Q63787 (P85A_RAT) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 3, 2013.
Version 125.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Phosphatidylinositol 3-kinase regulatory subunit alpha Short name=PI3-kinase regulatory subunit alpha Short name=PI3K regulatory subunit alpha Short name=PtdIns-3-kinase regulatory subunit alpha Alternative name(s): Phosphatidylinositol 3-kinase 85 kDa regulatory subunit alpha Short name=PI3-kinase subunit p85-alpha Short name=PtdIns-3-kinase regulatory subunit p85-alpha | ||
| Gene names |
| ||
| Organism | Rattus norvegicus (Rat) [Reference proteome] | ||
| Taxonomic identifier | 10116 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Rattus![]() |
Protein attributes
| Sequence length | 724 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Binds to activated (phosphorylated) protein-Tyr kinases, through its SH2 domain, and acts as an adapter, mediating the association of the p110 catalytic unit to the plasma membrane. Necessary for the insulin-stimulated increase in glucose uptake and glycogen synthesis in insulin-sensitive tissues. Plays an important role in signaling in response to FGFR1, FGFR2, FGFR3, FGFR4, KITLG/SCF, KIT, PDGFRA and PDGFRB. Likewise, plays a role in ITGB2 signaling By similarity. |
| Subunit structure | Heterodimer of a regulatory subunit PIK3R1 and a p110 catalytic subunit (PIK3CA, PIK3CB or PIK3CD). Interacts with phosphorylated LAT, LAX1, TRAT1 and LIME1 upon TCR and/or activation. Interacts with phosphorylated TOM1L1. Interacts with CBLB. The SH2 domains interact with the YTHM motif of phosphorylated INSR in vitro. Also interacts with tyrosine-phosphorylated IGF1R in vitro. Interacts with CD28 and CD3Z upon T-cell activation. Interacts with NISCH, SOCS7 and HCST By similarity. Interacts with IRS1 and phosphorylated IRS4. Interacts with RUFY3. Interacts with FGFR1, FGFR2, FGFR3 and FGFR4 (phosphorylated) Probable. Interacts with AXL, FASLG, FER, FGR, HCK, KIT and BCR By similarity. Interacts with PDGFRA (tyrosine phosphorylated) and PDGFRB (tyrosine phosphorylated). Interacts (via SH2 domain) with CSF1R (tyrosine phosphorylated). Interacts with ERBB4 (phosphorylated). Interacts (via SH2 domain) with TEK/TIE2 (tyrosine phosphorylated). Interacts with LYN (via SH3 domain); this enhances enzyme activity By similarity. Interacts with NTRK1 (phosphorylated upon ligand-binding) By similarity. Interacts with PTK2/FAK1. Ref.5 Ref.6 |
| Tissue specificity | The P85-alpha isoform is widely expressed. Expression of the P55-alpha isoform is highest in brain and skeletal muscle. The P50-alpha isoform is abundant in liver with lower levels in brain and muscle. |
| Domain | The SH3 domain mediates the binding to CBLB By similarity. |
| Post-translational modification | Polyubiquitinated in T-cells by CBLB; which does not promote proteasomal degradation but impairs association with CD28 and CD3Z upon T-cell activation By similarity. Phosphorylated. Tyrosine phosphorylated in response to signaling by FGFR1, FGFR2, FGFR3 and FGFR4. Phosphorylated by CSF1R. Phosphorylated on tyrosine residues by TEK/TIE2. Dephosphorylated by PTPRJ. Phosphorylated by PIK3CA at Ser-608; phosphorylation is stimulated by insulin and PDGF. The relevance of phosphorylation by PIK3CA is however unclear. Phosphorylated in response to KIT and KITLG/SCF. Phosphorylated by FGR and ERBB4 By similarity. |
| Sequence similarities | Belongs to the PI3K p85 subunit family. Contains 1 Rho-GAP domain. Contains 2 SH2 domains. Contains 1 SH3 domain. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| A0MZ67 | 2 | EBI-518443,EBI-1392040 | ||
| Khdrbs1 | Q91V33 | 2 | EBI-518443,EBI-518436 |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform p85-alpha (identifier: Q63787-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform p55-alpha (identifier: Q63787-2) The sequence of this isoform differs from the canonical sequence as follows: 1-270: Missing. 271-304: VLFRFPAASSDNTEHLIKAVELLISAEWSERQPA → MYTTVWTMEDLDLECAKTDINCGTDLMFYIEMDP | ||||||
| Isoform p50-alpha (identifier: Q63787-3) The sequence of this isoform differs from the canonical sequence as follows: 1-300: Missing. 301-306: RQPAPA → MHNLQT |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 724 | 724 | Phosphatidylinositol 3-kinase regulatory subunit alpha | PRO_0000080760 | |||||||||||||||||||||||||
Regions | |||||||||||||||||||||||||||||
| Domain | 3 – 79 | 77 | SH3 | ||||||||||||||||||||||||||
| Domain | 113 – 301 | 189 | Rho-GAP | ||||||||||||||||||||||||||
| Domain | 333 – 428 | 96 | SH2 1 | ||||||||||||||||||||||||||
| Domain | 624 – 718 | 95 | SH2 2 | ||||||||||||||||||||||||||
Amino acid modifications | |||||||||||||||||||||||||||||
| Modified residue | 467 | 1 | Phosphotyrosine By similarity | ||||||||||||||||||||||||||
| Modified residue | 580 | 1 | Phosphotyrosine By similarity | ||||||||||||||||||||||||||
| Modified residue | 607 | 1 | Phosphotyrosine By similarity | ||||||||||||||||||||||||||
| Modified residue | 608 | 1 | Phosphoserine By similarity | ||||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||||
| Alternative sequence | 1 – 300 | 300 | Missing in isoform p50-alpha. | VSP_004711 | |||||||||||||||||||||||||
| Alternative sequence | 1 – 270 | 270 | Missing in isoform p55-alpha. | VSP_004709 | |||||||||||||||||||||||||
| Alternative sequence | 271 – 304 | 34 | VLFRF…ERQPA → MYTTVWTMEDLDLECAKTDI NCGTDLMFYIEMDP in isoform p55-alpha. | VSP_004710 | |||||||||||||||||||||||||
| Alternative sequence | 301 – 306 | 6 | RQPAPA → MHNLQT in isoform p50-alpha. | VSP_004712 | |||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||||
| Beta strand | 324 – 327 | 4 | |||||||||||||||||||||||||||
| Helix | 340 – 346 | 7 | |||||||||||||||||||||||||||
| Beta strand | 347 – 349 | 3 | |||||||||||||||||||||||||||
| Beta strand | 358 – 360 | 3 | |||||||||||||||||||||||||||
| Beta strand | 363 – 365 | 3 | |||||||||||||||||||||||||||
| Beta strand | 371 – 374 | 4 | |||||||||||||||||||||||||||
| Beta strand | 377 – 380 | 4 | |||||||||||||||||||||||||||
| Beta strand | 385 – 393 | 9 | |||||||||||||||||||||||||||
| Helix | 403 – 407 | 5 | |||||||||||||||||||||||||||
| Beta strand | 408 – 411 | 4 | |||||||||||||||||||||||||||
| Beta strand | 415 – 417 | 3 | |||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| [1] | "A novel 55-kDa regulatory subunit for phosphatidylinositol 3-kinase structurally similar to p55PIK is generated by alternative splicing of the p85alpha gene." Inukai K., Anai M., van Breda E., Hosaka T., Katagiri H., Funaki M., Fukushima Y., Ogihara T., Yazaki Y., Kikuchi M., Oka Y., Asano T. J. Biol. Chem. 271:5317-5320(1996) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS P85-ALPHA AND P55-ALPHA). Strain: Wistar. Tissue: Brain. |
| [2] | "p85alpha gene generates three isoforms of regulatory subunit for phosphatidylinositol 3-kinase (PI 3-Kinase), p50alpha, p55alpha, and p85alpha, with different PI 3-kinase activity elevating responses to insulin." Inukai K., Funaki M., Ogihara T., Katagiri H., Kanda A., Anai M., Fukushima Y., Hosaka T., Suzuki M., Shin B., Takata K., Yazaki Y., Kikuchi M., Oka Y., Asano T. J. Biol. Chem. 272:7873-7882(1997) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM P50-ALPHA). Tissue: Liver. |
| [3] | "Structural organization and alternative splicing of the murine phosphoinositide 3-kinase p85 alpha gene." Fruman D.A., Cantley L.C., Carpenter C.L. Genomics 37:113-121(1996) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM P50-ALPHA). Tissue: Liver. |
| [4] | "Signal transduction by fibroblast growth factor receptor-4 (FGFR-4). Comparison with FGFR-1." Vainikka S., Joukov V., Wennstrom S., Bergman M., Pelicci P.G., Alitalo K. J. Biol. Chem. 269:18320-18326(1994) [PubMed] [Europe PMC] [Abstract] Cited for: ACTIVATION BY FGFR4. |
| [5] | "Phosphorylation of tyrosine 397 in focal adhesion kinase is required for binding phosphatidylinositol 3-kinase." Chen H.C., Appeddu P.A., Isoda H., Guan J.L. J. Biol. Chem. 271:26329-26334(1996) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH PTK2/FAK1. |
| [6] | "Insulin receptor substrate 1 binds two novel splice variants of the regulatory subunit of phosphatidylinositol 3-kinase in muscle and brain." Antonetti D.A., Algenstaedt P., Kahn C.R. Mol. Cell. Biol. 16:2195-2203(1996) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH IRS1. |
| [7] | "Stimulation of phosphatidylinositol 3-kinase by fibroblast growth factor receptors is mediated by coordinated recruitment of multiple docking proteins." Ong S.H., Hadari Y.R., Gotoh N., Guy G.R., Schlessinger J., Lax I. Proc. Natl. Acad. Sci. U.S.A. 98:6074-6079(2001) [PubMed] [Europe PMC] [Abstract] Cited for: ACTIVATION BY FGFR1. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | D64045 mRNA. Translation: BAA18932.1. D64048 mRNA. Translation: BAA18933.1. U50412 mRNA. Translation: AAC52846.1. D78486 mRNA. Translation: BAA24426.1. | ||||||||||||||||||
| IPI | IPI00211946. IPI00231820. IPI00231821. | ||||||||||||||||||
| RefSeq | NP_037137.1. NM_013005.1. | ||||||||||||||||||
| UniGene | Rn.10599. | ||||||||||||||||||
3D structure databases | |||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||
| ProteinModelPortal | Q63787. | ||||||||||||||||||
| SMR | Q63787. Positions 1-84, 115-309, 328-600, 614-724. | ||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||
| IntAct | Q63787. 3 interactions. | ||||||||||||||||||
| MINT | MINT-2880471. | ||||||||||||||||||
PTM databases | |||||||||||||||||||
| PhosphoSite | Q63787. | ||||||||||||||||||
Proteomic databases | |||||||||||||||||||
| PaxDb | Q63787. | ||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||
Genome annotation databases | |||||||||||||||||||
| GeneID | 25513. | ||||||||||||||||||
| KEGG | rno:25513. | ||||||||||||||||||
| UCSC | RGD:3329. rat. | ||||||||||||||||||
Organism-specific databases | |||||||||||||||||||
| CTD | 5295. | ||||||||||||||||||
| RGD | 3329. Pik3r1. | ||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||
| eggNOG | NOG263689. | ||||||||||||||||||
| HOGENOM | HOG000008438. | ||||||||||||||||||
| HOVERGEN | HBG082100. | ||||||||||||||||||
| KO | K02649. | ||||||||||||||||||
| OrthoDB | EOG4GXFM8. | ||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||
| Reactome | REACT_109781. Immune System. | ||||||||||||||||||
Gene expression databases | |||||||||||||||||||
| ArrayExpress | Q63787. | ||||||||||||||||||
| Genevestigator | Q63787. | ||||||||||||||||||
Family and domain databases | |||||||||||||||||||
| Gene3D | 1.10.555.10. 1 hit. 3.30.505.10. 2 hits. | ||||||||||||||||||
| InterPro | IPR001720. PI3kinase_P85. IPR008936. Rho_GTPase_activation_prot. IPR000198. RhoGAP_dom. IPR000980. SH2. IPR011511. SH3_2. IPR001452. SH3_domain. [Graphical view] | ||||||||||||||||||
| PANTHER | PTHR10155. PTHR10155. 1 hit. | ||||||||||||||||||
| Pfam | PF00620. RhoGAP. 1 hit. PF00017. SH2. 2 hits. PF07653. SH3_2. 1 hit. [Graphical view] | ||||||||||||||||||
| PRINTS | PR00678. PI3KINASEP85. PR00401. SH2DOMAIN. | ||||||||||||||||||
| SMART | SM00324. RhoGAP. 1 hit. SM00252. SH2. 2 hits. SM00326. SH3. 1 hit. [Graphical view] | ||||||||||||||||||
| SUPFAM | SSF48350. Rho_GAP. 1 hit. SSF50044. SH3. 1 hit. | ||||||||||||||||||
| PROSITE | PS50238. RHOGAP. 1 hit. PS50001. SH2. 2 hits. PS50002. SH3. 1 hit. [Graphical view] | ||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||
Other | |||||||||||||||||||
| EvolutionaryTrace | Q63787. | ||||||||||||||||||
| NextBio | 606957. | ||||||||||||||||||
Entry information
| Entry name | P85A_RAT | ||||||||
| Accession | Primary (citable) accession number: Q63787 Secondary accession number(s): O55085, P70544, Q63790 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
