Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q63HR2 (TENC1_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 90. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (6) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Tensin-like C1 domain-containing phosphatase

EC=3.1.3.-
Alternative name(s):
C1 domain-containing phosphatase and tensin homolog
Short name=C1-TEN
Tensin-2
Gene names
Name:TENC1
Synonyms:KIAA1075, TNS2
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length1409 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Regulates cell motility and proliferation. May have phosphatase activity. Reduces AKT1 phosphorylation. Lowers AKT1 kinase activity and interferes with AKT1 signaling. Ref.7

Subunit structure

Interacts with AXL. Ref.1

Subcellular location

Cell junctionfocal adhesion. Cell membrane; Peripheral membrane protein; Cytoplasmic side. Note: Detected at the end of actin stress fibers. Ref.2

Tissue specificity

Detected in heart, kidney, brain, thymus, spleen, liver, placenta, lung, skeletal muscle and small intestine. Ref.1 Ref.2

Sequence similarities

Contains 1 C2 tensin-type domain.

Contains 1 phorbol-ester/DAG-type zinc finger.

Contains 1 phosphatase tensin-type domain.

Contains 1 SH2 domain.

Sequence caution

The sequence AAI29829.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

The sequence AAI29830.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

The sequence AAI31504.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.

The sequence BAA83027.2 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

The sequence CAH56176.1 differs from that shown. Reason: Intron retention.

Binary interactions

With

Entry

#Exp.

IntAct

Notes

ERBB2P046264EBI-949753,EBI-641062
ERBB3P218603EBI-949753,EBI-720706

Alternative products

This entry describes 5 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q63HR2-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q63HR2-2)

The sequence of this isoform differs from the canonical sequence as follows:
     776-872: Missing.
Isoform 4 (identifier: Q63HR2-4)

The sequence of this isoform differs from the canonical sequence as follows:
     1-25: MKSSGPVERLLRALGRRDSSRAASR → MDGGGVCVGRGDLLSSPQALGQLLRKESRPRRAMK
Isoform 5 (identifier: Q63HR2-5)

The sequence of this isoform differs from the canonical sequence as follows:
     1-124: Missing.
Isoform 6 (identifier: Q63HR2-6)

The sequence of this isoform differs from the canonical sequence as follows:
     1273-1274: Missing.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 14091409Tensin-like C1 domain-containing phosphatase
PRO_0000292987

Regions

Domain122 – 294173Phosphatase tensin-type
Domain299 – 425127C2 tensin-type
Domain1140 – 1247108SH2
Zinc finger31 – 7949Phorbol-ester/DAG-type
Compositional bias489 – 53345Pro-rich
Compositional bias724 – 1122399Pro-rich

Sites

Active site2311Phosphocysteine intermediate Probable

Amino acid modifications

Modified residue4831Phosphotyrosine By similarity

Natural variations

Alternative sequence1 – 124124Missing in isoform 5.
VSP_026457
Alternative sequence1 – 2525MKSSG…RAASR → MDGGGVCVGRGDLLSSPQAL GQLLRKESRPRRAMK in isoform 4.
VSP_026458
Alternative sequence776 – 87297Missing in isoform 2.
VSP_026460
Alternative sequence1273 – 12742Missing in isoform 6.
VSP_026461
Natural variant3531S → T.
Corresponds to variant rs11170389 [ dbSNP | Ensembl ].
VAR_033043
Natural variant6701A → T.
Corresponds to variant rs11558984 [ dbSNP | Ensembl ].
VAR_052547

Experimental info

Mutagenesis2311C → S: Abolishes inhibition of AKT1 kinase activity. Ref.7
Sequence conflict7021A → V in AAH54099. Ref.6
Sequence conflict8981P → Q in AAH54099. Ref.6
Sequence conflict10361P → L in CAB70815. Ref.5
Sequence conflict10831G → E in AAI29830. Ref.6
Sequence conflict11191P → S in AAH54099. Ref.6
Sequence conflict11481D → G in AAH54099. Ref.6
Sequence conflict12361P → L in CAH56176. Ref.5
Sequence conflict12461P → L in AAM74225. Ref.1
Sequence conflict12461P → L in AAN03866. Ref.1
Sequence conflict12461P → L in AAL14641. Ref.2
Sequence conflict12461P → L in BAA83027. Ref.3

Secondary structure

....................................................... 1409
Helix Strand Turn

Details...

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified June 26, 2007. Version 2.
Checksum: 67824299A1382140

FASTA1,409152,580
        10         20         30         40         50         60 
MKSSGPVERL LRALGRRDSS RAASRPRKAE PHSFREKVFR KKPPVCAVCK VTIDGTGVSC 

        70         80         90        100        110        120 
RVCKVATHRK CEAKVTSACQ ALPPVELRRN TAPVRRIEHL GSTKSLNHSK QRSTLPRSFS 

       130        140        150        160        170        180 
LDPLMERRWD LDLTYVTERI LAAAFPARPD EQRHRGHLRE LAHVLQSKHR DKYLLFNLSE 

       190        200        210        220        230        240 
KRHDLTRLNP KVQDFGWPEL HAPPLDKLCS ICKAMETWLS ADPQHVVVLY CKGNKGKLGV 

       250        260        270        280        290        300 
IVSAYMHYSK ISAGADQALA TLTMRKFCED KVATELQPSQ RRYISYFSGL LSGSIRMNSS 

       310        320        330        340        350        360 
PLFLHYVLIP MLPAFEPGTG FQPFLKIYQS MQLVYTSGVY HIAGPGPQQL CISLEPALLL 

       370        380        390        400        410        420 
KGDVMVTCYH KGGRGTDRTL VFRVQFHTCT IHGPQLTFPK DQLDEAWTDE RFPFQASVEF 

       430        440        450        460        470        480 
VFSSSPEKIK GSTPRNDPSV SVDYNTTEPA VRWDSYENFN QHHEDSVDGS LTHTRGPLDG 

       490        500        510        520        530        540 
SPYAQVQRPP RQTPPAPSPE PPPPPMLSVS SDSGHSSTLT TEPAAESPGR PPPTAAERQE 

       550        560        570        580        590        600 
LDRLLGGCGV ASGGRGAGRE TAILDDEEQP TVGGGPHLGV YPGHRPGLSR HCSCRQGYRE 

       610        620        630        640        650        660 
PCGVPNGGYY RPEGTLERRR LAYGGYEGSP QGYAEASMEK RRLCRSLSEG LYPYPPEMGK 

       670        680        690        700        710        720 
PATGDFGYRA PGYREVVILE DPGLPALYPC PACEEKLALP TAALYGLRLE REAGEGWASE 

       730        740        750        760        770        780 
AGKPLLHPVR PGHPLPLLLP ACGHHHAPMP DYSCLKPPKA GEEGHEGCSY TMCPEGRYGH 

       790        800        810        820        830        840 
PGYPALVTYS YGGAVPSYCP AYGRVPHSCG SPGEGRGYPS PGAHSPRAGS ISPGSPPYPQ 

       850        860        870        880        890        900 
SRKLSYEIPT EEGGDRYPLP GHLASAGPLA SAESLEPVSW REGPSGHSTL PRSPRDAPCS 

       910        920        930        940        950        960 
ASSELSGPST PLHTSSPVQG KESTRRQDTR SPTSAPTQRL SPGEALPPVS QAGTGKAPEL 

       970        980        990       1000       1010       1020 
PSGSGPEPLA PSPVSPTFPP SSPSDWPQER SPGGHSDGAS PRSPVPTTLP GLRHAPWQGP 

      1030       1040       1050       1060       1070       1080 
RGPPDSPDGS PLTPVPSQMP WLVASPEPPQ SSPTPAFPLA ASYDTNGLSQ PPLPEKRHLP 

      1090       1100       1110       1120       1130       1140 
GPGQQPGPWG PEQASSPARG ISHHVTFAPL LSDNVPQTPE PPTQESQSNV KFVQDTSKFW 

      1150       1160       1170       1180       1190       1200 
YKPHLSRDQA IALLKDKDPG AFLIRDSHSF QGAYGLALKV ATPPPSAQPW KGDPVEQLVR 

      1210       1220       1230       1240       1250       1260 
HFLIETGPKG VKIKGCPSEP YFGSLSALVS QHSISPISLP CCLRIPSKDP LEETPEAPVP 

      1270       1280       1290       1300       1310       1320 
TNMSTAADLL RQGAACSVLY LTSVETESLT GPQAVARASS AALSCSPRPT PAVVHFKVSA 

      1330       1340       1350       1360       1370       1380 
QGITLTDNQR KLFFRRHYPV NSITFSSTDP QDRRWTNPDG TTSKIFGFVA KKPGSPWENV 

      1390       1400 
CHLFAELDPD QPAGAIVTFI TKVLLGQRK 

« Hide

Isoform 2 [UniParc].

Checksum: BD63FB8C01E97D9A
Show »

FASTA1,312142,685
Isoform 4 [UniParc].

Checksum: 7F26C74F3E88A801
Show »

FASTA1,419153,564
Isoform 5 [UniParc].

Checksum: F52B6ED198BEE396
Show »

FASTA1,285138,828
Isoform 6 [UniParc].

Checksum: C19BCA8F1535E663
Show »

FASTA1,407152,452

References

« Hide 'large scale' references
[1]"Interaction of Axl receptor tyrosine kinase with C1-TEN, a novel C1 domain-containing protein with homology to tensin."
Hafizi S., Alindri F., Karlsson R., Dahlbaeck B.
Biochem. Biophys. Res. Commun. 299:793-800(2002) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 4), INTERACTION WITH AXL, TISSUE SPECIFICITY.
Tissue: Kidney.
[2]"Tensin1 and a previously undocumented family member, tensin2, positively regulate cell migration."
Chen H., Duncan I.C., Bozorgchami H., Lo S.H.
Proc. Natl. Acad. Sci. U.S.A. 99:733-738(2002) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 5), SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
[3]"Prediction of the coding sequences of unidentified human genes. XIV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
Kikuno R., Nagase T., Ishikawa K., Hirosawa M., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O.
DNA Res. 6:197-205(1999) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Brain.
[4]"Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones."
Nakajima D., Okazaki N., Yamakawa H., Kikuno R., Ohara O., Nagase T.
DNA Res. 9:99-106(2002) [PubMed] [Europe PMC] [Abstract]
Cited for: SEQUENCE REVISION.
[5]"The full-ORF clone resource of the German cDNA consortium."
Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I.
BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 759-1409 (ISOFORM 6).
Tissue: Colon endothelium and Testis.
[6]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 5), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 364-1398 (ISOFORM 2).
Tissue: Brain and Uterus.
[7]"C1-TEN is a negative regulator of the Akt/PKB signal transduction pathway and inhibits cell survival, proliferation, and migration."
Hafizi S., Ibraimi F., Dahlbaeck B.
FASEB J. 19:971-973(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION, MUTAGENESIS OF CYS-231.
[8]"N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB."
Van Damme P., Lasa M., Polevoda B., Gazquez C., Elosegui-Artola A., Kim D.S., De Juan-Pardo E., Demeyer K., Hole K., Larrea E., Timmerman E., Prieto J., Arnesen T., Sherman F., Gevaert K., Aldabe R.
Proc. Natl. Acad. Sci. U.S.A. 109:12449-12454(2012) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
[9]"Solution structure of the PTB domain of KIAA1075 protein from human."
RIKEN structural genomics initiative (RSGI)
Submitted (OCT-2006) to the PDB data bank
Cited for: STRUCTURE BY NMR OF 1263-1409.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AF518729 mRNA. Translation: AAM74225.1.
AF518728 mRNA. Translation: AAN03866.1.
AF417490 mRNA. Translation: AAL14641.1.
AB028998 mRNA. Translation: BAA83027.2. Different initiation.
AL137564 mRNA. Translation: CAB70815.1.
BX647126 mRNA. Translation: CAH56176.1. Sequence problems.
BC054099 mRNA. Translation: AAH54099.1.
BC110854 mRNA. Translation: AAI10855.1.
BC129828 mRNA. Translation: AAI29829.1. Different initiation.
BC129829 mRNA. Translation: AAI29830.1. Different initiation.
BC131503 mRNA. Translation: AAI31504.1. Different initiation.
BC142668 mRNA. Translation: AAI42669.1.
BC142712 mRNA. Translation: AAI42713.1.
PIRT46500.
RefSeqNP_056134.2. NM_015319.2.
NP_736610.2. NM_170754.2.
NP_938072.1. NM_198316.1.
UniGeneHs.343334.
Hs.6147.

3D structure databases

PDBe
RCSB PDB
PDBj
EntryMethodResolution (Å)ChainPositionsPDBsum
2DKQNMR-A1263-1409[»]
2KNONMR-A1135-1249[»]
2L6KNMR-A1135-1248[»]
2LOZNMR-A1263-1409[»]
3HQCX-ray1.80A1264-1409[»]
ProteinModelPortalQ63HR2.
SMRQ63HR2. Positions 126-467, 1135-1249, 1263-1409.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid116951. 10 interactions.
IntActQ63HR2. 8 interactions.
MINTMINT-2870924.

PTM databases

PhosphoSiteQ63HR2.

Polymorphism databases

DMDM150416153.

Proteomic databases

PaxDbQ63HR2.
PRIDEQ63HR2.

Protocols and materials databases

DNASU23371.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000314250; ENSP00000319684; ENSG00000111077. [Q63HR2-1]
ENST00000314276; ENSP00000319756; ENSG00000111077. [Q63HR2-4]
ENST00000379902; ENSP00000369232; ENSG00000111077. [Q63HR2-5]
ENST00000546602; ENSP00000449363; ENSG00000111077. [Q63HR2-2]
ENST00000552570; ENSP00000447021; ENSG00000111077. [Q63HR2-6]
GeneID23371.
KEGGhsa:23371.
UCSCuc001sbl.3. human. [Q63HR2-1]
uc001sbn.3. human. [Q63HR2-4]
uc001sbq.3. human. [Q63HR2-2]
uc009zmr.3. human. [Q63HR2-6]

Organism-specific databases

CTD23371.
GeneCardsGC12P053440.
HGNCHGNC:19737. TENC1.
HPAHPA034659.
MIM607717. gene.
neXtProtNX_Q63HR2.
PharmGKBPA134976096.
HUGESearch...
GenAtlasSearch...

Phylogenomic databases

eggNOGCOG2453.
HOVERGENHBG108559.
OMARQGYREP.
OrthoDBEOG7ZPNJ6.
PhylomeDBQ63HR2.
TreeFamTF315996.

Enzyme and pathway databases

SignaLinkQ63HR2.

Gene expression databases

ArrayExpressQ63HR2.
BgeeQ63HR2.
GenevestigatorQ63HR2.

Family and domain databases

Gene3D2.30.29.30. 1 hit.
3.30.505.10. 1 hit.
InterProIPR000008. C2_dom.
IPR011993. PH_like_dom.
IPR002219. Prot_Kinase_C-like_PE/DAG-bd.
IPR013625. PTB.
IPR006020. PTB/PI_dom.
IPR000980. SH2.
IPR014020. Tensin_C2-dom.
[Graphical view]
PfamPF08416. PTB. 1 hit.
PF10409. PTEN_C2. 1 hit.
PF00017. SH2. 1 hit.
[Graphical view]
SMARTSM00109. C1. 1 hit.
SM00462. PTB. 1 hit.
SM00252. SH2. 1 hit.
[Graphical view]
SUPFAMSSF49562. SSF49562. 1 hit.
SSF55550. SSF55550. 1 hit.
PROSITEPS51182. C2_TENSIN. 1 hit.
PS51181. PPASE_TENSIN. 1 hit.
PS50001. SH2. 1 hit.
PS00479. ZF_DAG_PE_1. 1 hit.
PS50081. ZF_DAG_PE_2. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSTENC1. human.
EvolutionaryTraceQ63HR2.
GeneWikiTENC1.
GenomeRNAi23371.
NextBio45448.
PROQ63HR2.
SOURCESearch...

Entry information

Entry nameTENC1_HUMAN
AccessionPrimary (citable) accession number: Q63HR2
Secondary accession number(s): A2VDF2 expand/collapse secondary AC list , A2VDF3, A2VDI8, A5PKY4, Q2NL80, Q76MW6, Q7Z5T9, Q8NFF9, Q8NFG0, Q96P25, Q9NT29, Q9UPS7
Entry history
Integrated into UniProtKB/Swiss-Prot: June 26, 2007
Last sequence update: June 26, 2007
Last modified: April 16, 2014
This is version 90 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

PDB cross-references

Index of Protein Data Bank (PDB) cross-references

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 12

Human chromosome 12: entries, gene names and cross-references to MIM