Q63862 (MYH11_RAT) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 29, 2013.
Version 87.
History...
Clusters with 
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Myosin-11 Alternative name(s): Myosin heavy chain 11 Myosin heavy chain, smooth muscle isoform SMMHC | ||
| Gene names |
| ||
| Organism | Rattus norvegicus (Rat) [Reference proteome] | ||
| Taxonomic identifier | 10116 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Rattus |
Protein attributes
| Sequence length | 1327 AA. |
| Sequence status | Fragments. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Function | Muscle contraction. |
| Subunit structure | Muscle myosin is a hexameric protein that consists of 2 heavy chain subunits (MHC), 2 alkali light chain subunits (MLC) and 2 regulatory light chain subunits (MLC-2). |
| Subcellular location | Melanosome By similarity. Cytoplasm › myofibril. Note: Thick filaments of the myofibrils. |
| Tissue specificity | Both isoform 1 and isoform 2 are detected in small and large intestine, uterus, bladder, aorta, stomach, and at much lower levels in lung. All three isoforms are coexpressed in smooth muscle. Isoform 2 predominates in most of the smooth muscles tested, with the exception of intestine and urinary bladder, which show greater expression of isoform 1. Ref.1 Ref.2 |
| Domain | The rodlike tail sequence is highly repetitive, showing cycles of a 28-residue repeat pattern composed of 4 heptapeptides, characteristic for alpha-helical coiled coils. Each myosin heavy chain can be split into 1 light meromyosin (LMM) and 1 heavy meromyosin (HMM). It can later be split further into 2 globular subfragments (S1) and 1 rod-shaped subfragment (S2). |
| Sequence similarities | Contains 1 IQ domain. Contains 1 myosin head-like domain. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cytoplasm Thick filament |
| Coding sequence diversity | Alternative splicing |
| Domain | Coiled coil |
| Ligand | ATP-binding Actin-binding Calmodulin-binding Nucleotide-binding |
| Molecular function | Motor protein Muscle protein Myosin |
| PTM | Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | smooth muscle contraction Non-traceable author statement. Source: UniProtKB |
| Cellular_component | melanosome Inferred from electronic annotation. Source: UniProtKB-SubCell muscle myosin complexNon-traceable author statement Ref.1. Source: UniProtKB myofibrilInferred from electronic annotation. Source: UniProtKB-SubCell myosin filamentInferred from electronic annotation. Source: UniProtKB-KW |
| Molecular_function | ATP binding Inferred from electronic annotation. Source: UniProtKB-KW motor activityInferred from electronic annotation. Source: InterPro structural constituent of muscleNon-traceable author statement Ref.1. Source: UniProtKB |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 Ref.1 (identifier: Q63862-1) Also known as: SM1B; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 Ref.1 (identifier: Q63862-2) Also known as: SM1A; The sequence of this isoform differs from the canonical sequence as follows: 61-67: Missing. | ||||||
| Isoform 3 Ref.2 (identifier: Q63862-3) Also known as: SM2; The sequence of this isoform differs from the canonical sequence as follows: 1285-1327: RGNEASFVPSRRAGGRRVIENTDGSEEEMDARDSDFNGTKASE → GPPPQETSQ |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | ‹1 – 1327 | ›1327 | Myosin-11 | PRO_0000123428 | |||||
Regions | |||||||||
| Domain | ‹1 – 648 | ›648 | Myosin head-like | ||||||
| Domain | 649 – 678 | 30 | IQ | ||||||
| Nucleotide binding | 34 – 41 | 8 | ATP By similarity UniProtKB P10587 | ||||||
| Region | 524 – 546 | 23 | Actin-binding By similarity UniProtKB P10587 | ||||||
| Region | 625 – 639 | 15 | Actin-binding By similarity UniProtKB P10587 | ||||||
| Region | 1290 – 1327 | 38 | C-terminal | ||||||
| Coiled coil | 707 – 1289 | 583 | Potential | ||||||
Amino acid modifications | |||||||||
| Modified residue | 1309 | 1 | Phosphoserine By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 61 – 67 | 7 | Missing in isoform 2. Ref.1 | VSP_050914 | |||||
| Alternative sequence | 1285 – 1327 | 43 | RGNEA…TKASE → GPPPQETSQ in isoform 3. Ref.2 | VSP_050915 | |||||
Experimental info | |||||||||
| Non-adjacent residues | 706 – 707 | 2 | |||||||
| Non-terminal residue | 1 | 1 | |||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| [1] | "Identification of a novel smooth muscle myosin heavy chain cDNA: isoform diversity in the S1 head region." White S., Martin A.F., Periasamy M. Am. J. Physiol. 264:C1252-C1258(1993) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-706 (ISOFORMS 1 AND 2), TISSUE SPECIFICITY. Tissue: Fetal smooth muscle and Stomach. |
| [2] | "Myosin heavy chain isoform diversity in smooth muscle is produced by differential RNA processing." Babij P., Periasamy M. J. Mol. Biol. 210:673-679(1989) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 707-1327 (ISOFORM 1), NUCLEOTIDE SEQUENCE [MRNA] OF 707-1327 (ISOFORM 3), TISSUE SPECIFICITY. Strain: Sprague-Dawley. Tissue: Fetal aorta. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AY953023 mRNA. Translation: AAX51987.1. S61948 mRNA. Translation: AAB26775.1. X16261 mRNA. Translation: CAA34347.1. X16262 mRNA. Translation: CAA34348.1. |
| IPI | IPI00464464. IPI00464465. IPI00896783. |
| PIR | S07537. S10450. |
| UniGene | Rn.94969. |
3D structure databases | |
| ProteinModelPortal | Q63862. |
| SMR | Q63862. Positions 1-676. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q63862. 1 interaction. |
PTM databases | |
| PhosphoSite | Q63862. |
Proteomic databases | |
| PaxDb | Q63862. |
| PRIDE | Q63862. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Organism-specific databases | |
| RGD | 3136. Myh11. |
Phylogenomic databases | |
| eggNOG | COG5022. |
| HOGENOM | HOG000173958. |
| HOVERGEN | HBG004704. |
Gene expression databases | |
| ArrayExpress | Q63862. |
| Genevestigator | Q63862. |
| GermOnline | ENSRNOG00000000029. Rattus norvegicus. |
Family and domain databases | |
| Gene3D | 4.10.270.10. 1 hit. |
| InterPro | IPR000048. IQ_motif_EF-hand-BS. IPR027401. Myosin-like_IQ_dom. IPR001609. Myosin_head_motor_dom. IPR002928. Myosin_tail. IPR027417. P-loop_NTPase. [Graphical view] |
| Pfam | PF00063. Myosin_head. 1 hit. PF01576. Myosin_tail_1. 1 hit. [Graphical view] |
| PRINTS | PR00193. MYOSINHEAVY. |
| SMART | SM00015. IQ. 1 hit. SM00242. MYSc. 1 hit. [Graphical view] |
| SUPFAM | SSF52540. SSF52540. 1 hit. |
| PROSITE | PS50096. IQ. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Entry information
| Entry name | MYH11_RAT | ||||||||
| Accession | Primary (citable) accession number: Q63862 Secondary accession number(s): Q58GJ0  Q63861 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| SIMILARITY comments Index of protein domains and families |