Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Tensin-2

Gene

TNS2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Regulates cell motility and proliferation. May have phosphatase activity. Reduces AKT1 phosphorylation. Lowers AKT1 kinase activity and interferes with AKT1 signaling.1 Publication

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Active sitei231 – 2311Phosphocysteine intermediateCurated

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri31 – 7949Phorbol-ester/DAG-typePROSITE-ProRule annotationAdd
BLAST

GO - Molecular functioni

  1. metal ion binding Source: UniProtKB-KW
  2. phosphoprotein phosphatase activity Source: UniProtKB-KW

GO - Biological processi

  1. cellular homeostasis Source: Ensembl
  2. collagen metabolic process Source: Ensembl
  3. intracellular signal transduction Source: InterPro
  4. kidney development Source: Ensembl
  5. multicellular organismal homeostasis Source: Ensembl
  6. multicellular organism growth Source: Ensembl
  7. negative regulation of cell proliferation Source: UniProtKB
  8. response to muscle activity Source: Ensembl
Complete GO annotation...

Keywords - Molecular functioni

Hydrolase, Protein phosphatase

Keywords - Ligandi

Metal-binding, Zinc

Enzyme and pathway databases

SignaLinkiQ63HR2.

Names & Taxonomyi

Protein namesi
Recommended name:
Tensin-2 (EC:3.1.3.-)
Alternative name(s):
C1 domain-containing phosphatase and tensin homolog
Short name:
C1-TEN
Tensin-like C1 domain-containing phosphatase
Gene namesi
Name:TNS2
Synonyms:KIAA1075, TENC1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640 Componenti: Chromosome 12

Organism-specific databases

HGNCiHGNC:19737. TNS2.

Subcellular locationi

  1. Cell junctionfocal adhesion 2 Publications
  2. Cell membrane 1 Publication; Peripheral membrane protein 1 Publication; Cytoplasmic side 1 Publication

  3. Note: Detected at the end of actin stress fibers. Detected in cytoplasmic punctate bodies (PubMed:22019427).1 Publication

GO - Cellular componenti

  1. focal adhesion Source: UniProtKB
  2. plasma membrane Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Cell junction, Cell membrane, Membrane

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi231 – 2311C → S: Abolishes inhibition of AKT1 kinase activity. 1 Publication

Organism-specific databases

PharmGKBiPA134976096.

Polymorphism and mutation databases

BioMutaiTENC1.
DMDMi150416153.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 14091409Tensin-2PRO_0000292987Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei91 – 911Phosphothreonine1 Publication
Modified residuei120 – 1201Phosphoserine1 Publication
Modified residuei455 – 4551Phosphoserine1 Publication
Modified residuei456 – 4561Phosphotyrosine1 Publication
Modified residuei466 – 4661Phosphoserine1 Publication
Modified residuei474 – 4741Phosphothreonine1 Publication
Modified residuei483 – 4831PhosphotyrosineBy similarity
Modified residuei820 – 8201Phosphoserine1 Publication
Modified residuei825 – 8251Phosphoserine1 Publication
Modified residuei830 – 8301Phosphoserine1 Publication
Modified residuei832 – 8321Phosphoserine1 Publication
Modified residuei845 – 8451Phosphoserine1 Publication
Modified residuei931 – 9311Phosphoserine1 Publication
Modified residuei941 – 9411Phosphoserine1 Publication
Modified residuei972 – 9721Phosphoserine1 Publication
Modified residuei977 – 9771Phosphothreonine1 Publication
Modified residuei991 – 9911Phosphoserine1 Publication
Modified residuei1003 – 10031Phosphoserine1 Publication
Modified residuei1182 – 11821Phosphothreonine1 Publication
Modified residuei1247 – 12471Phosphoserine1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ63HR2.
PaxDbiQ63HR2.
PRIDEiQ63HR2.

PTM databases

DEPODiQ63HR2.
PhosphoSiteiQ63HR2.

Expressioni

Tissue specificityi

Detected in heart, kidney, brain, thymus, spleen, liver, placenta, lung, skeletal muscle and small intestine.2 Publications

Gene expression databases

BgeeiQ63HR2.
ExpressionAtlasiQ63HR2. baseline and differential.
GenevestigatoriQ63HR2.

Organism-specific databases

HPAiHPA034659.

Interactioni

Subunit structurei

Interacts with AXL. Interacts with SYK; leading to its phosphorylation (PubMed:22019427).2 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
Q9NWL93EBI-949753,EBI-10315054
C11orf87Q6NUJ23EBI-949753,EBI-6660291
C19orf66Q9NUL53EBI-949753,EBI-10313866
ERBB2P046264EBI-949753,EBI-641062
ERBB3P218603EBI-949753,EBI-720706
KITP107212EBI-949753,EBI-1379503
KRTAP10-5P603703EBI-949753,EBI-10172150
KRTAP10-7P604093EBI-949753,EBI-10172290
KRTAP10-8P604103EBI-949753,EBI-10171774
KRTAP12-2P599913EBI-949753,EBI-10176379
METP085812EBI-949753,EBI-1039152
NUBP2Q9Y5Y23EBI-949753,EBI-1048886
PKP1Q138353EBI-949753,EBI-2513407
REEP6Q96HR93EBI-949753,EBI-750345
RELQ048643EBI-949753,EBI-307352
TEKT5Q96M293EBI-949753,EBI-10239812
ZNF250P15622-33EBI-949753,EBI-10177272
ZNF417Q8TAU33EBI-949753,EBI-740727
ZNF587Q96SQ53EBI-949753,EBI-6427977

Protein-protein interaction databases

BioGridi116951. 28 interactions.
IntActiQ63HR2. 25 interactions.
MINTiMINT-2870924.

Structurei

Secondary structure

1
1409
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Helixi1137 – 11404Combined sources
Beta strandi1141 – 11444Combined sources
Helixi1147 – 11548Combined sources
Beta strandi1161 – 11666Combined sources
Beta strandi1168 – 11703Combined sources
Beta strandi1173 – 11797Combined sources
Beta strandi1184 – 11896Combined sources
Beta strandi1190 – 11923Combined sources
Helixi1194 – 11985Combined sources
Beta strandi1199 – 12057Combined sources
Beta strandi1210 – 12134Combined sources
Beta strandi1222 – 12243Combined sources
Helixi1225 – 12306Combined sources
Turni1231 – 12344Combined sources
Beta strandi1237 – 12415Combined sources
Helixi1266 – 12727Combined sources
Beta strandi1274 – 128512Combined sources
Helixi1291 – 130414Combined sources
Beta strandi1305 – 13073Combined sources
Beta strandi1312 – 13198Combined sources
Beta strandi1322 – 13298Combined sources
Beta strandi1332 – 13398Combined sources
Helixi1340 – 13423Combined sources
Beta strandi1343 – 13486Combined sources
Beta strandi1350 – 13523Combined sources
Beta strandi1354 – 13563Combined sources
Turni1358 – 13603Combined sources
Beta strandi1362 – 137211Combined sources
Beta strandi1375 – 138511Combined sources
Beta strandi1389 – 13913Combined sources
Helixi1393 – 140513Combined sources

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
2DKQNMR-A1263-1409[»]
2KNONMR-A1135-1249[»]
2L6KNMR-A1135-1248[»]
2LOZNMR-A1263-1409[»]
3HQCX-ray1.80A1264-1409[»]
ProteinModelPortaliQ63HR2.
SMRiQ63HR2. Positions 126-467, 1135-1249, 1263-1409.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ63HR2.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini122 – 294173Phosphatase tensin-typePROSITE-ProRule annotationAdd
BLAST
Domaini299 – 425127C2 tensin-typePROSITE-ProRule annotationAdd
BLAST
Domaini1140 – 1247108SH2PROSITE-ProRule annotationAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi489 – 53345Pro-richAdd
BLAST
Compositional biasi724 – 1122399Pro-richAdd
BLAST

Sequence similaritiesi

Contains 1 C2 tensin-type domain.PROSITE-ProRule annotation
Contains 1 phorbol-ester/DAG-type zinc finger.PROSITE-ProRule annotation
Contains 1 phosphatase tensin-type domain.PROSITE-ProRule annotation
Contains 1 SH2 domain.PROSITE-ProRule annotation

Zinc finger

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri31 – 7949Phorbol-ester/DAG-typePROSITE-ProRule annotationAdd
BLAST

Keywords - Domaini

SH2 domain, Zinc-finger

Phylogenomic databases

eggNOGiCOG2453.
GeneTreeiENSGT00760000119113.
HOVERGENiHBG108559.
InParanoidiQ63HR2.
KOiK18080.
OMAiRQGYREP.
OrthoDBiEOG7ZPNJ6.
PhylomeDBiQ63HR2.
TreeFamiTF315996.

Family and domain databases

Gene3Di2.30.29.30. 1 hit.
3.30.505.10. 1 hit.
3.90.190.10. 1 hit.
InterProiIPR000008. C2_dom.
IPR002219. PE/DAG-bd.
IPR011993. PH_like_dom.
IPR029021. Prot-tyrosine_phosphatase-like.
IPR013625. PTB.
IPR006020. PTB/PI_dom.
IPR000980. SH2.
IPR014020. Tensin_C2-dom.
IPR029023. Tensin_lipid_phosphatase_dom.
[Graphical view]
PfamiPF08416. PTB. 1 hit.
PF10409. PTEN_C2. 1 hit.
PF00017. SH2. 1 hit.
[Graphical view]
SMARTiSM00109. C1. 1 hit.
SM00462. PTB. 1 hit.
SM00252. SH2. 1 hit.
[Graphical view]
SUPFAMiSSF49562. SSF49562. 1 hit.
SSF52799. SSF52799. 1 hit.
SSF55550. SSF55550. 1 hit.
PROSITEiPS51182. C2_TENSIN. 1 hit.
PS51181. PPASE_TENSIN. 1 hit.
PS50001. SH2. 1 hit.
PS00479. ZF_DAG_PE_1. 1 hit.
PS50081. ZF_DAG_PE_2. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q63HR2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MKSSGPVERL LRALGRRDSS RAASRPRKAE PHSFREKVFR KKPPVCAVCK
60 70 80 90 100
VTIDGTGVSC RVCKVATHRK CEAKVTSACQ ALPPVELRRN TAPVRRIEHL
110 120 130 140 150
GSTKSLNHSK QRSTLPRSFS LDPLMERRWD LDLTYVTERI LAAAFPARPD
160 170 180 190 200
EQRHRGHLRE LAHVLQSKHR DKYLLFNLSE KRHDLTRLNP KVQDFGWPEL
210 220 230 240 250
HAPPLDKLCS ICKAMETWLS ADPQHVVVLY CKGNKGKLGV IVSAYMHYSK
260 270 280 290 300
ISAGADQALA TLTMRKFCED KVATELQPSQ RRYISYFSGL LSGSIRMNSS
310 320 330 340 350
PLFLHYVLIP MLPAFEPGTG FQPFLKIYQS MQLVYTSGVY HIAGPGPQQL
360 370 380 390 400
CISLEPALLL KGDVMVTCYH KGGRGTDRTL VFRVQFHTCT IHGPQLTFPK
410 420 430 440 450
DQLDEAWTDE RFPFQASVEF VFSSSPEKIK GSTPRNDPSV SVDYNTTEPA
460 470 480 490 500
VRWDSYENFN QHHEDSVDGS LTHTRGPLDG SPYAQVQRPP RQTPPAPSPE
510 520 530 540 550
PPPPPMLSVS SDSGHSSTLT TEPAAESPGR PPPTAAERQE LDRLLGGCGV
560 570 580 590 600
ASGGRGAGRE TAILDDEEQP TVGGGPHLGV YPGHRPGLSR HCSCRQGYRE
610 620 630 640 650
PCGVPNGGYY RPEGTLERRR LAYGGYEGSP QGYAEASMEK RRLCRSLSEG
660 670 680 690 700
LYPYPPEMGK PATGDFGYRA PGYREVVILE DPGLPALYPC PACEEKLALP
710 720 730 740 750
TAALYGLRLE REAGEGWASE AGKPLLHPVR PGHPLPLLLP ACGHHHAPMP
760 770 780 790 800
DYSCLKPPKA GEEGHEGCSY TMCPEGRYGH PGYPALVTYS YGGAVPSYCP
810 820 830 840 850
AYGRVPHSCG SPGEGRGYPS PGAHSPRAGS ISPGSPPYPQ SRKLSYEIPT
860 870 880 890 900
EEGGDRYPLP GHLASAGPLA SAESLEPVSW REGPSGHSTL PRSPRDAPCS
910 920 930 940 950
ASSELSGPST PLHTSSPVQG KESTRRQDTR SPTSAPTQRL SPGEALPPVS
960 970 980 990 1000
QAGTGKAPEL PSGSGPEPLA PSPVSPTFPP SSPSDWPQER SPGGHSDGAS
1010 1020 1030 1040 1050
PRSPVPTTLP GLRHAPWQGP RGPPDSPDGS PLTPVPSQMP WLVASPEPPQ
1060 1070 1080 1090 1100
SSPTPAFPLA ASYDTNGLSQ PPLPEKRHLP GPGQQPGPWG PEQASSPARG
1110 1120 1130 1140 1150
ISHHVTFAPL LSDNVPQTPE PPTQESQSNV KFVQDTSKFW YKPHLSRDQA
1160 1170 1180 1190 1200
IALLKDKDPG AFLIRDSHSF QGAYGLALKV ATPPPSAQPW KGDPVEQLVR
1210 1220 1230 1240 1250
HFLIETGPKG VKIKGCPSEP YFGSLSALVS QHSISPISLP CCLRIPSKDP
1260 1270 1280 1290 1300
LEETPEAPVP TNMSTAADLL RQGAACSVLY LTSVETESLT GPQAVARASS
1310 1320 1330 1340 1350
AALSCSPRPT PAVVHFKVSA QGITLTDNQR KLFFRRHYPV NSITFSSTDP
1360 1370 1380 1390 1400
QDRRWTNPDG TTSKIFGFVA KKPGSPWENV CHLFAELDPD QPAGAIVTFI

TKVLLGQRK
Length:1,409
Mass (Da):152,580
Last modified:June 26, 2007 - v2
Checksum:i67824299A1382140
GO
Isoform 2 (identifier: Q63HR2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     776-872: Missing.

Show »
Length:1,312
Mass (Da):142,685
Checksum:iBD63FB8C01E97D9A
GO
Isoform 4 (identifier: Q63HR2-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-25: MKSSGPVERLLRALGRRDSSRAASR → MDGGGVCVGRGDLLSSPQALGQLLRKESRPRRAMK

Show »
Length:1,419
Mass (Da):153,564
Checksum:i7F26C74F3E88A801
GO
Isoform 5 (identifier: Q63HR2-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-124: Missing.

Show »
Length:1,285
Mass (Da):138,828
Checksum:iF52B6ED198BEE396
GO
Isoform 6 (identifier: Q63HR2-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1273-1274: Missing.

Show »
Length:1,407
Mass (Da):152,452
Checksum:iC19BCA8F1535E663
GO

Sequence cautioni

The sequence AAI29829.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence AAI29830.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence AAI31504.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence BAA83027.2 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence CAH56176.1 differs from that shown.Intron retention.Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti702 – 7021A → V in AAH54099 (PubMed:15489334).Curated
Sequence conflicti898 – 8981P → Q in AAH54099 (PubMed:15489334).Curated
Sequence conflicti1036 – 10361P → L in CAB70815 (PubMed:17974005).Curated
Sequence conflicti1083 – 10831G → E in AAI29830 (PubMed:15489334).Curated
Sequence conflicti1119 – 11191P → S in AAH54099 (PubMed:15489334).Curated
Sequence conflicti1148 – 11481D → G in AAH54099 (PubMed:15489334).Curated
Sequence conflicti1236 – 12361P → L in CAH56176 (PubMed:17974005).Curated
Sequence conflicti1246 – 12461P → L in AAM74225 (PubMed:12470648).Curated
Sequence conflicti1246 – 12461P → L in AAN03866 (PubMed:12470648).Curated
Sequence conflicti1246 – 12461P → L in AAL14641 (PubMed:11792844).Curated
Sequence conflicti1246 – 12461P → L in BAA83027 (PubMed:10470851).Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti353 – 3531S → T.
Corresponds to variant rs11170389 [ dbSNP | Ensembl ].
VAR_033043
Natural varianti670 – 6701A → T.
Corresponds to variant rs11558984 [ dbSNP | Ensembl ].
VAR_052547

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 124124Missing in isoform 5. 2 PublicationsVSP_026457Add
BLAST
Alternative sequencei1 – 2525MKSSG…RAASR → MDGGGVCVGRGDLLSSPQAL GQLLRKESRPRRAMK in isoform 4. 1 PublicationVSP_026458Add
BLAST
Alternative sequencei776 – 87297Missing in isoform 2. 1 PublicationVSP_026460Add
BLAST
Alternative sequencei1273 – 12742Missing in isoform 6. 1 PublicationVSP_026461

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF518729 mRNA. Translation: AAM74225.1.
AF518728 mRNA. Translation: AAN03866.1.
AF417490 mRNA. Translation: AAL14641.1.
AB028998 mRNA. Translation: BAA83027.2. Different initiation.
AL137564 mRNA. Translation: CAB70815.1.
BX647126 mRNA. Translation: CAH56176.1. Sequence problems.
BC054099 mRNA. Translation: AAH54099.1.
BC110854 mRNA. Translation: AAI10855.1.
BC129828 mRNA. Translation: AAI29829.1. Different initiation.
BC129829 mRNA. Translation: AAI29830.1. Different initiation.
BC131503 mRNA. Translation: AAI31504.1. Different initiation.
BC142668 mRNA. Translation: AAI42669.1.
BC142712 mRNA. Translation: AAI42713.1.
CCDSiCCDS8842.1. [Q63HR2-4]
CCDS8843.1. [Q63HR2-1]
CCDS8844.1. [Q63HR2-5]
PIRiT46500.
RefSeqiNP_056134.2. NM_015319.2. [Q63HR2-4]
NP_736610.2. NM_170754.2. [Q63HR2-1]
NP_938072.1. NM_198316.1. [Q63HR2-5]
UniGeneiHs.343334.
Hs.6147.

Genome annotation databases

EnsembliENST00000314250; ENSP00000319684; ENSG00000111077. [Q63HR2-1]
ENST00000314276; ENSP00000319756; ENSG00000111077. [Q63HR2-4]
ENST00000379902; ENSP00000369232; ENSG00000111077. [Q63HR2-5]
ENST00000546602; ENSP00000449363; ENSG00000111077. [Q63HR2-2]
ENST00000552570; ENSP00000447021; ENSG00000111077. [Q63HR2-6]
GeneIDi23371.
KEGGihsa:23371.
UCSCiuc001sbl.3. human. [Q63HR2-1]
uc001sbn.3. human. [Q63HR2-4]
uc001sbq.3. human. [Q63HR2-2]
uc009zmr.3. human. [Q63HR2-6]

Polymorphism and mutation databases

BioMutaiTENC1.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF518729 mRNA. Translation: AAM74225.1.
AF518728 mRNA. Translation: AAN03866.1.
AF417490 mRNA. Translation: AAL14641.1.
AB028998 mRNA. Translation: BAA83027.2. Different initiation.
AL137564 mRNA. Translation: CAB70815.1.
BX647126 mRNA. Translation: CAH56176.1. Sequence problems.
BC054099 mRNA. Translation: AAH54099.1.
BC110854 mRNA. Translation: AAI10855.1.
BC129828 mRNA. Translation: AAI29829.1. Different initiation.
BC129829 mRNA. Translation: AAI29830.1. Different initiation.
BC131503 mRNA. Translation: AAI31504.1. Different initiation.
BC142668 mRNA. Translation: AAI42669.1.
BC142712 mRNA. Translation: AAI42713.1.
CCDSiCCDS8842.1. [Q63HR2-4]
CCDS8843.1. [Q63HR2-1]
CCDS8844.1. [Q63HR2-5]
PIRiT46500.
RefSeqiNP_056134.2. NM_015319.2. [Q63HR2-4]
NP_736610.2. NM_170754.2. [Q63HR2-1]
NP_938072.1. NM_198316.1. [Q63HR2-5]
UniGeneiHs.343334.
Hs.6147.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
2DKQNMR-A1263-1409[»]
2KNONMR-A1135-1249[»]
2L6KNMR-A1135-1248[»]
2LOZNMR-A1263-1409[»]
3HQCX-ray1.80A1264-1409[»]
ProteinModelPortaliQ63HR2.
SMRiQ63HR2. Positions 126-467, 1135-1249, 1263-1409.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi116951. 28 interactions.
IntActiQ63HR2. 25 interactions.
MINTiMINT-2870924.

PTM databases

DEPODiQ63HR2.
PhosphoSiteiQ63HR2.

Polymorphism and mutation databases

BioMutaiTENC1.
DMDMi150416153.

Proteomic databases

MaxQBiQ63HR2.
PaxDbiQ63HR2.
PRIDEiQ63HR2.

Protocols and materials databases

DNASUi23371.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000314250; ENSP00000319684; ENSG00000111077. [Q63HR2-1]
ENST00000314276; ENSP00000319756; ENSG00000111077. [Q63HR2-4]
ENST00000379902; ENSP00000369232; ENSG00000111077. [Q63HR2-5]
ENST00000546602; ENSP00000449363; ENSG00000111077. [Q63HR2-2]
ENST00000552570; ENSP00000447021; ENSG00000111077. [Q63HR2-6]
GeneIDi23371.
KEGGihsa:23371.
UCSCiuc001sbl.3. human. [Q63HR2-1]
uc001sbn.3. human. [Q63HR2-4]
uc001sbq.3. human. [Q63HR2-2]
uc009zmr.3. human. [Q63HR2-6]

Organism-specific databases

CTDi23371.
GeneCardsiGC12P053440.
HGNCiHGNC:19737. TNS2.
HPAiHPA034659.
MIMi607717. gene.
neXtProtiNX_Q63HR2.
PharmGKBiPA134976096.
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiCOG2453.
GeneTreeiENSGT00760000119113.
HOVERGENiHBG108559.
InParanoidiQ63HR2.
KOiK18080.
OMAiRQGYREP.
OrthoDBiEOG7ZPNJ6.
PhylomeDBiQ63HR2.
TreeFamiTF315996.

Enzyme and pathway databases

SignaLinkiQ63HR2.

Miscellaneous databases

ChiTaRSiTENC1. human.
EvolutionaryTraceiQ63HR2.
GeneWikiiTENC1.
GenomeRNAii23371.
NextBioi45448.
PROiQ63HR2.
SOURCEiSearch...

Gene expression databases

BgeeiQ63HR2.
ExpressionAtlasiQ63HR2. baseline and differential.
GenevestigatoriQ63HR2.

Family and domain databases

Gene3Di2.30.29.30. 1 hit.
3.30.505.10. 1 hit.
3.90.190.10. 1 hit.
InterProiIPR000008. C2_dom.
IPR002219. PE/DAG-bd.
IPR011993. PH_like_dom.
IPR029021. Prot-tyrosine_phosphatase-like.
IPR013625. PTB.
IPR006020. PTB/PI_dom.
IPR000980. SH2.
IPR014020. Tensin_C2-dom.
IPR029023. Tensin_lipid_phosphatase_dom.
[Graphical view]
PfamiPF08416. PTB. 1 hit.
PF10409. PTEN_C2. 1 hit.
PF00017. SH2. 1 hit.
[Graphical view]
SMARTiSM00109. C1. 1 hit.
SM00462. PTB. 1 hit.
SM00252. SH2. 1 hit.
[Graphical view]
SUPFAMiSSF49562. SSF49562. 1 hit.
SSF52799. SSF52799. 1 hit.
SSF55550. SSF55550. 1 hit.
PROSITEiPS51182. C2_TENSIN. 1 hit.
PS51181. PPASE_TENSIN. 1 hit.
PS50001. SH2. 1 hit.
PS00479. ZF_DAG_PE_1. 1 hit.
PS50081. ZF_DAG_PE_2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Interaction of Axl receptor tyrosine kinase with C1-TEN, a novel C1 domain-containing protein with homology to tensin."
    Hafizi S., Alindri F., Karlsson R., Dahlbaeck B.
    Biochem. Biophys. Res. Commun. 299:793-800(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 4), INTERACTION WITH AXL, TISSUE SPECIFICITY.
    Tissue: Kidney.
  2. "Tensin1 and a previously undocumented family member, tensin2, positively regulate cell migration."
    Chen H., Duncan I.C., Bozorgchami H., Lo S.H.
    Proc. Natl. Acad. Sci. U.S.A. 99:733-738(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 5), SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
  3. "Prediction of the coding sequences of unidentified human genes. XIV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
    Kikuno R., Nagase T., Ishikawa K., Hirosawa M., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O.
    DNA Res. 6:197-205(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Brain.
  4. "Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones."
    Nakajima D., Okazaki N., Yamakawa H., Kikuno R., Ohara O., Nagase T.
    DNA Res. 9:99-106(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: SEQUENCE REVISION.
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 759-1409 (ISOFORM 6).
    Tissue: Colon endothelium and Testis.
  6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 5), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 364-1398 (ISOFORM 2).
    Tissue: Brain and Uterus.
  7. "C1-TEN is a negative regulator of the Akt/PKB signal transduction pathway and inhibits cell survival, proliferation, and migration."
    Hafizi S., Ibraimi F., Dahlbaeck B.
    FASEB J. 19:971-973(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, MUTAGENESIS OF CYS-231.
  8. "The protein-tyrosine kinase Syk interacts with the C-terminal region of tensin2."
    Moon K.D., Zhang X., Zhou Q., Geahlen R.L.
    Biochim. Biophys. Acta 1823:199-205(2012) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH SYK, SUBCELLULAR LOCATION.
  9. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  10. "An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome."
    Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H.
    J. Proteomics 96:253-262(2014) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-91; SER-120; SER-455; TYR-456; SER-466; THR-474; SER-820; SER-825; SER-830; SER-832; SER-845; SER-931; SER-941; SER-972; THR-977; SER-991; SER-1003; THR-1182 AND SER-1247, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Liver.
  11. "Solution structure of the PTB domain of KIAA1075 protein from human."
    RIKEN structural genomics initiative (RSGI)
    Submitted (OCT-2006) to the PDB data bank
    Cited for: STRUCTURE BY NMR OF 1263-1409.

Entry informationi

Entry nameiTNS2_HUMAN
AccessioniPrimary (citable) accession number: Q63HR2
Secondary accession number(s): A2VDF2
, A2VDF3, A2VDI8, A5PKY4, Q2NL80, Q76MW6, Q7Z5T9, Q8NFF9, Q8NFG0, Q96P25, Q9NT29, Q9UPS7
Entry historyi
Integrated into UniProtKB/Swiss-Prot: June 26, 2007
Last sequence update: June 26, 2007
Last modified: April 29, 2015
This is version 100 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.