Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Myosin-11

Gene

Myh11

Organism
Rattus norvegicus (Rat)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Muscle contraction.Curated

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Nucleotide bindingi34 – 41ATPBy similarity8

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionActin-binding, Calmodulin-binding, Motor protein, Muscle protein, Myosin
LigandATP-binding, Nucleotide-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Myosin-11
Alternative name(s):
Myosin heavy chain 11
Myosin heavy chain, smooth muscle isoform
SMMHC
Gene namesi
Name:Myh11Imported
OrganismiRattus norvegicus (Rat)
Taxonomic identifieri10116 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeRattus
Proteomesi
  • UP000002494 Componenti: Unplaced

Organism-specific databases

RGDi3136 Myh11

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Thick filament

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_0000123428‹1 – 1327Myosin-11Add BLAST›1327

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei1039PhosphoserineCombined sources1
Modified residuei1077PhosphoserineCombined sources1
Modified residuei1306PhosphothreonineCombined sources1
Modified residuei1309PhosphoserineCombined sources1
Modified residuei1326PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiQ63862
PRIDEiQ63862

PTM databases

iPTMnetiQ63862

Expressioni

Tissue specificityi

Both isoform 1 and isoform 2 are detected in small and large intestine, uterus, bladder, aorta, stomach, and at much lower levels in lung. All three isoforms are coexpressed in smooth muscle. Isoform 2 predominates in most of the smooth muscles tested, with the exception of intestine and urinary bladder, which show greater expression of isoform 1.2 Publications

Interactioni

Subunit structurei

Muscle myosin is a hexameric protein that consists of 2 heavy chain subunits (MHC), 2 alkali light chain subunits (MLC) and 2 regulatory light chain subunits (MLC-2).Curated

GO - Molecular functioni

Protein-protein interaction databases

IntActiQ63862, 1 interactor
STRINGi10116.ENSRNOP00000043197

Structurei

3D structure databases

ProteinModelPortaliQ63862
SMRiQ63862
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini‹1 – 646Myosin motorPROSITE-ProRule annotationAdd BLAST›646
Domaini649 – 678IQPROSITE-ProRule annotationAdd BLAST30

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni524 – 546Actin-bindingBy similarityAdd BLAST23
Regioni625 – 639Actin-bindingBy similarityAdd BLAST15
Regioni1290 – 1327C-terminalAdd BLAST38

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili707 – 1289Sequence analysisAdd BLAST583

Domaini

The rodlike tail sequence is highly repetitive, showing cycles of a 28-residue repeat pattern composed of 4 heptapeptides, characteristic for alpha-helical coiled coils.Curated
Limited proteolysis of myosin heavy chain produces 1 light meromyosin (LMM) and 1 heavy meromyosin (HMM). HMM can be further cleaved into 2 globular subfragments (S1) and 1 rod-shaped subfragment (S2).Curated

Sequence similaritiesi

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiKOG0161 Eukaryota
COG5022 LUCA
HOGENOMiHOG000173958
HOVERGENiHBG004704
InParanoidiQ63862
PhylomeDBiQ63862

Family and domain databases

Gene3Di3.40.850.10, 3 hits
4.10.270.10, 1 hit
InterProiView protein in InterPro
IPR000048 IQ_motif_EF-hand-BS
IPR036961 Kinesin_motor_dom_sf
IPR001609 Myosin_head_motor_dom
IPR027401 Myosin_IQ_contain_sf
IPR002928 Myosin_tail
IPR027417 P-loop_NTPase
PfamiView protein in Pfam
PF00063 Myosin_head, 1 hit
PF01576 Myosin_tail_1, 1 hit
PRINTSiPR00193 MYOSINHEAVY
SMARTiView protein in SMART
SM00242 MYSc, 1 hit
SUPFAMiSSF52540 SSF52540, 1 hit
PROSITEiView protein in PROSITE
PS50096 IQ, 1 hit
PS51456 MYOSIN_MOTOR, 1 hit

Sequences (3)i

Sequence statusi: Fragments.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 11 Publication (identifier: Q63862-1) [UniParc]FASTAAdd to basket
Also known as: SM1B1 Publication

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
KKRHEMPPHI YAIADTAYRS MLQDREDQSI LCTGESGAGK TENTKKVIQY
60 70 80 90 100
LAVVASSHKG KKDSSITQGP SFAYGELEKQ LLQANPILEA FGNAKTVKND
110 120 130 140 150
NSSRFGKFIR INFDVTGYIV GANIETYLLE KSRAIRHARD ERTFHIFYYL
160 170 180 190 200
IAGAKEKMRN DLLLESFNSY TFLSNGFVPI PAAQDDEMFQ ETLEAMSIMG
210 220 230 240 250
FSEEEQLAIL KVVSSVLQLG NIVFKKERNT DQASMPDNTA AQKVCHLVGI
260 270 280 290 300
NVTDFTRAIL TPRIKVGRDV VQKAQTKEQA DFAIEALAKA TYERLFRWIL
310 320 330 340 350
SRVNKALDKT HRQGASFLGI LDIAGFEIFE VNSFEQLCIN YTNEKLQQLF
360 370 380 390 400
NHTMFILEQE EYQREGIEWN FIDFGLDLQP CIELIERPNN PPGVLALLDE
410 420 430 440 450
ECWFPKATDK SFVEKLCSEQ GNHPKFQKPK QLKDKTEFSI IHYAGKVDYN
460 470 480 490 500
ASAWLTKNMD PLNDNVTSLL NASSDKFVAD LWKDVDRIVG LDQMAKMTES
510 520 530 540 550
SLPSASKTKK GMFRTVGQLY KEQLGKLMTT LRNTTPNFVR CIIPNHEKRS
560 570 580 590 600
GKLDAFLVLE QLRCNGVLEG IRICRQGFPN RIVFQEFRQR YEILAANAIP
610 620 630 640 650
KGFMDGKQAC ILMIKALELD PNLYRIGQSK IFFRTGVLAH LEEERDLKIT
660 670 680 690 700
DVIMAFQAMC RGYLARKAFT KRQQQLTASK VIQRNCAAYL KLRNWQWWRL
710 720 730 740 750
FTKVKPLDEE MEAKQNLERH VSTLNIQLSD SKKKLQDLAS TIEVMEEGKK
760 770 780 790 800
RLQKEMEGLG QQYEEKAAAY DKLEKTKNRL QQELDDLVVD LDNQRQLVSN
810 820 830 840 850
LEKKQKKFDQ LLAEEKNISS KYADERDRAE AEAREKETKA LSLARALEEA
860 870 880 890 900
LEAKEELERT NKMLKAEMED LVSSKDDVGK NVHELEKSKR ALETQMEEMR
910 920 930 940 950
TQLEELEDEL QATEDAKLRL EVNMQALKGQ FERDLQARDE QNEEKRRQLQ
960 970 980 990 1000
RQLHEYETEL EDERKQRALA AAAKKKLEGD LKDLELQADS AVKGREEAIK
1010 1020 1030 1040 1050
QLRKLQAQMK DFQRELDDAR ASRDEIFATS KENEKKAKSL EAELMQLQED
1060 1070 1080 1090 1100
LAAAERARKQ ADLEKEELAE ELASSLSGRN TLQDEKRRLE ARIAQLEEEL
1110 1120 1130 1140 1150
EEEQGNMEAM SDRVRKATLQ AEQLSNELVT ERSAAQKNES ARQQLERQNK
1160 1170 1180 1190 1200
ELRSKLQEVE GAVKAKLKST VAALEAKIVQ LEEQIEQEAR EKQAATKLLK
1210 1220 1230 1240 1250
QKDKKLKEVL LQVEDERKMV EQYKEQAEKG NTKVKQLKRQ LEEAEEESQR
1260 1270 1280 1290 1300
INANRRKLQR ELDEATESNE AMGREVNALK SKLRRGNEAS FVPSRRAGGR
1310 1320
RVIENTDGSE EEMDARDSDF NGTKASE
Length:1,327
Mass (Da):152,492
Last modified:November 8, 2005 - v3
Checksum:iEE56D86984389F04
GO
Isoform 21 Publication (identifier: Q63862-2) [UniParc]FASTAAdd to basket
Also known as: SM1A1 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     61-67: Missing.

Show »
Length:1,320
Mass (Da):151,732
Checksum:i9B8207E5758FA633
GO
Isoform 31 Publication (identifier: Q63862-3) [UniParc]FASTAAdd to basket
Also known as: SM21 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     1285-1327: RGNEASFVPSRRAGGRRVIENTDGSEEEMDARDSDFNGTKASE → GPPPQETSQ

Show »
Length:1,293
Mass (Da):148,730
Checksum:i4FFC81043153443B
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Non-terminal residuei1Curated1
Non-adjacent residuesi706 – 707Curated2

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_05091461 – 67Missing in isoform 2. 1 Publication7
Alternative sequenceiVSP_0509151285 – 1327RGNEA…TKASE → GPPPQETSQ in isoform 3. 1 PublicationAdd BLAST43

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY953023 mRNA Translation: AAX51987.1
S61948 mRNA Translation: AAB26775.1
X16261 mRNA Translation: CAA34347.1
X16262 mRNA Translation: CAA34348.1
PIRiS07537
S10450
UniGeneiRn.94969

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiMYH11_RAT
AccessioniPrimary (citable) accession number: Q63862
Secondary accession number(s): Q58GJ0
, Q63338, Q63339, Q63861
Entry historyiIntegrated into UniProtKB/Swiss-Prot: September 13, 2004
Last sequence update: November 8, 2005
Last modified: April 25, 2018
This is version 116 of the entry and version 3 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health