Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Disks large homolog 2

Gene

Dlg2

Organism
Rattus norvegicus (Rat)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Required for perception of chronic pain through NMDA receptor signaling. Regulates surface expression of NMDA receptors in dorsal horn neurons of the spinal cord. Interacts with the cytoplasmic tail of NMDA receptor subunits as well as inward rectifying potassium channels. Involved in regulation of synaptic stability at cholinergic synapses. Part of the postsynaptic protein scaffold of excitatory synapses (By similarity).By similarity

GO - Molecular functioni

  • guanylate kinase activity Source: GO_Central
  • ionotropic glutamate receptor binding Source: GO_Central
  • PDZ domain binding Source: RGD
  • protein C-terminus binding Source: UniProtKB
  • protein heterodimerization activity Source: RGD
  • protein phosphatase binding Source: BHF-UCL

GO - Biological processi

  • chemical synaptic transmission Source: GO_Central
  • negative regulation of phosphatase activity Source: UniProtKB
  • neuronal ion channel clustering Source: RGD
  • receptor clustering Source: RGD
  • receptor localization to synapse Source: GO_Central
Complete GO annotation...

Names & Taxonomyi

Protein namesi
Recommended name:
Disks large homolog 2
Alternative name(s):
Channel-associated protein of synapse-110
Short name:
Chapsyn-1101 Publication
Postsynaptic density protein PSD-93
Gene namesi
Name:Dlg2
Synonyms:Dlgh2
OrganismiRattus norvegicus (Rat)
Taxonomic identifieri10116 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeRattus
Proteomesi
  • UP000002494 Componenti: Unplaced

Organism-specific databases

RGDi619895. Dlg2.

Subcellular locationi

GO - Cellular componenti

  • cell junction Source: UniProtKB-KW
  • cytoplasm Source: RGD
  • dendrite Source: RGD
  • juxtaparanode region of axon Source: UniProtKB
  • membrane Source: UniProtKB
  • neuronal cell body Source: RGD
  • postsynaptic density Source: UniProtKB
  • postsynaptic membrane Source: GO_Central
Complete GO annotation...

Keywords - Cellular componenti

Cell junction, Cell membrane, Cell projection, Membrane, Postsynaptic cell membrane, Synapse

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi5C → S: Loss of palmitoylation and targeting to postsynaptic density. 1 Publication1
Mutagenesisi7C → S: Loss of palmitoylation and targeting to postsynaptic density. 1 Publication1

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000945551 – 852Disks large homolog 2Add BLAST852

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Lipidationi5S-palmitoyl cysteine1 Publication1
Lipidationi7S-palmitoyl cysteine1 Publication1
Modified residuei28PhosphoserineBy similarity1
Modified residuei58PhosphotyrosineBy similarity1
Modified residuei65PhosphoserineBy similarity1
Modified residuei307PhosphoserineBy similarity1
Modified residuei328PhosphoserineBy similarity1
Modified residuei360PhosphoserineCombined sources1
Modified residuei365PhosphoserineCombined sources1
Modified residuei406PhosphoserineCombined sources1
Modified residuei414PhosphoserineCombined sources1
Modified residuei505PhosphotyrosineBy similarity1
Modified residuei528PhosphoserineCombined sources1
Modified residuei530PhosphoserineCombined sources1
Modified residuei553PhosphoserineBy similarity1
Modified residuei732PhosphotyrosineBy similarity1
Modified residuei737PhosphotyrosineBy similarity1

Post-translational modificationi

Palmitoylation of isoform 1 and isoform 2 is not required for targeting to postsynaptic density.1 Publication

Keywords - PTMi

Lipoprotein, Palmitate, Phosphoprotein

Proteomic databases

PaxDbiQ63622.
PRIDEiQ63622.

PTM databases

iPTMnetiQ63622.
PhosphoSitePlusiQ63622.

Expressioni

Tissue specificityi

Detected in juxtaparanodal zones in the central nervous system and at nerve terminal plexuses of basket cells in the cerebellum (at protein level) (PubMed:20089912). Brain. High levels in cerebellar Purkinje cells. Expressed in pyramidal cells of the Ammons's horn and granular cells of the dentate gyrus in the hippocampus as well as cerebral cortex and striatum. High levels in dorsal horn of spinal cord.3 Publications

Developmental stagei

High levels in developing brain and spinal chord, sensory neurons of dorsal root and trigeminal ganglia, myenteric neurons of the intestine as well as in non-neuronal cells of adrenal, thymus and submandibular glands of E15 embryos.1 Publication

Interactioni

Subunit structurei

Interacts through its PDZ domains with NETO1. Interacts with NOS1/nNOS through second PDZ domain (PubMed:8922396). Interacts with KCNJ2/Kir2.1 (via C-terminus) through one of its PDZ domains (By similarity). Interacts with KCNJ4 (By similarity). Interacts with FRMPD4 (via C-terminus) (PubMed:19118189). Interacts with LRFN1 (PubMed:16630835). Interacts with LRFN2 and LRFN4. Interacts with FASLG (By similarity). Interacts with ADAM22 (PubMed:20089912).By similarity5 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
ATP2B2Q01814-12EBI-396947,EBI-1174262From a different organism.
ATP2B4P23634-62EBI-396947,EBI-1174437From a different organism.
DgkiQ810C53EBI-396947,EBI-8523614
DgkzO085604EBI-396947,EBI-8570505
KIF1BO60333-33EBI-396947,EBI-465669From a different organism.
Map1aP349264EBI-396947,EBI-631571

GO - Molecular functioni

  • ionotropic glutamate receptor binding Source: GO_Central
  • PDZ domain binding Source: RGD
  • protein C-terminus binding Source: UniProtKB
  • protein heterodimerization activity Source: RGD
  • protein phosphatase binding Source: BHF-UCL

Protein-protein interaction databases

BioGridi248965. 7 interactors.
IntActiQ63622. 15 interactors.
MINTiMINT-155119.
STRINGi10116.ENSRNOP00000052268.

Structurei

Secondary structure

1852
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi93 – 102Combined sources10
Beta strandi109 – 113Combined sources5
Helixi121 – 123Combined sources3
Beta strandi127 – 132Combined sources6
Helixi137 – 141Combined sources5
Beta strandi149 – 153Combined sources5
Helixi163 – 172Combined sources10
Beta strandi175 – 184Combined sources10

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
4H11X-ray1.67A/B93-188[»]
ProteinModelPortaliQ63622.
SMRiQ63622.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini98 – 184PDZ 1PROSITE-ProRule annotationAdd BLAST87
Domaini193 – 279PDZ 2PROSITE-ProRule annotationAdd BLAST87
Domaini421 – 501PDZ 3PROSITE-ProRule annotationAdd BLAST81
Domaini536 – 606SH3PROSITE-ProRule annotationAdd BLAST71
Domaini662 – 837Guanylate kinase-likePROSITE-ProRule annotationAdd BLAST176

Sequence similaritiesi

Belongs to the MAGUK family.Curated
Contains 1 guanylate kinase-like domain.PROSITE-ProRule annotation
Contains 3 PDZ (DHR) domains.PROSITE-ProRule annotation
Contains 1 SH3 domain.PROSITE-ProRule annotation

Keywords - Domaini

Repeat, SH3 domain

Phylogenomic databases

eggNOGiKOG0708. Eukaryota.
COG0194. LUCA.
HOGENOMiHOG000232102.
HOVERGENiHBG107814.
InParanoidiQ63622.
KOiK12075.

Family and domain databases

Gene3Di2.30.42.10. 3 hits.
3.40.50.300. 2 hits.
InterProiIPR016313. DLG1.
IPR019590. DLG1_PEST_dom.
IPR008145. GK/Ca_channel_bsu.
IPR008144. Guanylate_kin-like_dom.
IPR020590. Guanylate_kinase_CS.
IPR027417. P-loop_NTPase.
IPR001478. PDZ.
IPR019583. PDZ_assoc.
IPR011511. SH3_2.
IPR001452. SH3_domain.
[Graphical view]
PfamiPF00625. Guanylate_kin. 1 hit.
PF10608. MAGUK_N_PEST. 2 hits.
PF00595. PDZ. 3 hits.
PF10600. PDZ_assoc. 1 hit.
PF07653. SH3_2. 1 hit.
[Graphical view]
PIRSFiPIRSF001741. MAGUK_DLGH. 1 hit.
SMARTiSM00072. GuKc. 1 hit.
SM01277. MAGUK_N_PEST. 1 hit.
SM00228. PDZ. 3 hits.
SM00326. SH3. 1 hit.
[Graphical view]
SUPFAMiSSF50044. SSF50044. 2 hits.
SSF50156. SSF50156. 3 hits.
SSF52540. SSF52540. 1 hit.
PROSITEiPS00856. GUANYLATE_KINASE_1. 1 hit.
PS50052. GUANYLATE_KINASE_2. 1 hit.
PS50106. PDZ. 3 hits.
PS50002. SH3. 1 hit.
[Graphical view]

Sequences (7)i

Sequence statusi: Complete.

This entry describes 7 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q63622-1) [UniParc]FASTAAdd to basket
Also known as: PSD-93b

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MFFACYCALR TNVKKYRYQD EDGPHDHSLP RLTHEVRGPE LVHVSEKNLS
60 70 80 90 100
QIENVHGYVL QSHISPLKAS PAPIIVNTDT LDTIPYVNGT EIEYEFEEIT
110 120 130 140 150
LERGNSGLGF SIAGGTDNPH IGDDPGIFIT KIIPGGAAAE DGRLRVNDCI
160 170 180 190 200
LRVNEVDVSE VSHSKAVEAL KEAGSIVRLY VRRRRPILET VVEIKLFKGP
210 220 230 240 250
KGLGFSIAGG VGNQHIPGDN SIYVTKIIDG GAAQKDGRLQ VGDRLLMVNN
260 270 280 290 300
YSLEEVTHEE AVAILKNTSD VVYLKVGKPT TIYMTDPYGP PDITHSYSPP
310 320 330 340 350
MENHLLSGNN GTLEYKTSLP PISPGRYSPI PKHMLVEDDY TRPPEPVYST
360 370 380 390 400
VNKLCDKPAS PRHYSPVECD KSFLLSTPYP HYHLGLLPDS DMTSHSQHST
410 420 430 440 450
ATRQPSVTLQ RAISLEGEPR KVVLHKGSTG LGFNIVGGED GEGIFVSFIL
460 470 480 490 500
AGGPADLSGE LQRGDQILSV NGIDLRGASH EQAAAALKGA GQTVTIIAQY
510 520 530 540 550
QPEDYARFEA KIHDLREQMM NHSMSSGSGS LRTNQKRSLY VRAMFDYDKS
560 570 580 590 600
KDSGLPSQGL SFKYGDILHV INASDDEWWQ ARRVILDGDS EEMGVIPSKR
610 620 630 640 650
RVERKERARL KTVKFNAKPG VIDSKGDIPG LGDDGYGTKT LRGQEDLILS
660 670 680 690 700
YEPVTRQEIN YTRPVIILGP MKDRINDDLI SEFPDKFGSC VPHTTRPKRD
710 720 730 740 750
YEVDGRDYHF VISREQMEKD IQEHKFIEAG QYNDNLYGTS VQSVRFVAER
760 770 780 790 800
GKHCILDVSG NAIKRLQVAQ LYPIAIFIKP KSLEPLMEMN KRLTEEQAKK
810 820 830 840 850
TYDRAIKLEQ EFGEYFTAIV QGDTLEDIYN QCKLVIEEQS GPFIWIPSKE

KL
Length:852
Mass (Da):94,934
Last modified:November 1, 1997 - v1
Checksum:iF8D414A8B9CF5B09
GO
Isoform 2 (identifier: Q63622-2) [UniParc]FASTAAdd to basket
Also known as: PSD-93a

The sequence of this isoform differs from the canonical sequence as follows:
     1-13: MFFACYCALRTNV → MICHCKVACTNNTLSLMFGC

Show »
Length:859
Mass (Da):95,585
Checksum:i4843703C194A1CE8
GO
Isoform 3 (identifier: Q63622-3) [UniParc]FASTAAdd to basket
Also known as: PSD-93c

The sequence of this isoform differs from the canonical sequence as follows:
     1-61: Missing.
     62-68: SHISPLK → MQHAFIP
     341-392: Missing.

Show »
Length:739
Mass (Da):81,962
Checksum:i6C33B93499B8E70A
GO
Isoform 4 (identifier: Q63622-4) [UniParc]FASTAAdd to basket
Also known as: PSD-93-delta

The sequence of this isoform differs from the canonical sequence as follows:
     1-68: MFFACYCALR...VLQSHISPLK → MNAYLTKQHS...CPHGWFSPAQ

Show »
Length:887
Mass (Da):97,938
Checksum:iFBB0E9EF8F855A59
GO
Isoform 5 (identifier: Q63622-5) [UniParc]FASTAAdd to basket
Also known as: PSD-93d

The sequence of this isoform differs from the canonical sequence as follows:
     1-246: Missing.

Note: No experimental confirmation available.
Show »
Length:606
Mass (Da):68,062
Checksum:iF87FF88D002EA965
GO
Isoform 6 (identifier: Q63622-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     450-454: Missing.
     626-641: Missing.

Show »
Length:831
Mass (Da):92,978
Checksum:i0B9B45B7A317B263
GO
Isoform 7 (identifier: Q63622-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     626-641: GDIPGLGDDGYGTKTL → GSFNDKRKKSFIFSRKFPFYKNKEQSEQETSDPE

Show »
Length:870
Mass (Da):97,486
Checksum:iA6890D04BE125927
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti181 – 182VR → IL in AAC52643 (PubMed:8625413).Curated2
Sequence conflicti228I → M in AAC52643 (PubMed:8625413).Curated1
Sequence conflicti326R → K in AAC52643 (PubMed:8625413).Curated1
Sequence conflicti339D → E in AAB48562 (Ref. 3) Curated1
Sequence conflicti464 – 465GD → RK in AAC52643 (PubMed:8625413).Curated2
Sequence conflicti474D → H (PubMed:8625413).Curated1
Sequence conflicti476R → P (PubMed:8625413).Curated1
Sequence conflicti478A → D (PubMed:8625413).Curated1
Sequence conflicti484 – 486AAA → LP in AAC52643 (PubMed:8625413).Curated3
Sequence conflicti506A → S in AAC52643 (PubMed:8625413).Curated1
Sequence conflicti569H → N in AAC52643 (PubMed:8625413).Curated1
Sequence conflicti586L → Q in AAC52643 (PubMed:8625413).Curated1
Sequence conflicti627 – 630DIPG → TSR (PubMed:8922396).Curated4
Sequence conflicti639K → A in AAB48562 (Ref. 3) Curated1
Sequence conflicti726F → L in AAB53243 (PubMed:8755482).Curated1
Sequence conflicti733N → Y in AAC52643 (PubMed:8625413).Curated1
Sequence conflicti749E → V in AAB53243 (PubMed:8755482).Curated1
Sequence conflicti756L → H in AAC52643 (PubMed:8625413).Curated1
Sequence conflicti791 – 792KR → NG (PubMed:8625413).Curated2
Sequence conflicti794T → M (PubMed:8625413).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0155251 – 246Missing in isoform 5. 1 PublicationAdd BLAST246
Alternative sequenceiVSP_0155261 – 68MFFAC…ISPLK → MNAYLTKQHSCSRGSDGMDA GRGVPTLIRDAHCACGWQRN AQGLGYSSQTMPSSGPGGPA SNRTKLVTLWDSVRKSPHKT STKGKGNCGERCACPHGWFS PAQ in isoform 4. CuratedAdd BLAST68
Alternative sequenceiVSP_0155271 – 61Missing in isoform 3. 1 PublicationAdd BLAST61
Alternative sequenceiVSP_0155281 – 13MFFAC…LRTNV → MICHCKVACTNNTLSLMFGC in isoform 2. 1 PublicationAdd BLAST13
Alternative sequenceiVSP_01552962 – 68SHISPLK → MQHAFIP in isoform 3. 1 Publication7
Alternative sequenceiVSP_015530341 – 392Missing in isoform 3. 1 PublicationAdd BLAST52
Alternative sequenceiVSP_015531450 – 454Missing in isoform 6. 1 Publication5
Alternative sequenceiVSP_015533626 – 641Missing in isoform 6. 1 PublicationAdd BLAST16
Alternative sequenceiVSP_015532626 – 641GDIPG…GTKTL → GSFNDKRKKSFIFSRKFPFY KNKEQSEQETSDPE in isoform 7. CuratedAdd BLAST16

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U49049 mRNA. Translation: AAB53243.1.
U50717 mRNA. Translation: AAC52643.1.
U53368 mRNA. Translation: AAB48562.1.
PIRiT10811.
RefSeqiNP_071618.1. NM_022282.1.
UniGeneiRn.202966.

Genome annotation databases

GeneIDi64053.
KEGGirno:64053.
UCSCiRGD:619895. rat. [Q63622-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U49049 mRNA. Translation: AAB53243.1.
U50717 mRNA. Translation: AAC52643.1.
U53368 mRNA. Translation: AAB48562.1.
PIRiT10811.
RefSeqiNP_071618.1. NM_022282.1.
UniGeneiRn.202966.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
4H11X-ray1.67A/B93-188[»]
ProteinModelPortaliQ63622.
SMRiQ63622.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi248965. 7 interactors.
IntActiQ63622. 15 interactors.
MINTiMINT-155119.
STRINGi10116.ENSRNOP00000052268.

PTM databases

iPTMnetiQ63622.
PhosphoSitePlusiQ63622.

Proteomic databases

PaxDbiQ63622.
PRIDEiQ63622.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

GeneIDi64053.
KEGGirno:64053.
UCSCiRGD:619895. rat. [Q63622-1]

Organism-specific databases

CTDi1740.
RGDi619895. Dlg2.

Phylogenomic databases

eggNOGiKOG0708. Eukaryota.
COG0194. LUCA.
HOGENOMiHOG000232102.
HOVERGENiHBG107814.
InParanoidiQ63622.
KOiK12075.

Miscellaneous databases

PROiQ63622.

Family and domain databases

Gene3Di2.30.42.10. 3 hits.
3.40.50.300. 2 hits.
InterProiIPR016313. DLG1.
IPR019590. DLG1_PEST_dom.
IPR008145. GK/Ca_channel_bsu.
IPR008144. Guanylate_kin-like_dom.
IPR020590. Guanylate_kinase_CS.
IPR027417. P-loop_NTPase.
IPR001478. PDZ.
IPR019583. PDZ_assoc.
IPR011511. SH3_2.
IPR001452. SH3_domain.
[Graphical view]
PfamiPF00625. Guanylate_kin. 1 hit.
PF10608. MAGUK_N_PEST. 2 hits.
PF00595. PDZ. 3 hits.
PF10600. PDZ_assoc. 1 hit.
PF07653. SH3_2. 1 hit.
[Graphical view]
PIRSFiPIRSF001741. MAGUK_DLGH. 1 hit.
SMARTiSM00072. GuKc. 1 hit.
SM01277. MAGUK_N_PEST. 1 hit.
SM00228. PDZ. 3 hits.
SM00326. SH3. 1 hit.
[Graphical view]
SUPFAMiSSF50044. SSF50044. 2 hits.
SSF50156. SSF50156. 3 hits.
SSF52540. SSF52540. 1 hit.
PROSITEiPS00856. GUANYLATE_KINASE_1. 1 hit.
PS50052. GUANYLATE_KINASE_2. 1 hit.
PS50106. PDZ. 3 hits.
PS50002. SH3. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiDLG2_RAT
AccessioniPrimary (citable) accession number: Q63622
Secondary accession number(s): P70548, Q62939
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: November 1, 1997
Last modified: November 2, 2016
This is version 150 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.