Q63HR2 (TENC1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 29, 2013.
Version 82.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Tensin-like C1 domain-containing phosphatase EC=3.1.3.- Alternative name(s): C1 domain-containing phosphatase and tensin homolog Short name=C1-TEN Tensin-2 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 1409 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Regulates cell motility and proliferation. May have phosphatase activity. Reduces AKT1 phosphorylation. Lowers AKT1 kinase activity and interferes with AKT1 signaling. Ref.7 |
| Subunit structure | Interacts with AXL. Ref.1 |
| Subcellular location | Cell junction › focal adhesion. Cell membrane; Peripheral membrane protein; Cytoplasmic side. Note: Detected at the end of actin stress fibers. Ref.2 |
| Tissue specificity | Detected in heart, kidney, brain, thymus, spleen, liver, placenta, lung, skeletal muscle and small intestine. Ref.1 Ref.2 |
| Sequence similarities | Contains 1 C2 tensin-type domain. Contains 1 phorbol-ester/DAG-type zinc finger. Contains 1 phosphatase tensin-type domain. Contains 1 SH2 domain. |
| Sequence caution | The sequence AAI29829.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended. The sequence AAI29830.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended. The sequence AAI31504.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened. The sequence BAA83027.2 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended. The sequence CAH56176.1 differs from that shown. Reason: Intron retention. |
Ontologies
Alternative products
| This entry describes 5 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q63HR2-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q63HR2-2) The sequence of this isoform differs from the canonical sequence as follows: 776-872: Missing. | ||||||
| Isoform 4 (identifier: Q63HR2-4) The sequence of this isoform differs from the canonical sequence as follows: 1-25: MKSSGPVERLLRALGRRDSSRAASR → MDGGGVCVGRGDLLSSPQALGQLLRKESRPRRAMK | ||||||
| Isoform 5 (identifier: Q63HR2-5) The sequence of this isoform differs from the canonical sequence as follows: 1-124: Missing. | ||||||
| Isoform 6 (identifier: Q63HR2-6) The sequence of this isoform differs from the canonical sequence as follows: 1273-1274: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1409 | 1409 | Tensin-like C1 domain-containing phosphatase | PRO_0000292987 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Regions | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 122 – 294 | 173 | Phosphatase tensin-type | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 299 – 425 | 127 | C2 tensin-type | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 1140 – 1247 | 108 | SH2 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Zinc finger | 31 – 79 | 49 | Phorbol-ester/DAG-type | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Compositional bias | 489 – 533 | 45 | Pro-rich | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Compositional bias | 724 – 1122 | 399 | Pro-rich | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sites | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Active site | 231 | 1 | Phosphocysteine intermediate Probable | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Amino acid modifications | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 455 | 1 | Phosphoserine By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 466 | 1 | Phosphoserine By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 481 | 1 | Phosphoserine By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 483 | 1 | Phosphotyrosine By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 832 | 1 | Phosphoserine By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 835 | 1 | Phosphoserine By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 914 | 1 | Phosphothreonine By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 124 | 124 | Missing in isoform 5. | VSP_026457 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 25 | 25 | MKSSG…RAASR → MDGGGVCVGRGDLLSSPQAL GQLLRKESRPRRAMK in isoform 4. | VSP_026458 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 776 – 872 | 97 | Missing in isoform 2. | VSP_026460 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1273 – 1274 | 2 | Missing in isoform 6. | VSP_026461 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 353 | 1 | S → T in dnSNP:rs11170389. Corresponds to variant rs11170389 [ dbSNP | Ensembl ]. | VAR_033043 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 670 | 1 | A → T. Corresponds to variant rs11558984 [ dbSNP | Ensembl ]. | VAR_052547 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Experimental info | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 231 | 1 | C → S: Abolishes inhibition of AKT1 kinase activity. Ref.7 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 702 | 1 | A → V in AAH54099. Ref.6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 898 | 1 | P → Q in AAH54099. Ref.6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 1036 | 1 | P → L in CAB70815. Ref.5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 1083 | 1 | G → E in AAI29830. Ref.6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 1119 | 1 | P → S in AAH54099. Ref.6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 1148 | 1 | D → G in AAH54099. Ref.6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 1236 | 1 | P → L in CAH56176. Ref.5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 1246 | 1 | P → L in AAM74225. Ref.1 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 1246 | 1 | P → L in AAN03866. Ref.1 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 1246 | 1 | P → L in AAL14641. Ref.2 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 1246 | 1 | P → L in BAA83027. Ref.3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 1137 – 1140 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 1141 – 1144 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 1147 – 1154 | 8 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 1161 – 1166 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 1168 – 1170 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 1173 – 1179 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 1184 – 1189 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 1190 – 1192 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 1194 – 1198 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 1199 – 1205 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 1210 – 1213 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 1222 – 1224 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 1225 – 1230 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 1231 – 1234 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 1237 – 1241 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 1266 – 1272 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 1274 – 1285 | 12 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 1291 – 1304 | 14 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 1305 – 1307 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 1312 – 1319 | 8 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 1322 – 1329 | 8 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 1332 – 1339 | 8 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 1340 – 1342 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 1343 – 1348 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 1350 – 1352 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 1354 – 1356 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 1358 – 1360 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 1362 – 1372 | 11 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 1375 – 1385 | 11 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 1389 – 1391 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 1393 – 1405 | 13 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Interaction of Axl receptor tyrosine kinase with C1-TEN, a novel C1 domain-containing protein with homology to tensin." Hafizi S., Alindri F., Karlsson R., Dahlbaeck B. Biochem. Biophys. Res. Commun. 299:793-800(2002) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 4), INTERACTION WITH AXL, TISSUE SPECIFICITY. Tissue: Kidney. |
| [2] | "Tensin1 and a previously undocumented family member, tensin2, positively regulate cell migration." Chen H., Duncan I.C., Bozorgchami H., Lo S.H. Proc. Natl. Acad. Sci. U.S.A. 99:733-738(2002) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 5), SUBCELLULAR LOCATION, TISSUE SPECIFICITY. |
| [3] | "Prediction of the coding sequences of unidentified human genes. XIV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro." Kikuno R., Nagase T., Ishikawa K., Hirosawa M., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O. DNA Res. 6:197-205(1999) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Brain. |
| [4] | "Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones." Nakajima D., Okazaki N., Yamakawa H., Kikuno R., Ohara O., Nagase T. DNA Res. 9:99-106(2002) [PubMed] [Europe PMC] [Abstract] Cited for: SEQUENCE REVISION. |
| [5] | "The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 759-1409 (ISOFORM 6). Tissue: Colon endothelium and Testis. |
| [6] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 5), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 364-1398 (ISOFORM 2). Tissue: Brain and Uterus. |
| [7] | "C1-TEN is a negative regulator of the Akt/PKB signal transduction pathway and inhibits cell survival, proliferation, and migration." Hafizi S., Ibraimi F., Dahlbaeck B. FASEB J. 19:971-973(2005) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, MUTAGENESIS OF CYS-231. |
| [8] | "Solution structure of the PTB domain of KIAA1075 protein from human." RIKEN structural genomics initiative (RSGI) Submitted (OCT-2006) to the PDB data bank Cited for: STRUCTURE BY NMR OF 1263-1409. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AF518729 mRNA. Translation: AAM74225.1. AF518728 mRNA. Translation: AAN03866.1. AF417490 mRNA. Translation: AAL14641.1. AB028998 mRNA. Translation: BAA83027.2. Different initiation. AL137564 mRNA. Translation: CAB70815.1. BX647126 mRNA. Translation: CAH56176.1. Sequence problems. BC054099 mRNA. Translation: AAH54099.1. BC110854 mRNA. Translation: AAI10855.1. BC129828 mRNA. Translation: AAI29829.1. Different initiation. BC129829 mRNA. Translation: AAI29830.1. Different initiation. BC131503 mRNA. Translation: AAI31504.1. Different initiation. BC142668 mRNA. Translation: AAI42669.1. BC142712 mRNA. Translation: AAI42713.1. | ||||||||||||||||||||||||||||||||||||
| IPI | IPI00385317. IPI00396051. IPI00465295. IPI00550368. IPI00848267. | ||||||||||||||||||||||||||||||||||||
| PIR | T46500. | ||||||||||||||||||||||||||||||||||||
| RefSeq | NP_056134.2. NM_015319.2. NP_736610.2. NM_170754.2. NP_938072.1. NM_198316.1. | ||||||||||||||||||||||||||||||||||||
| UniGene | Hs.343334. Hs.6147. | ||||||||||||||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||||||||||||||
| ProteinModelPortal | Q63HR2. | ||||||||||||||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||||||||||||||
| IntAct | Q63HR2. 6 interactions. | ||||||||||||||||||||||||||||||||||||
| MINT | MINT-2870924. | ||||||||||||||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||||||||||||||
| PhosphoSite | Q63HR2. | ||||||||||||||||||||||||||||||||||||
Polymorphism databases | |||||||||||||||||||||||||||||||||||||
| DMDM | 150416153. | ||||||||||||||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||||||||||||||
| PaxDb | Q63HR2. | ||||||||||||||||||||||||||||||||||||
| PRIDE | Q63HR2. | ||||||||||||||||||||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||||||||||||||||||||
| DNASU | 23371. | ||||||||||||||||||||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||||||||||||||
| Ensembl | ENST00000314250; ENSP00000319684; ENSG00000111077. ENST00000314276; ENSP00000319756; ENSG00000111077. ENST00000379902; ENSP00000369232; ENSG00000111077. ENST00000546602; ENSP00000449363; ENSG00000111077. ENST00000552570; ENSP00000447021; ENSG00000111077. | ||||||||||||||||||||||||||||||||||||
| GeneID | 23371. | ||||||||||||||||||||||||||||||||||||
| KEGG | hsa:23371. | ||||||||||||||||||||||||||||||||||||
| UCSC | uc001sbl.3. human. uc001sbn.3. human. uc001sbq.3. human. uc009zmr.3. human. | ||||||||||||||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||||||||||||||
| CTD | 23371. | ||||||||||||||||||||||||||||||||||||
| GeneCards | GC12P053440. | ||||||||||||||||||||||||||||||||||||
| HGNC | HGNC:19737. TENC1. | ||||||||||||||||||||||||||||||||||||
| HPA | HPA034659. | ||||||||||||||||||||||||||||||||||||
| MIM | 607717. gene. | ||||||||||||||||||||||||||||||||||||
| neXtProt | NX_Q63HR2. | ||||||||||||||||||||||||||||||||||||
| PharmGKB | PA134976096. | ||||||||||||||||||||||||||||||||||||
| HUGE | Search... | ||||||||||||||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||||||||||||||
| eggNOG | COG2453. | ||||||||||||||||||||||||||||||||||||
| HOVERGEN | HBG108559. | ||||||||||||||||||||||||||||||||||||
| OMA | HAPWQGP. | ||||||||||||||||||||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||||||||||||||||||||
| SignaLink | Q63HR2. | ||||||||||||||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||||||||||||||
| ArrayExpress | Q63HR2. | ||||||||||||||||||||||||||||||||||||
| Bgee | Q63HR2. | ||||||||||||||||||||||||||||||||||||
| Genevestigator | Q63HR2. | ||||||||||||||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||||||||||||||
| Gene3D | 2.30.29.30. 1 hit. 3.30.505.10. 1 hit. | ||||||||||||||||||||||||||||||||||||
| InterPro | IPR008973. C2_Ca/lipid-bd_dom_CaLB. IPR011993. PH_like_dom. IPR014019. Phosphatase_tensin-typ. IPR002219. Prot_Kinase_C-like_PE/DAG-bd. IPR013625. PTB. IPR006020. PTyr_interaction_dom. IPR000980. SH2. IPR014020. Tensin_phosphatase_C2-dom. [Graphical view] | ||||||||||||||||||||||||||||||||||||
| Pfam | PF08416. PTB. 1 hit. PF10409. PTEN_C2. 1 hit. PF00017. SH2. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||
| SMART | SM00109. C1. 1 hit. SM00462. PTB. 1 hit. SM00252. SH2. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||
| SUPFAM | SSF49562. C2_CaLB. 1 hit. | ||||||||||||||||||||||||||||||||||||
| PROSITE | PS51182. C2_TENSIN. 1 hit. PS51181. PPASE_TENSIN. 1 hit. PS50001. SH2. 1 hit. PS00479. ZF_DAG_PE_1. 1 hit. PS50081. ZF_DAG_PE_2. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||||||||||||||
Other | |||||||||||||||||||||||||||||||||||||
| ChiTaRS | TENC1. human. | ||||||||||||||||||||||||||||||||||||
| EvolutionaryTrace | Q63HR2. | ||||||||||||||||||||||||||||||||||||
| GenomeRNAi | 23371. | ||||||||||||||||||||||||||||||||||||
| NextBio | 45448. | ||||||||||||||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||||||||||||||
Entry information
| Entry name | TENC1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q63HR2 Secondary accession number(s): A2VDF2 Q9UPS7 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 12 Human chromosome 12: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
