP00000319684; ENSG00000111077. [Q63HR2-1]
ENST00000314276; ENSP00000319756; ENSG00000111077. [Q63HR2-4]
ENST00000379902; ENSP00000369232; ENSG00000111077. [Q63HR2-5]
ENST00000546602; ENSP00000449363; ENSG00000111077. [Q63HR2-2]
ENST00000552570; ENSP00000447021; ENSG00000111077. [Q63HR2-6]
GeneIDi23371.
KEGGihsa:23371.
UCSCiuc001sbl.4. human. [Q63HR2-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF518729 mRNA. Translation: AAM74225.1.
AF518728 mRNA. Translation: AAN03866.1.
AF417490 mRNA. Translation: AAL14641.1.
AB028998 mRNA. Translation: BAA83027.2. Different initiation.
AL137564 mRNA. Translation: CAB70815.1.
BX647126 mRNA. Translation: CAH56176.1. Sequence problems.
BC054099 mRNA. Translation: AAH54099.1.
BC110854 mRNA. Translation: AAI10855.1.
BC129828 mRNA. Translation: AAI29829.1. Different initiation.
BC129829 mRNA. Translation: AAI29830.1. Different initiation.
BC131503 mRNA. Translation: AAI31504.1. Different initiation.
BC142668 mRNA. Translation: AAI42669.1.
BC142712 mRNA. Translation: AAI42713.1.
CCDSiCCDS8842.1. [Q63HR2-4]
CCDS8843.1. [Q63HR2-1]
CCDS8844.1. [Q63HR2-5]
PIRiT46500.
RefSeqiNP_056134.2. NM_015319.2. [Q63HR2-4]
NP_736610.2. NM_170754.2. [Q63HR2-1]
NP_938072.1. NM_198316.1. [Q63HR2-5]
UniGeneiHs.343334.
Hs.6147.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2DKQNMR-A1263-1409[»]
2KNONMR-A1135-1249[»]
2L6KNMR-A1135-1248[»]
2LOZNMR-A1263-1409[»]
3HQCX-ray1.80A1264-1409[»]
ProteinModelPortaliQ63HR2.
SMRiQ63HR2.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi116951. 73 interactors.
IntActiQ63HR2. 129 interactors.
MINTiMINT-2870924.
STRINGi9606.ENSP00000319756.

PTM databases

DEPODiQ63HR2.
iPTMnetiQ63HR2.
PhosphoSitePlusiQ63HR2.

Polymorphism and mutation databases

BioMutaiTENC1.
DMDMi150416153.

Proteomic databases

EPDiQ63HR2.
MaxQBiQ63HR2.
PaxDbiQ63HR2.
PeptideAtlasiQ63HR2.
PRIDEiQ63HR2.

Protocols and materials databases

DNASUi23371.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000314250; ENSP00000319684; ENSG00000111077. [Q63HR2-1]
ENST00000314276; ENSP00000319756; ENSG00000111077. [Q63HR2-4]
ENST00000379902; ENSP00000369232; ENSG00000111077. [Q63HR2-5]
ENST00000546602; ENSP00000449363; ENSG00000111077. [Q63HR2-2]
ENST00000552570; ENSP00000447021; ENSG00000111077. [Q63HR2-6]
GeneIDi23371.
KEGGihsa:23371.
UCSCiuc001sbl.4. human. [Q63HR2-1]

Organism-specific databases

CTDi23371.
DisGeNETi23371.
GeneCardsiTNS2.
HGNCiHGNC:19737. TNS2.
HPAiHPA034659.
MIMi607717. gene.
neXtProtiNX_Q63HR2.
OpenTargetsiENSG00000111077.
PharmGKBiPA134976096.
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1930. Eukaryota.
KOG2283. Eukaryota.
ENOG410YFRV. LUCA.
GeneTreeiENSGT00760000119113.
HOVERGENiHBG108559.
InParanoidiQ63HR2.
KOiK18080.
OMAiRQGYREP.
OrthoDBiEOG091G00II.
PhylomeDBiQ63HR2.
TreeFamiTF315996.

Enzyme and pathway databases

SignaLinkiQ63HR2.

Miscellaneous databases

ChiTaRSiTENC1. human.
EvolutionaryTraceiQ63HR2.
GeneWikiiTENC1.
GenomeRNAii23371.
PROiQ63HR2.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000111077.
ExpressionAtlasiQ63HR2. baseline and differential.
GenevisibleiQ63HR2. HS.

Family and domain databases

CDDicd00029. C1. 1 hit.
cd01213. PTB_tensin. 1 hit.
Gene3Di2.30.29.30. 1 hit.
3.30.505.10. 1 hit.
3.90.190.10. 1 hit.
InterProiIPR000008. C2_dom.
IPR002219. PE/DAG-bd.
IPR011993. PH_dom-like.
IPR029021. Prot-tyrosine_phosphatase-like.
IPR013625. PTB.
IPR006020. PTB/PI_dom.
IPR000980. SH2.
IPR014020. Tensin_C2-dom.
IPR029023. Tensin_lipid_phosphatase_dom.
IPR033929. Tensin_PTB.
[Graphical view]
PfamiPF08416. PTB. 1 hit.
PF10409. PTEN_C2. 1 hit.
PF00017. SH2. 1 hit.
[Graphical view]
SMARTiSM00109. C1. 1 hit.
SM00462. PTB. 1 hit.
SM01326. PTEN_C2. 1 hit.
SM00252. SH2. 1 hit.
[Graphical view]
SUPFAMiSSF49562. SSF49562. 1 hit.
SSF50729. SSF50729. 1 hit.
SSF52799. SSF52799. 1 hit.
SSF55550. SSF55550. 1 hit.
PROSITEiPS51182. C2_TENSIN. 1 hit.
PS51181. PPASE_TENSIN. 1 hit.
PS50001. SH2. 1 hit.
PS00479. ZF_DAG_PE_1. 1 hit.
PS50081. ZF_DAG_PE_2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiTNS2_HUMAN
AccessioniPrimary (citable) accession number: Q63HR2
Secondary accession number(s): A2VDF2
, A2VDF3, A2VDI8, A5PKY4, Q2NL80, Q76MW6, Q7Z5T9, Q8NFF9, Q8NFG0, Q96P25, Q9NT29, Q9UPS7
Entry historyi
Integrated into UniProtKB/Swiss-Prot: June 26, 2007
Last sequence update: June 26, 2007
Last modified: November 30, 2016
This is version 116 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.