Q63625 (PHRF1_RAT) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 3, 2013.
Version 67.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: PHD and RING finger domain-containing protein 1 Alternative name(s): CTD-binding SR-like protein rA9 | ||
| Gene names |
| ||
| Organism | Rattus norvegicus (Rat) [Reference proteome] | ||
| Taxonomic identifier | 10116 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Rattus![]() |
Protein attributes
| Sequence length | 1685 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Subunit structure | Interacts with POLR2A (via the C-terminal domain). Ref.1 |
| Sequence similarities | Contains 1 PHD-type zinc finger. Contains 1 RING-type zinc finger. |
Ontologies
| Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing |
| Domain | Coiled coil Zinc-finger |
| Ligand | Metal-binding Zinc |
| PTM | Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | mRNA processing Inferred from mutant phenotype Ref.1. Source: RGD transcription from RNA polymerase II promoterInferred from mutant phenotype Ref.1. Source: RGD |
| Molecular_function | protein domain specific binding Inferred from mutant phenotype Ref.1. Source: RGD zinc ion bindingInferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q63625-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Note: No experimental confirmation available. Gene prediction based on similarity to human ortholog. | ||||||
| Isoform 2 Ref.1 (identifier: Q63625-2) The sequence of this isoform differs from the canonical sequence as follows: 1-212: Missing. 213-244: YHMECLDPPLQEVPVDEWFCPECAVPGVDPTH → MRRLKRKTRPFVKCVAGVIVRTGSYFVTAVML |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1685 | 1685 | PHD and RING finger domain-containing protein 1 | PRO_0000354663 | |||||
Regions | |||||||||
| Zinc finger | 109 – 150 | 42 | RING-type; degenerate | ||||||
| Zinc finger | 188 – 238 | 51 | PHD-type | ||||||
| Coiled coil | 1589 – 1615 | 27 | Potential | ||||||
| Compositional bias | 267 – 409 | 143 | Arg-rich | ||||||
| Compositional bias | 994 – 1188 | 195 | Arg-rich | ||||||
Amino acid modifications | |||||||||
| Modified residue | 335 | 1 | Phosphothreonine By similarity | ||||||
| Modified residue | 460 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 867 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 870 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 922 | 1 | Phosphoserine By similarity UniProtKB Q9P1Y6 | ||||||
| Modified residue | 948 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 1002 | 1 | Phosphoserine By similarity UniProtKB Q9P1Y6 | ||||||
| Modified residue | 1044 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 1046 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 1138 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 1139 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 1205 | 1 | Phosphoserine By similarity UniProtKB Q9P1Y6 | ||||||
| Modified residue | 1372 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 1383 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 1416 | 1 | Phosphothreonine By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 212 | 212 | Missing in isoform 2. Ref.1 | VSP_052981 | |||||
| Alternative sequence | 213 – 244 | 32 | YHMEC…VDPTH → MRRLKRKTRPFVKCVAGVIV RTGSYFVTAVML in isoform 2. Ref.1 | VSP_052982 | |||||
Experimental info | |||||||||
| Sequence conflict | 615 | 1 | T → S in AAC52658. Ref.1 | ||||||
| Sequence conflict | 793 | 1 | Q → P in AAC52658. Ref.1 | ||||||
| Sequence conflict | 855 – 856 | 2 | SG → PD in AAC52658. Ref.1 | ||||||
| Sequence conflict | 1549 | 1 | S → G in AAC52658. Ref.1 | ||||||
| Sequence conflict | 1592 | 1 | K → T in AAC52658. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "The C-terminal domain of the largest subunit of RNA polymerase II interacts with a novel set of serine/arginine-rich proteins." Yuryev A., Patturajan M., Litingtung Y., Joshi R.V., Gentile C., Gebara M., Corden J.L. Proc. Natl. Acad. Sci. U.S.A. 93:6975-6980(1996) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), INTERACTION WITH POLR2A. Tissue: Hippocampus. |
| [2] | "Genome sequence of the Brown Norway rat yields insights into mammalian evolution." Gibbs R.A., Weinstock G.M., Metzker M.L., Muzny D.M., Sodergren E.J., Scherer S., Scott G., Steffen D., Worley K.C., Burch P.E., Okwuonu G., Hines S., Lewis L., Deramo C., Delgado O., Dugan-Rocha S., Miner G., Morgan M. Collins F.S.Nature 428:493-521(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. Strain: Brown Norway. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | U49057 mRNA. Translation: AAC52658.1. AC118351 Genomic DNA. No translation available. |
| IPI | IPI00211009. IPI00915115. |
| PIR | T31422. |
| RefSeq | NP_620793.1. NM_139093.1. |
| UniGene | Rn.10530. |
3D structure databases | |
| ProteinModelPortal | Q63625. |
| ModBase | Search... |
Proteomic databases | |
| PaxDb | Q63625. |
| PRIDE | Q63625. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENSRNOT00000023376; ENSRNOP00000023376; ENSRNOG00000017299. ENSRNOT00000051755; ENSRNOP00000046880; ENSRNOG00000017299. |
| GeneID | 245925. |
| KEGG | rno:245925. |
| UCSC | RGD:708360. rat. |
Organism-specific databases | |
| CTD | 57661. |
| RGD | 708360. Phrf1. |
Phylogenomic databases | |
| eggNOG | NOG300312. |
| GeneTree | ENSGT00530000063661. |
| HOGENOM | HOG000082501. |
| HOVERGEN | HBG108250. |
| InParanoid | Q63625. |
| OMA | YMKKLHM. |
| OrthoDB | EOG4MSD0F. |
Gene expression databases | |
| ArrayExpress | Q63625. |
| Genevestigator | Q63625. |
Family and domain databases | |
| Gene3D | 3.30.40.10. 2 hits. |
| InterPro | IPR019786. Zinc_finger_PHD-type_CS. IPR011011. Znf_FYVE_PHD. IPR001965. Znf_PHD. IPR019787. Znf_PHD-finger. IPR001841. Znf_RING. IPR013083. Znf_RING/FYVE/PHD. IPR017907. Znf_RING_CS. [Graphical view] |
| Pfam | PF00628. PHD. 1 hit. PF13639. zf-RING_2. 1 hit. [Graphical view] |
| SMART | SM00249. PHD. 1 hit. SM00184. RING. 2 hits. [Graphical view] |
| SUPFAM | SSF57903. FYVE_PHD_ZnF. 1 hit. |
| PROSITE | PS01359. ZF_PHD_1. 1 hit. PS50016. ZF_PHD_2. 1 hit. PS00518. ZF_RING_1. 1 hit. PS50089. ZF_RING_2. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 623186. |
Entry information
| Entry name | PHRF1_RAT | ||||||||
| Accession | Primary (citable) accession number: Q63625 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| SIMILARITY comments Index of protein domains and families |

Clusters with
