Q63HN8 (RN213_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 89.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: E3 ubiquitin-protein ligase RNF213 EC=6.3.2.- Alternative name(s): ALK lymphoma oligomerization partner on chromosome 17 Mysterin RING finger protein 213 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 5207 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Probable E3 ubiquitin-protein ligase that may play a role in angiogenesis. May also have an ATPase activity. |
| Pathway | |
| Subcellular location | |
| Tissue specificity | Widely expressed (at protein level). Ref.1 |
| Domain | The RING-type zinc finger domain is required for the ubiquitin-protein ligase activity. |
| Post-translational modification | Autoubiquitinates. |
| Involvement in disease | Moyamoya disease 2 (MYMY2) [MIM:607151]: A progressive cerebral angiopathy characterized by bilateral intracranial carotid artery stenosis and telangiectatic vessels in the region of the basal ganglia. The abnormal vessels resemble a 'puff of smoke' (moyamoya) on cerebral angiogram. Affected individuals can develop transient ischemic attacks and/or cerebral infarction, and rupture of the collateral vessels can cause intracranial hemorrhage. Hemiplegia of sudden onset and epileptic seizures constitute the prevailing presentation in childhood, while subarachnoid bleeding occurs more frequently in adults. A chromosomal aberration involving ALO17 is associated with anaplastic large-cell lymphoma (ALCL). Translocation t(2;17)(p23;q25) with ALK. |
| Sequence similarities | Contains 1 RING-type zinc finger. |
| Sequence caution | The sequence AAH32220.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended. The sequence BAB13444.1 differs from that shown. Reason: Probable cloning artifact. The sequence BAB14708.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended. The sequence BAB15212.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended. The sequence BAB15280.1 differs from that shown. Reason: Erroneous termination at position 4257. Translated as Gln. The sequence BAB15330.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended. The sequence CAH10615.1 differs from that shown. Reason: Frameshift at positions 211, 213, 221 and 266. The sequence CAH56189.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Ubl conjugation pathway |
| Cellular component | Cytoplasm |
| Coding sequence diversity | Alternative splicing Chromosomal rearrangement |
| Disease | Disease mutation Proto-oncogene |
| Domain | Coiled coil Zinc-finger |
| Ligand | Metal-binding Zinc |
| Molecular function | Ligase |
| PTM | Phosphoprotein Ubl conjugation |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | protein autoubiquitination Inferred from direct assay Ref.1. Source: UniProtKB |
| Cellular_component | cytoplasm Inferred from direct assay Ref.1. Source: UniProtKB |
| Molecular_function | ATPase activity Inferred from direct assay Ref.1. Source: UniProtKB nucleotide bindingInferred from electronic annotation. Source: InterPro ubiquitin-protein ligase activityInferred from direct assay Ref.1. Source: UniProtKB zinc ion bindingInferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q63HN8-3) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Note: Major isoform detected in all tissues examined. | ||||||
| Isoform 2 (identifier: Q63HN8-4) The sequence of this isoform differs from the canonical sequence as follows: 87-87: E → EGATSEVLVDAAVDLISDEWEAANAIPSKRRKQDAAPLEAASVPSADCEQ | ||||||
| Note: Minor isoform with restricted expression. Gene prediction based on partial EST data. | ||||||
| Isoform 3 (identifier: Q63HN8-5) The sequence of this isoform differs from the canonical sequence as follows: 1009-1063: SQTSILQGFS...LADVKHVFRL → VNNLSSWETD...SLAKGNGAEI 1064-5207: Missing. | ||||||
| Isoform 4 (identifier: Q63HN8-6) The sequence of this isoform differs from the canonical sequence as follows: 1-4650: Missing. 4651-4660: QEQHQLSSRR → MTRKSAPTSG | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 5207 | 5207 | E3 ubiquitin-protein ligase RNF213 | PRO_0000415917 | |||||
Regions | |||||||||
| Zinc finger | 3997 – 4036 | 40 | RING-type | ||||||
| Coiled coil | 343 – 374 | 32 | Potential | ||||||
Amino acid modifications | |||||||||
| Modified residue | 217 | 1 | Phosphoserine Ref.13 | ||||||
| Modified residue | 1258 | 1 | Phosphoserine Ref.8 Ref.9 Ref.10 Ref.11 Ref.12 Ref.13 Ref.15 | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 4650 | 4650 | Missing in isoform 4. | VSP_042416 | |||||
| Alternative sequence | 87 | 1 | E → EGATSEVLVDAAVDLISDEW EAANAIPSKRRKQDAAPLEA ASVPSADCEQ in isoform 2. | VSP_042417 | |||||
| Alternative sequence | 1009 – 1063 | 55 | SQTSI…HVFRL → VNNLSSWETDSGSQLCSAMT QLRAMKHPLGLSSSANSEIG KWAPSSLAKGNGAEI in isoform 3. | VSP_042418 | |||||
| Alternative sequence | 1064 – 5207 | 4144 | Missing in isoform 3. | VSP_042419 | |||||
| Alternative sequence | 4651 – 4660 | 10 | QEQHQLSSRR → MTRKSAPTSG in isoform 4. | VSP_042420 | |||||
| Natural variant | 2554 | 1 | D → E. Ref.16 | VAR_067020 | |||||
| Natural variant | 3891 | 1 | M → V Rare variant detected in a sporadic case of Moyamoya disease. Ref.16 | VAR_067021 | |||||
| Natural variant | 3915 | 1 | E → G. Ref.16 | VAR_067022 | |||||
| Natural variant | 3962 | 1 | N → D Variant detected in cases of Moyamoya disease in Caucasian populations. Ref.1 | VAR_067023 | |||||
| Natural variant | 4013 | 1 | D → N Variant detected in cases of Moyamoya disease in Caucasian populations. Ref.1 | VAR_067024 | |||||
| Natural variant | 4062 | 1 | R → Q Variant detected in cases of Moyamoya disease in Caucasian populations. Ref.1 | VAR_067025 | |||||
| Natural variant | 4399 | 1 | A → T. Ref.16 | VAR_067026 | |||||
| Natural variant | 4567 | 1 | V → M Rare variant detected in a sporadic case of Moyamoya disease. Ref.16 | VAR_067027 | |||||
| Natural variant | 4608 | 1 | P → S Variant detected in cases of Moyamoya disease in Caucasian populations. Ref.1 | VAR_067028 | |||||
| Natural variant | 4765 | 1 | V → M Rare variant detected in a sporadic case of Moyamoya disease. Ref.16 | VAR_067029 | |||||
| Natural variant | 4810 | 1 | R → K in MYMY2; very frequent in individuals affected by Moyamoya disease; strongly increases the risk of Moyamoya disease. Ref.1 Ref.16 | VAR_067030 | |||||
| Natural variant | 4863 | 1 | D → N Variant detected in cases of Moyamoya disease in East Asian populations. Ref.1 | VAR_067031 | |||||
| Natural variant | 4950 | 1 | E → D Variant detected in cases of Moyamoya disease in East Asian populations. Ref.1 | VAR_067032 | |||||
| Natural variant | 5021 | 1 | A → V Variant detected in cases of Moyamoya disease in East Asian populations. Ref.1 | VAR_067033 | |||||
| Natural variant | 5160 | 1 | D → E Variant detected in cases of Moyamoya disease in East Asian populations. Ref.1 | VAR_067034 | |||||
| Natural variant | 5176 | 1 | E → G Variant detected in cases of Moyamoya disease in East Asian populations. Ref.1 | VAR_067035 | |||||
Experimental info | |||||||||
| Sequence conflict | 270 | 1 | M → T in AAH36891. Ref.4 | ||||||
| Sequence conflict | 270 | 1 | M → T in AAH40341. Ref.4 | ||||||
| Sequence conflict | 321 | 1 | M → T in AAH36891. Ref.4 | ||||||
| Sequence conflict | 321 | 1 | M → T in AAH40341. Ref.4 | ||||||
| Sequence conflict | 369 | 1 | K → N in AAH36891. Ref.4 | ||||||
| Sequence conflict | 1045 | 1 | N → D in BAK53191. Ref.1 | ||||||
| Sequence conflict | 1045 | 1 | N → D in BAB13444. Ref.6 | ||||||
| Sequence conflict | 1133 | 1 | Q → K in BAB13444. Ref.6 | ||||||
| Sequence conflict | 1195 | 1 | V → M in BAB13444. Ref.6 | ||||||
| Sequence conflict | 1272 | 1 | E → Q in BAB13444. Ref.6 | ||||||
| Sequence conflict | 1331 | 1 | D → G in BAB13444. Ref.6 | ||||||
| Sequence conflict | 3323 | 1 | R → G in CAH56189. Ref.2 | ||||||
| Sequence conflict | 4220 | 1 | E → G in BAB15212. Ref.7 | ||||||
| Sequence conflict | 4571 | 1 | D → G in BAB15280. Ref.7 | ||||||
| Sequence conflict | 4853 | 1 | K → R in BAB15212. Ref.7 | ||||||
| Sequence conflict | 4892 | 1 | N → S in BAB15212. Ref.7 | ||||||
| Sequence conflict | 5139 | 1 | L → S in BAB15280. Ref.7 | ||||||
| Sequence conflict | 5187 | 1 | L → P in BAB15330. Ref.7 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Identification of RNF213 as a susceptibility gene for moyamoya disease and its possible role in vascular development." Liu W., Morito D., Takashima S., Mineharu Y., Kobayashi H., Hitomi T., Hashikata H., Matsuura N., Yamazaki S., Toyoda A., Kikuta K., Takagi Y., Harada K.H., Fujiyama A., Herzig R., Krischek B., Zou L., Kim J.E. Koizumi A.PLoS ONE 6:E22542-E22542(2011) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), CATALYTIC ACTIVITY, AUTOUBIQUITINATION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY, VARIANTS ASP-3962; ASN-4013; GLN-4062; SER-4608; ASN-4863; ASP-4950; VAL-5021; GLU-5160 AND GLY-5176, VARIANT MYMY2 LYS-4810. |
| [2] | "The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 3021-5207 (ISOFORMS 1/2). Tissue: Endometrium, Lymph node, Melanoma and Uterus. |
| [3] | "DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage." Zody M.C., Garber M., Adams D.J., Sharpe T., Harrow J., Lupski J.R., Nicholson C., Searle S.M., Wilming L., Young S.K., Abouelleil A., Allen N.R., Bi W., Bloom T., Borowsky M.L., Bugalter B.E., Butler J., Chang J.L. Nusbaum C.Nature 440:1045-1049(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3 AND 4). Tissue: Eye and Lung. |
| [5] | "Identification of novel fusion partners of ALK, the anaplastic lymphoma kinase, in anaplastic large-cell lymphoma and inflammatory myofibroblastic tumor." Cools J., Wlodarska I., Somers R., Mentens N., Pedeutour F., Maes B., De Wolf-Peeters C., Pauwels P., Hagemeijer A., Marynen P. Genes Chromosomes Cancer 34:354-362(2002) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-163 (ISOFORMS 1 AND 2/3), CHROMOSOMAL TRANSLOCATION WITH ALK. |
| [6] | "Prediction of the coding sequences of unidentified human genes. XVIII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro." Nagase T., Kikuno R., Nakayama M., Hirosawa M., Ohara O. DNA Res. 7:273-281(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 136-1509 AND 3888-5207 (ISOFORMS 1/2). Tissue: Brain. |
| [7] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 3770-5207 (ISOFORMS 1/2). Tissue: Spleen and Thyroid. |
| [8] | "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle." Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M. Mol. Cell 31:438-448(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1258, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [9] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1258, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [10] | "Large-scale phosphoproteome analysis of human liver tissue by enrichment and fractionation of phosphopeptides with strong anion exchange chromatography." Han G., Ye M., Zhou H., Jiang X., Feng S., Jiang X., Tian R., Wan D., Zou H., Gu J. Proteomics 8:1346-1361(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1258, MASS SPECTROMETRY. Tissue: Liver. |
| [11] | "Large-scale proteomics analysis of the human kinome." Oppermann F.S., Gnad F., Olsen J.V., Hornberger R., Greff Z., Keri G., Mann M., Daub H. Mol. Cell. Proteomics 8:1751-1764(2009) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1258, MASS SPECTROMETRY. |
| [12] | "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions." Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K. Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1258, MASS SPECTROMETRY. Tissue: Leukemic T-cell. |
| [13] | "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis." Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M. Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-217 AND SER-1258, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [14] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [15] | "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation." Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B. Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1258, MASS SPECTROMETRY. |
| [16] | "A genome-wide association study identifies RNF213 as the first Moyamoya disease gene." Kamada F., Aoki Y., Narisawa A., Abe Y., Komatsuzaki S., Kikuchi A., Kanno J., Niihori T., Ono M., Ishii N., Owada Y., Fujimura M., Mashimo Y., Suzuki Y., Hata A., Tsuchiya S., Tominaga T., Matsubara Y., Kure S. J. Hum. Genet. 56:34-40(2011) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS GLU-2554; VAL-3891; GLY-3915; THR-4399; MET-4567 AND MET-4765, VARIANT MYMY2 LYS-4810. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AB537889 mRNA. Translation: BAK53191.1. AL832920 mRNA. Translation: CAH10615.1. Frameshift. AL833201 mRNA. Translation: CAH56308.1. BX640932 mRNA. Translation: CAE45967.1. BX647946 mRNA. Translation: CAH56189.1. Different initiation. AC123764 Genomic DNA. No translation available. AC124319 Genomic DNA. No translation available. BC032220 mRNA. Translation: AAH32220.1. Different initiation. BC036891 mRNA. Translation: AAH36891.1. BC040341 mRNA. Translation: AAH40341.1. AF397204 mRNA. Translation: AAN63520.1. AF397205 mRNA. Translation: AAN63521.1. AB046774 mRNA. Translation: BAB13380.1. AB046838 mRNA. Translation: BAB13444.1. Sequence problems. AK023871 mRNA. Translation: BAB14708.1. Different initiation. AK025676 mRNA. Translation: BAB15212.1. Different initiation. AK025914 mRNA. Translation: BAB15280.1. Sequence problems. AK026038 mRNA. Translation: BAB15330.1. Different initiation. AK074030 mRNA. Translation: BAB84856.1. |
| IPI | IPI00217287. IPI00642126. IPI00828098. |
| RefSeq | NP_001243000.1. NM_001256071.1. NP_066005.2. NM_020954.3. |
| UniGene | Hs.195642. Hs.740662. Hs.741236. |
3D structure databases | |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q63HN8. 3 interactions. |
PTM databases | |
| PhosphoSite | Q63HN8. |
Polymorphism databases | |
| DMDM | 116242975. |
Proteomic databases | |
| PaxDb | Q63HN8. |
| PRIDE | Q63HN8. |
Protocols and materials databases | |
| DNASU | 57674. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000319921; ENSP00000324392; ENSG00000173821. ENST00000508628; ENSP00000425956; ENSG00000173821. ENST00000582970; ENSP00000464087; ENSG00000173821. |
| GeneID | 57674. |
| KEGG | hsa:57674. |
Organism-specific databases | |
| CTD | 57674. |
| GeneCards | GC17P078235. |
| H-InvDB | HIX0014240. |
| HGNC | HGNC:14539. RNF213. |
| HPA | HPA003347. HPA026790. |
| MIM | 607151. phenotype. 613768. gene. |
| neXtProt | NX_Q63HN8. |
| Orphanet | 2573. Moyamoya disease. |
| PharmGKB | PA134898812. PA162401681. |
| HUGE | Search... Search... |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG86922. |
| HOGENOM | HOG000185147. |
| HOVERGEN | HBG073493. |
| InParanoid | Q9HCF4. |
| OMA | GMEFVQG. |
Enzyme and pathway databases | |
| UniPathway | UPA00143. |
Gene expression databases | |
| ArrayExpress | Q63HN8. |
| Bgee | Q63HN8. |
| CleanEx | HS_KIAA1618. |
| Genevestigator | Q9HCF4. |
| GermOnline | ENSG00000180843. Homo sapiens. |
Family and domain databases | |
| Gene3D | 3.30.40.10. 1 hit. |
| InterPro | IPR003593. AAA+_ATPase. IPR018957. Znf_C3HC4_RING-type. IPR001841. Znf_RING. IPR013083. Znf_RING/FYVE/PHD. [Graphical view] |
| Pfam | PF00097. zf-C3HC4. 1 hit. [Graphical view] |
| SMART | SM00382. AAA. 2 hits. SM00184. RING. 1 hit. [Graphical view] |
| PROSITE | PS00518. ZF_RING_1. False negative. PS50089. ZF_RING_2. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | RNF213. human. |
| GenomeRNAi | 57674. |
| NextBio | 64478. |
| PMAP-CutDB | Q9HCF4. |
| SOURCE | Search... |
Entry information
| Entry name | RN213_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q63HN8 Secondary accession number(s): C9JCP4 Q9HCL8 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 17 Human chromosome 17: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PATHWAY comments Index of metabolic and biosynthesis pathways |
| SIMILARITY comments Index of protein domains and families |

Clusters with
