Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q63HR2

- TENC1_HUMAN

UniProt

Q63HR2 - TENC1_HUMAN

Protein

Tensin-like C1 domain-containing phosphatase

Gene

TENC1

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 94 (01 Oct 2014)
      Sequence version 2 (26 Jun 2007)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Regulates cell motility and proliferation. May have phosphatase activity. Reduces AKT1 phosphorylation. Lowers AKT1 kinase activity and interferes with AKT1 signaling.1 Publication

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Active sitei231 – 2311Phosphocysteine intermediateCurated

    Regions

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Zinc fingeri31 – 7949Phorbol-ester/DAG-typePROSITE-ProRule annotationAdd
    BLAST

    GO - Molecular functioni

    1. metal ion binding Source: UniProtKB-KW
    2. phosphoprotein phosphatase activity Source: UniProtKB-KW
    3. protein binding Source: UniProtKB

    GO - Biological processi

    1. cellular homeostasis Source: Ensembl
    2. collagen metabolic process Source: Ensembl
    3. intracellular signal transduction Source: InterPro
    4. kidney development Source: Ensembl
    5. multicellular organismal homeostasis Source: Ensembl
    6. multicellular organism growth Source: Ensembl
    7. negative regulation of cell proliferation Source: UniProtKB
    8. response to muscle activity Source: Ensembl

    Keywords - Molecular functioni

    Hydrolase, Protein phosphatase

    Keywords - Ligandi

    Metal-binding, Zinc

    Enzyme and pathway databases

    SignaLinkiQ63HR2.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Tensin-like C1 domain-containing phosphatase (EC:3.1.3.-)
    Alternative name(s):
    C1 domain-containing phosphatase and tensin homolog
    Short name:
    C1-TEN
    Tensin-2
    Gene namesi
    Name:TENC1
    Synonyms:KIAA1075, TNS2
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 12

    Organism-specific databases

    HGNCiHGNC:19737. TENC1.

    Subcellular locationi

    Cell junctionfocal adhesion 1 Publication. Cell membrane 1 Publication; Peripheral membrane protein 1 Publication; Cytoplasmic side 1 Publication
    Note: Detected at the end of actin stress fibers.

    GO - Cellular componenti

    1. focal adhesion Source: UniProtKB
    2. plasma membrane Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Cell junction, Cell membrane, Membrane

    Pathology & Biotechi

    Mutagenesis

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Mutagenesisi231 – 2311C → S: Abolishes inhibition of AKT1 kinase activity. 1 Publication

    Organism-specific databases

    PharmGKBiPA134976096.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 14091409Tensin-like C1 domain-containing phosphatasePRO_0000292987Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei483 – 4831PhosphotyrosineBy similarity

    Keywords - PTMi

    Phosphoprotein

    Proteomic databases

    MaxQBiQ63HR2.
    PaxDbiQ63HR2.
    PRIDEiQ63HR2.

    PTM databases

    PhosphoSiteiQ63HR2.

    Expressioni

    Tissue specificityi

    Detected in heart, kidney, brain, thymus, spleen, liver, placenta, lung, skeletal muscle and small intestine.2 Publications

    Gene expression databases

    ArrayExpressiQ63HR2.
    BgeeiQ63HR2.
    GenevestigatoriQ63HR2.

    Organism-specific databases

    HPAiHPA034659.

    Interactioni

    Subunit structurei

    Interacts with AXL.1 Publication

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    ERBB2P046264EBI-949753,EBI-641062
    ERBB3P218603EBI-949753,EBI-720706
    KITP107212EBI-949753,EBI-1379503
    METP085812EBI-949753,EBI-1039152

    Protein-protein interaction databases

    BioGridi116951. 10 interactions.
    IntActiQ63HR2. 10 interactions.
    MINTiMINT-2870924.

    Structurei

    Secondary structure

    1
    1409
    Legend: HelixTurnBeta strand
    Show more details
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Helixi1137 – 11404
    Beta strandi1141 – 11444
    Helixi1147 – 11548
    Beta strandi1161 – 11666
    Beta strandi1168 – 11703
    Beta strandi1173 – 11797
    Beta strandi1184 – 11896
    Beta strandi1190 – 11923
    Helixi1194 – 11985
    Beta strandi1199 – 12057
    Beta strandi1210 – 12134
    Beta strandi1222 – 12243
    Helixi1225 – 12306
    Turni1231 – 12344
    Beta strandi1237 – 12415
    Helixi1266 – 12727
    Beta strandi1274 – 128512
    Helixi1291 – 130414
    Beta strandi1305 – 13073
    Beta strandi1312 – 13198
    Beta strandi1322 – 13298
    Beta strandi1332 – 13398
    Helixi1340 – 13423
    Beta strandi1343 – 13486
    Beta strandi1350 – 13523
    Beta strandi1354 – 13563
    Turni1358 – 13603
    Beta strandi1362 – 137211
    Beta strandi1375 – 138511
    Beta strandi1389 – 13913
    Helixi1393 – 140513

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    EntryMethodResolution (Å)ChainPositionsPDBsum
    2DKQNMR-A1263-1409[»]
    2KNONMR-A1135-1249[»]
    2L6KNMR-A1135-1248[»]
    2LOZNMR-A1263-1409[»]
    3HQCX-ray1.80A1264-1409[»]
    ProteinModelPortaliQ63HR2.
    SMRiQ63HR2. Positions 126-467, 1135-1249, 1263-1409.
    ModBaseiSearch...
    MobiDBiSearch...

    Miscellaneous databases

    EvolutionaryTraceiQ63HR2.

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini122 – 294173Phosphatase tensin-typePROSITE-ProRule annotationAdd
    BLAST
    Domaini299 – 425127C2 tensin-typePROSITE-ProRule annotationAdd
    BLAST
    Domaini1140 – 1247108SH2PROSITE-ProRule annotationAdd
    BLAST

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi489 – 53345Pro-richAdd
    BLAST
    Compositional biasi724 – 1122399Pro-richAdd
    BLAST

    Sequence similaritiesi

    Contains 1 C2 tensin-type domain.PROSITE-ProRule annotation
    Contains 1 phorbol-ester/DAG-type zinc finger.PROSITE-ProRule annotation
    Contains 1 phosphatase tensin-type domain.PROSITE-ProRule annotation
    Contains 1 SH2 domain.PROSITE-ProRule annotation

    Zinc finger

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Zinc fingeri31 – 7949Phorbol-ester/DAG-typePROSITE-ProRule annotationAdd
    BLAST

    Keywords - Domaini

    SH2 domain, Zinc-finger

    Phylogenomic databases

    eggNOGiCOG2453.
    HOVERGENiHBG108559.
    KOiK18080.
    OMAiRQGYREP.
    OrthoDBiEOG7ZPNJ6.
    PhylomeDBiQ63HR2.
    TreeFamiTF315996.

    Family and domain databases

    Gene3Di2.30.29.30. 1 hit.
    3.30.505.10. 1 hit.
    3.90.190.10. 1 hit.
    InterProiIPR000008. C2_dom.
    IPR011993. PH_like_dom.
    IPR029021. Prot-tyrosine_phosphatase-like.
    IPR002219. Prot_Kinase_C-like_PE/DAG-bd.
    IPR013625. PTB.
    IPR006020. PTB/PI_dom.
    IPR000980. SH2.
    IPR014020. Tensin_C2-dom.
    IPR029023. Tensin_lipid_phosphatase_dom.
    [Graphical view]
    PfamiPF08416. PTB. 1 hit.
    PF10409. PTEN_C2. 1 hit.
    PF00017. SH2. 1 hit.
    [Graphical view]
    SMARTiSM00109. C1. 1 hit.
    SM00462. PTB. 1 hit.
    SM00252. SH2. 1 hit.
    [Graphical view]
    SUPFAMiSSF49562. SSF49562. 1 hit.
    SSF52799. SSF52799. 1 hit.
    SSF55550. SSF55550. 1 hit.
    PROSITEiPS51182. C2_TENSIN. 1 hit.
    PS51181. PPASE_TENSIN. 1 hit.
    PS50001. SH2. 1 hit.
    PS00479. ZF_DAG_PE_1. 1 hit.
    PS50081. ZF_DAG_PE_2. 1 hit.
    [Graphical view]

    Sequences (5)i

    Sequence statusi: Complete.

    This entry describes 5 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q63HR2-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MKSSGPVERL LRALGRRDSS RAASRPRKAE PHSFREKVFR KKPPVCAVCK     50
    VTIDGTGVSC RVCKVATHRK CEAKVTSACQ ALPPVELRRN TAPVRRIEHL 100
    GSTKSLNHSK QRSTLPRSFS LDPLMERRWD LDLTYVTERI LAAAFPARPD 150
    EQRHRGHLRE LAHVLQSKHR DKYLLFNLSE KRHDLTRLNP KVQDFGWPEL 200
    HAPPLDKLCS ICKAMETWLS ADPQHVVVLY CKGNKGKLGV IVSAYMHYSK 250
    ISAGADQALA TLTMRKFCED KVATELQPSQ RRYISYFSGL LSGSIRMNSS 300
    PLFLHYVLIP MLPAFEPGTG FQPFLKIYQS MQLVYTSGVY HIAGPGPQQL 350
    CISLEPALLL KGDVMVTCYH KGGRGTDRTL VFRVQFHTCT IHGPQLTFPK 400
    DQLDEAWTDE RFPFQASVEF VFSSSPEKIK GSTPRNDPSV SVDYNTTEPA 450
    VRWDSYENFN QHHEDSVDGS LTHTRGPLDG SPYAQVQRPP RQTPPAPSPE 500
    PPPPPMLSVS SDSGHSSTLT TEPAAESPGR PPPTAAERQE LDRLLGGCGV 550
    ASGGRGAGRE TAILDDEEQP TVGGGPHLGV YPGHRPGLSR HCSCRQGYRE 600
    PCGVPNGGYY RPEGTLERRR LAYGGYEGSP QGYAEASMEK RRLCRSLSEG 650
    LYPYPPEMGK PATGDFGYRA PGYREVVILE DPGLPALYPC PACEEKLALP 700
    TAALYGLRLE REAGEGWASE AGKPLLHPVR PGHPLPLLLP ACGHHHAPMP 750
    DYSCLKPPKA GEEGHEGCSY TMCPEGRYGH PGYPALVTYS YGGAVPSYCP 800
    AYGRVPHSCG SPGEGRGYPS PGAHSPRAGS ISPGSPPYPQ SRKLSYEIPT 850
    EEGGDRYPLP GHLASAGPLA SAESLEPVSW REGPSGHSTL PRSPRDAPCS 900
    ASSELSGPST PLHTSSPVQG KESTRRQDTR SPTSAPTQRL SPGEALPPVS 950
    QAGTGKAPEL PSGSGPEPLA PSPVSPTFPP SSPSDWPQER SPGGHSDGAS 1000
    PRSPVPTTLP GLRHAPWQGP RGPPDSPDGS PLTPVPSQMP WLVASPEPPQ 1050
    SSPTPAFPLA ASYDTNGLSQ PPLPEKRHLP GPGQQPGPWG PEQASSPARG 1100
    ISHHVTFAPL LSDNVPQTPE PPTQESQSNV KFVQDTSKFW YKPHLSRDQA 1150
    IALLKDKDPG AFLIRDSHSF QGAYGLALKV ATPPPSAQPW KGDPVEQLVR 1200
    HFLIETGPKG VKIKGCPSEP YFGSLSALVS QHSISPISLP CCLRIPSKDP 1250
    LEETPEAPVP TNMSTAADLL RQGAACSVLY LTSVETESLT GPQAVARASS 1300
    AALSCSPRPT PAVVHFKVSA QGITLTDNQR KLFFRRHYPV NSITFSSTDP 1350
    QDRRWTNPDG TTSKIFGFVA KKPGSPWENV CHLFAELDPD QPAGAIVTFI 1400
    TKVLLGQRK 1409
    Length:1,409
    Mass (Da):152,580
    Last modified:June 26, 2007 - v2
    Checksum:i67824299A1382140
    GO
    Isoform 2 (identifier: Q63HR2-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         776-872: Missing.

    Show »
    Length:1,312
    Mass (Da):142,685
    Checksum:iBD63FB8C01E97D9A
    GO
    Isoform 4 (identifier: Q63HR2-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-25: MKSSGPVERLLRALGRRDSSRAASR → MDGGGVCVGRGDLLSSPQALGQLLRKESRPRRAMK

    Show »
    Length:1,419
    Mass (Da):153,564
    Checksum:i7F26C74F3E88A801
    GO
    Isoform 5 (identifier: Q63HR2-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-124: Missing.

    Show »
    Length:1,285
    Mass (Da):138,828
    Checksum:iF52B6ED198BEE396
    GO
    Isoform 6 (identifier: Q63HR2-6) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1273-1274: Missing.

    Show »
    Length:1,407
    Mass (Da):152,452
    Checksum:iC19BCA8F1535E663
    GO

    Sequence cautioni

    The sequence CAH56176.1 differs from that shown. Reason: Intron retention.
    The sequence AAI29829.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.
    The sequence AAI29830.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.
    The sequence AAI31504.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.
    The sequence BAA83027.2 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti702 – 7021A → V in AAH54099. (PubMed:15489334)Curated
    Sequence conflicti898 – 8981P → Q in AAH54099. (PubMed:15489334)Curated
    Sequence conflicti1036 – 10361P → L in CAB70815. (PubMed:17974005)Curated
    Sequence conflicti1083 – 10831G → E in AAI29830. (PubMed:15489334)Curated
    Sequence conflicti1119 – 11191P → S in AAH54099. (PubMed:15489334)Curated
    Sequence conflicti1148 – 11481D → G in AAH54099. (PubMed:15489334)Curated
    Sequence conflicti1236 – 12361P → L in CAH56176. (PubMed:17974005)Curated
    Sequence conflicti1246 – 12461P → L in AAM74225. (PubMed:12470648)Curated
    Sequence conflicti1246 – 12461P → L in AAN03866. (PubMed:12470648)Curated
    Sequence conflicti1246 – 12461P → L in AAL14641. (PubMed:11792844)Curated
    Sequence conflicti1246 – 12461P → L in BAA83027. (PubMed:10470851)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti353 – 3531S → T.
    Corresponds to variant rs11170389 [ dbSNP | Ensembl ].
    VAR_033043
    Natural varianti670 – 6701A → T.
    Corresponds to variant rs11558984 [ dbSNP | Ensembl ].
    VAR_052547

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 124124Missing in isoform 5. 2 PublicationsVSP_026457Add
    BLAST
    Alternative sequencei1 – 2525MKSSG…RAASR → MDGGGVCVGRGDLLSSPQAL GQLLRKESRPRRAMK in isoform 4. 1 PublicationVSP_026458Add
    BLAST
    Alternative sequencei776 – 87297Missing in isoform 2. 1 PublicationVSP_026460Add
    BLAST
    Alternative sequencei1273 – 12742Missing in isoform 6. 1 PublicationVSP_026461

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF518729 mRNA. Translation: AAM74225.1.
    AF518728 mRNA. Translation: AAN03866.1.
    AF417490 mRNA. Translation: AAL14641.1.
    AB028998 mRNA. Translation: BAA83027.2. Different initiation.
    AL137564 mRNA. Translation: CAB70815.1.
    BX647126 mRNA. Translation: CAH56176.1. Sequence problems.
    BC054099 mRNA. Translation: AAH54099.1.
    BC110854 mRNA. Translation: AAI10855.1.
    BC129828 mRNA. Translation: AAI29829.1. Different initiation.
    BC129829 mRNA. Translation: AAI29830.1. Different initiation.
    BC131503 mRNA. Translation: AAI31504.1. Different initiation.
    BC142668 mRNA. Translation: AAI42669.1.
    BC142712 mRNA. Translation: AAI42713.1.
    CCDSiCCDS8842.1. [Q63HR2-4]
    CCDS8843.1. [Q63HR2-1]
    CCDS8844.1. [Q63HR2-5]
    PIRiT46500.
    RefSeqiNP_056134.2. NM_015319.2. [Q63HR2-4]
    NP_736610.2. NM_170754.2. [Q63HR2-1]
    NP_938072.1. NM_198316.1. [Q63HR2-5]
    UniGeneiHs.343334.
    Hs.6147.

    Genome annotation databases

    EnsembliENST00000314250; ENSP00000319684; ENSG00000111077. [Q63HR2-1]
    ENST00000314276; ENSP00000319756; ENSG00000111077. [Q63HR2-4]
    ENST00000379902; ENSP00000369232; ENSG00000111077. [Q63HR2-5]
    ENST00000546602; ENSP00000449363; ENSG00000111077. [Q63HR2-2]
    ENST00000552570; ENSP00000447021; ENSG00000111077. [Q63HR2-6]
    GeneIDi23371.
    KEGGihsa:23371.
    UCSCiuc001sbl.3. human. [Q63HR2-1]
    uc001sbn.3. human. [Q63HR2-4]
    uc001sbq.3. human. [Q63HR2-2]
    uc009zmr.3. human. [Q63HR2-6]

    Polymorphism databases

    DMDMi150416153.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF518729 mRNA. Translation: AAM74225.1 .
    AF518728 mRNA. Translation: AAN03866.1 .
    AF417490 mRNA. Translation: AAL14641.1 .
    AB028998 mRNA. Translation: BAA83027.2 . Different initiation.
    AL137564 mRNA. Translation: CAB70815.1 .
    BX647126 mRNA. Translation: CAH56176.1 . Sequence problems.
    BC054099 mRNA. Translation: AAH54099.1 .
    BC110854 mRNA. Translation: AAI10855.1 .
    BC129828 mRNA. Translation: AAI29829.1 . Different initiation.
    BC129829 mRNA. Translation: AAI29830.1 . Different initiation.
    BC131503 mRNA. Translation: AAI31504.1 . Different initiation.
    BC142668 mRNA. Translation: AAI42669.1 .
    BC142712 mRNA. Translation: AAI42713.1 .
    CCDSi CCDS8842.1. [Q63HR2-4 ]
    CCDS8843.1. [Q63HR2-1 ]
    CCDS8844.1. [Q63HR2-5 ]
    PIRi T46500.
    RefSeqi NP_056134.2. NM_015319.2. [Q63HR2-4 ]
    NP_736610.2. NM_170754.2. [Q63HR2-1 ]
    NP_938072.1. NM_198316.1. [Q63HR2-5 ]
    UniGenei Hs.343334.
    Hs.6147.

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    Entry Method Resolution (Å) Chain Positions PDBsum
    2DKQ NMR - A 1263-1409 [» ]
    2KNO NMR - A 1135-1249 [» ]
    2L6K NMR - A 1135-1248 [» ]
    2LOZ NMR - A 1263-1409 [» ]
    3HQC X-ray 1.80 A 1264-1409 [» ]
    ProteinModelPortali Q63HR2.
    SMRi Q63HR2. Positions 126-467, 1135-1249, 1263-1409.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 116951. 10 interactions.
    IntActi Q63HR2. 10 interactions.
    MINTi MINT-2870924.

    PTM databases

    PhosphoSitei Q63HR2.

    Polymorphism databases

    DMDMi 150416153.

    Proteomic databases

    MaxQBi Q63HR2.
    PaxDbi Q63HR2.
    PRIDEi Q63HR2.

    Protocols and materials databases

    DNASUi 23371.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000314250 ; ENSP00000319684 ; ENSG00000111077 . [Q63HR2-1 ]
    ENST00000314276 ; ENSP00000319756 ; ENSG00000111077 . [Q63HR2-4 ]
    ENST00000379902 ; ENSP00000369232 ; ENSG00000111077 . [Q63HR2-5 ]
    ENST00000546602 ; ENSP00000449363 ; ENSG00000111077 . [Q63HR2-2 ]
    ENST00000552570 ; ENSP00000447021 ; ENSG00000111077 . [Q63HR2-6 ]
    GeneIDi 23371.
    KEGGi hsa:23371.
    UCSCi uc001sbl.3. human. [Q63HR2-1 ]
    uc001sbn.3. human. [Q63HR2-4 ]
    uc001sbq.3. human. [Q63HR2-2 ]
    uc009zmr.3. human. [Q63HR2-6 ]

    Organism-specific databases

    CTDi 23371.
    GeneCardsi GC12P053440.
    HGNCi HGNC:19737. TENC1.
    HPAi HPA034659.
    MIMi 607717. gene.
    neXtProti NX_Q63HR2.
    PharmGKBi PA134976096.
    HUGEi Search...
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG2453.
    HOVERGENi HBG108559.
    KOi K18080.
    OMAi RQGYREP.
    OrthoDBi EOG7ZPNJ6.
    PhylomeDBi Q63HR2.
    TreeFami TF315996.

    Enzyme and pathway databases

    SignaLinki Q63HR2.

    Miscellaneous databases

    ChiTaRSi TENC1. human.
    EvolutionaryTracei Q63HR2.
    GeneWikii TENC1.
    GenomeRNAii 23371.
    NextBioi 45448.
    PROi Q63HR2.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q63HR2.
    Bgeei Q63HR2.
    Genevestigatori Q63HR2.

    Family and domain databases

    Gene3Di 2.30.29.30. 1 hit.
    3.30.505.10. 1 hit.
    3.90.190.10. 1 hit.
    InterProi IPR000008. C2_dom.
    IPR011993. PH_like_dom.
    IPR029021. Prot-tyrosine_phosphatase-like.
    IPR002219. Prot_Kinase_C-like_PE/DAG-bd.
    IPR013625. PTB.
    IPR006020. PTB/PI_dom.
    IPR000980. SH2.
    IPR014020. Tensin_C2-dom.
    IPR029023. Tensin_lipid_phosphatase_dom.
    [Graphical view ]
    Pfami PF08416. PTB. 1 hit.
    PF10409. PTEN_C2. 1 hit.
    PF00017. SH2. 1 hit.
    [Graphical view ]
    SMARTi SM00109. C1. 1 hit.
    SM00462. PTB. 1 hit.
    SM00252. SH2. 1 hit.
    [Graphical view ]
    SUPFAMi SSF49562. SSF49562. 1 hit.
    SSF52799. SSF52799. 1 hit.
    SSF55550. SSF55550. 1 hit.
    PROSITEi PS51182. C2_TENSIN. 1 hit.
    PS51181. PPASE_TENSIN. 1 hit.
    PS50001. SH2. 1 hit.
    PS00479. ZF_DAG_PE_1. 1 hit.
    PS50081. ZF_DAG_PE_2. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Interaction of Axl receptor tyrosine kinase with C1-TEN, a novel C1 domain-containing protein with homology to tensin."
      Hafizi S., Alindri F., Karlsson R., Dahlbaeck B.
      Biochem. Biophys. Res. Commun. 299:793-800(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 4), INTERACTION WITH AXL, TISSUE SPECIFICITY.
      Tissue: Kidney.
    2. "Tensin1 and a previously undocumented family member, tensin2, positively regulate cell migration."
      Chen H., Duncan I.C., Bozorgchami H., Lo S.H.
      Proc. Natl. Acad. Sci. U.S.A. 99:733-738(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 5), SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
    3. "Prediction of the coding sequences of unidentified human genes. XIV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
      Kikuno R., Nagase T., Ishikawa K., Hirosawa M., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O.
      DNA Res. 6:197-205(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Brain.
    4. "Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones."
      Nakajima D., Okazaki N., Yamakawa H., Kikuno R., Ohara O., Nagase T.
      DNA Res. 9:99-106(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: SEQUENCE REVISION.
    5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 759-1409 (ISOFORM 6).
      Tissue: Colon endothelium and Testis.
    6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 5), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 364-1398 (ISOFORM 2).
      Tissue: Brain and Uterus.
    7. "C1-TEN is a negative regulator of the Akt/PKB signal transduction pathway and inhibits cell survival, proliferation, and migration."
      Hafizi S., Ibraimi F., Dahlbaeck B.
      FASEB J. 19:971-973(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, MUTAGENESIS OF CYS-231.
    8. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    9. "Solution structure of the PTB domain of KIAA1075 protein from human."
      RIKEN structural genomics initiative (RSGI)
      Submitted (OCT-2006) to the PDB data bank
      Cited for: STRUCTURE BY NMR OF 1263-1409.

    Entry informationi

    Entry nameiTENC1_HUMAN
    AccessioniPrimary (citable) accession number: Q63HR2
    Secondary accession number(s): A2VDF2
    , A2VDF3, A2VDI8, A5PKY4, Q2NL80, Q76MW6, Q7Z5T9, Q8NFF9, Q8NFG0, Q96P25, Q9NT29, Q9UPS7
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: June 26, 2007
    Last sequence update: June 26, 2007
    Last modified: October 1, 2014
    This is version 94 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Reference proteome

    Documents

    1. Human chromosome 12
      Human chromosome 12: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    6. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3