Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Myosin-11

Gene

Myh11

Organism
Rattus norvegicus (Rat)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

Muscle contraction.Curated

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Nucleotide bindingi34 – 418ATPBy similarity

GO - Molecular functioni

  • ATP binding Source: UniProtKB-KW
  • motor activity Source: InterPro
  • structural constituent of muscle Source: UniProtKB
Complete GO annotation...

Keywords - Molecular functioni

Motor protein, Muscle protein, Myosin

Keywords - Ligandi

Actin-binding, ATP-binding, Calmodulin-binding, Nucleotide-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Myosin-11
Alternative name(s):
Myosin heavy chain 11
Myosin heavy chain, smooth muscle isoform
SMMHC
Gene namesi
Name:Myh11Imported
OrganismiRattus norvegicus (Rat)
Taxonomic identifieri10116 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeRattus
Proteomesi
  • UP000002494 Componenti: Unplaced

Organism-specific databases

RGDi3136. Myh11.

Subcellular locationi

GO - Cellular componenti

  • melanosome Source: UniProtKB-SubCell
  • muscle myosin complex Source: UniProtKB
  • myofibril Source: UniProtKB-SubCell
  • myosin filament Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Thick filament

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini‹1 – 1327›1327Myosin-11PRO_0000123428Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei1039 – 10391PhosphoserineCombined sources
Modified residuei1077 – 10771PhosphoserineCombined sources
Modified residuei1306 – 13061PhosphothreonineCombined sources
Modified residuei1309 – 13091PhosphoserineCombined sources
Modified residuei1326 – 13261PhosphoserineBy similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiQ63862.
PRIDEiQ63862.

PTM databases

iPTMnetiQ63862.

Expressioni

Tissue specificityi

Both isoform 1 and isoform 2 are detected in small and large intestine, uterus, bladder, aorta, stomach, and at much lower levels in lung. All three isoforms are coexpressed in smooth muscle. Isoform 2 predominates in most of the smooth muscles tested, with the exception of intestine and urinary bladder, which show greater expression of isoform 1.2 Publications

Interactioni

Subunit structurei

Muscle myosin is a hexameric protein that consists of 2 heavy chain subunits (MHC), 2 alkali light chain subunits (MLC) and 2 regulatory light chain subunits (MLC-2).Curated

Protein-protein interaction databases

IntActiQ63862. 1 interaction.
STRINGi10116.ENSRNOP00000043197.

Structurei

3D structure databases

ProteinModelPortaliQ63862.
SMRiQ63862. Positions 1-676.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini‹1 – 646›646Myosin motorAdd
BLAST
Domaini649 – 67830IQPROSITE-ProRule annotationAdd
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni524 – 54623Actin-bindingBy similarityAdd
BLAST
Regioni625 – 63915Actin-bindingBy similarityAdd
BLAST
Regioni1290 – 132738C-terminalAdd
BLAST

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili707 – 1289583Sequence analysisAdd
BLAST

Domaini

The rodlike tail sequence is highly repetitive, showing cycles of a 28-residue repeat pattern composed of 4 heptapeptides, characteristic for alpha-helical coiled coils.Curated
Limited proteolysis of myosin heavy chain produces 1 light meromyosin (LMM) and 1 heavy meromyosin (HMM). HMM can be further cleaved into 2 globular subfragments (S1) and 1 rod-shaped subfragment (S2).Curated

Sequence similaritiesi

Contains 1 IQ domain.PROSITE-ProRule annotation
Contains 1 myosin motor domain.Curated

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiKOG0161. Eukaryota.
COG5022. LUCA.
HOGENOMiHOG000173958.
HOVERGENiHBG004704.
InParanoidiQ63862.
PhylomeDBiQ63862.

Family and domain databases

Gene3Di4.10.270.10. 1 hit.
InterProiIPR000048. IQ_motif_EF-hand-BS.
IPR027401. Myosin-like_IQ_dom.
IPR001609. Myosin_head_motor_dom.
IPR002928. Myosin_tail.
IPR027417. P-loop_NTPase.
[Graphical view]
PfamiPF00063. Myosin_head. 1 hit.
PF01576. Myosin_tail_1. 1 hit.
[Graphical view]
PRINTSiPR00193. MYOSINHEAVY.
SMARTiSM00242. MYSc. 1 hit.
[Graphical view]
SUPFAMiSSF52540. SSF52540. 1 hit.
PROSITEiPS50096. IQ. 1 hit.
PS51456. MYOSIN_MOTOR. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Fragments.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 11 Publication (identifier: Q63862-1) [UniParc]FASTAAdd to basket
Also known as: SM1B1 Publication

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
KKRHEMPPHI YAIADTAYRS MLQDREDQSI LCTGESGAGK TENTKKVIQY
60 70 80 90 100
LAVVASSHKG KKDSSITQGP SFAYGELEKQ LLQANPILEA FGNAKTVKND
110 120 130 140 150
NSSRFGKFIR INFDVTGYIV GANIETYLLE KSRAIRHARD ERTFHIFYYL
160 170 180 190 200
IAGAKEKMRN DLLLESFNSY TFLSNGFVPI PAAQDDEMFQ ETLEAMSIMG
210 220 230 240 250
FSEEEQLAIL KVVSSVLQLG NIVFKKERNT DQASMPDNTA AQKVCHLVGI
260 270 280 290 300
NVTDFTRAIL TPRIKVGRDV VQKAQTKEQA DFAIEALAKA TYERLFRWIL
310 320 330 340 350
SRVNKALDKT HRQGASFLGI LDIAGFEIFE VNSFEQLCIN YTNEKLQQLF
360 370 380 390 400
NHTMFILEQE EYQREGIEWN FIDFGLDLQP CIELIERPNN PPGVLALLDE
410 420 430 440 450
ECWFPKATDK SFVEKLCSEQ GNHPKFQKPK QLKDKTEFSI IHYAGKVDYN
460 470 480 490 500
ASAWLTKNMD PLNDNVTSLL NASSDKFVAD LWKDVDRIVG LDQMAKMTES
510 520 530 540 550
SLPSASKTKK GMFRTVGQLY KEQLGKLMTT LRNTTPNFVR CIIPNHEKRS
560 570 580 590 600
GKLDAFLVLE QLRCNGVLEG IRICRQGFPN RIVFQEFRQR YEILAANAIP
610 620 630 640 650
KGFMDGKQAC ILMIKALELD PNLYRIGQSK IFFRTGVLAH LEEERDLKIT
660 670 680 690 700
DVIMAFQAMC RGYLARKAFT KRQQQLTASK VIQRNCAAYL KLRNWQWWRL
710 720 730 740 750
FTKVKPLDEE MEAKQNLERH VSTLNIQLSD SKKKLQDLAS TIEVMEEGKK
760 770 780 790 800
RLQKEMEGLG QQYEEKAAAY DKLEKTKNRL QQELDDLVVD LDNQRQLVSN
810 820 830 840 850
LEKKQKKFDQ LLAEEKNISS KYADERDRAE AEAREKETKA LSLARALEEA
860 870 880 890 900
LEAKEELERT NKMLKAEMED LVSSKDDVGK NVHELEKSKR ALETQMEEMR
910 920 930 940 950
TQLEELEDEL QATEDAKLRL EVNMQALKGQ FERDLQARDE QNEEKRRQLQ
960 970 980 990 1000
RQLHEYETEL EDERKQRALA AAAKKKLEGD LKDLELQADS AVKGREEAIK
1010 1020 1030 1040 1050
QLRKLQAQMK DFQRELDDAR ASRDEIFATS KENEKKAKSL EAELMQLQED
1060 1070 1080 1090 1100
LAAAERARKQ ADLEKEELAE ELASSLSGRN TLQDEKRRLE ARIAQLEEEL
1110 1120 1130 1140 1150
EEEQGNMEAM SDRVRKATLQ AEQLSNELVT ERSAAQKNES ARQQLERQNK
1160 1170 1180 1190 1200
ELRSKLQEVE GAVKAKLKST VAALEAKIVQ LEEQIEQEAR EKQAATKLLK
1210 1220 1230 1240 1250
QKDKKLKEVL LQVEDERKMV EQYKEQAEKG NTKVKQLKRQ LEEAEEESQR
1260 1270 1280 1290 1300
INANRRKLQR ELDEATESNE AMGREVNALK SKLRRGNEAS FVPSRRAGGR
1310 1320
RVIENTDGSE EEMDARDSDF NGTKASE
Length:1,327
Mass (Da):152,492
Last modified:November 8, 2005 - v3
Checksum:iEE56D86984389F04
GO
Isoform 21 Publication (identifier: Q63862-2) [UniParc]FASTAAdd to basket
Also known as: SM1A1 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     61-67: Missing.

Show »
Length:1,320
Mass (Da):151,732
Checksum:i9B8207E5758FA633
GO
Isoform 31 Publication (identifier: Q63862-3) [UniParc]FASTAAdd to basket
Also known as: SM21 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     1285-1327: RGNEASFVPSRRAGGRRVIENTDGSEEEMDARDSDFNGTKASE → GPPPQETSQ

Show »
Length:1,293
Mass (Da):148,730
Checksum:i4FFC81043153443B
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Non-terminal residuei1 – 11Curated
Non-adjacent residuesi706 – 7072Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei61 – 677Missing in isoform 2. 1 PublicationVSP_050914
Alternative sequencei1285 – 132743RGNEA…TKASE → GPPPQETSQ in isoform 3. 1 PublicationVSP_050915Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY953023 mRNA. Translation: AAX51987.1.
S61948 mRNA. Translation: AAB26775.1.
X16261 mRNA. Translation: CAA34347.1.
X16262 mRNA. Translation: CAA34348.1.
PIRiS07537.
S10450.
UniGeneiRn.94969.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY953023 mRNA. Translation: AAX51987.1.
S61948 mRNA. Translation: AAB26775.1.
X16261 mRNA. Translation: CAA34347.1.
X16262 mRNA. Translation: CAA34348.1.
PIRiS07537.
S10450.
UniGeneiRn.94969.

3D structure databases

ProteinModelPortaliQ63862.
SMRiQ63862. Positions 1-676.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

IntActiQ63862. 1 interaction.
STRINGi10116.ENSRNOP00000043197.

PTM databases

iPTMnetiQ63862.

Proteomic databases

PaxDbiQ63862.
PRIDEiQ63862.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Organism-specific databases

RGDi3136. Myh11.

Phylogenomic databases

eggNOGiKOG0161. Eukaryota.
COG5022. LUCA.
HOGENOMiHOG000173958.
HOVERGENiHBG004704.
InParanoidiQ63862.
PhylomeDBiQ63862.

Family and domain databases

Gene3Di4.10.270.10. 1 hit.
InterProiIPR000048. IQ_motif_EF-hand-BS.
IPR027401. Myosin-like_IQ_dom.
IPR001609. Myosin_head_motor_dom.
IPR002928. Myosin_tail.
IPR027417. P-loop_NTPase.
[Graphical view]
PfamiPF00063. Myosin_head. 1 hit.
PF01576. Myosin_tail_1. 1 hit.
[Graphical view]
PRINTSiPR00193. MYOSINHEAVY.
SMARTiSM00242. MYSc. 1 hit.
[Graphical view]
SUPFAMiSSF52540. SSF52540. 1 hit.
PROSITEiPS50096. IQ. 1 hit.
PS51456. MYOSIN_MOTOR. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiMYH11_RAT
AccessioniPrimary (citable) accession number: Q63862
Secondary accession number(s): Q58GJ0
, Q63338, Q63339, Q63861
Entry historyi
Integrated into UniProtKB/Swiss-Prot: September 13, 2004
Last sequence update: November 8, 2005
Last modified: September 7, 2016
This is version 108 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.