Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q63622

- DLG2_RAT

UniProt

Q63622 - DLG2_RAT

Protein

Disks large homolog 2

Gene

Dlg2

Organism
Rattus norvegicus (Rat)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 132 (01 Oct 2014)
      Sequence version 1 (01 Nov 1997)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Required for perception of chronic pain through NMDA receptor signaling. Regulates surface expression of NMDA receptors in dorsal horn neurons of the spinal cord. Interacts with the cytoplasmic tail of NMDA receptor subunits as well as inward rectifying potassium channels. Involved in regulation of synaptic stability at cholinergic synapses. Part of the postsynaptic protein scaffold of excitatory synapses By similarity.By similarity

    GO - Molecular functioni

    1. PDZ domain binding Source: RGD
    2. protein binding Source: IntAct
    3. protein C-terminus binding Source: UniProtKB
    4. protein heterodimerization activity Source: RGD
    5. protein phosphatase binding Source: BHF-UCL

    GO - Biological processi

    1. negative regulation of phosphatase activity Source: UniProtKB
    2. neuronal ion channel clustering Source: RGD
    3. receptor clustering Source: RGD

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Disks large homolog 2
    Alternative name(s):
    Channel-associated protein of synapse-110
    Short name:
    Chapsyn-110
    Postsynaptic density protein PSD-93
    Gene namesi
    Name:Dlg2
    Synonyms:Dlgh2
    OrganismiRattus norvegicus (Rat)
    Taxonomic identifieri10116 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeRattus
    ProteomesiUP000002494: Unplaced

    Organism-specific databases

    RGDi619895. Dlg2.

    Subcellular locationi

    Membrane; Lipid-anchor. Cell junctionsynapsepostsynaptic cell membranepostsynaptic density. Cell junctionsynapse
    Note: Concentrated in soma and postsynaptic density of a subset of neurons.

    GO - Cellular componenti

    1. cell junction Source: UniProtKB-KW
    2. cytoplasm Source: RGD
    3. dendrite Source: RGD
    4. juxtaparanode region of axon Source: MGI
    5. membrane Source: RGD
    6. neuronal cell body Source: RGD
    7. postsynaptic density Source: UniProtKB
    8. postsynaptic membrane Source: UniProtKB-KW

    Keywords - Cellular componenti

    Cell junction, Cell membrane, Membrane, Postsynaptic cell membrane, Synapse

    Pathology & Biotechi

    Mutagenesis

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Mutagenesisi5 – 51C → S: Loss of palmitoylation and targeting to postsynaptic density. 1 Publication
    Mutagenesisi7 – 71C → S: Loss of palmitoylation and targeting to postsynaptic density. 1 Publication

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 852852Disks large homolog 2PRO_0000094555Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Lipidationi5 – 51S-palmitoyl cysteine1 Publication
    Lipidationi7 – 71S-palmitoyl cysteine1 Publication
    Modified residuei28 – 281PhosphoserineBy similarity
    Modified residuei58 – 581PhosphotyrosineBy similarity
    Modified residuei65 – 651PhosphoserineBy similarity
    Modified residuei414 – 4141PhosphoserineBy similarity
    Modified residuei505 – 5051PhosphotyrosineBy similarity
    Modified residuei732 – 7321PhosphotyrosineBy similarity
    Modified residuei737 – 7371PhosphotyrosineBy similarity

    Post-translational modificationi

    Palmitoylation of isoform 1 and isoform 2 is not required for targeting to postsynaptic density.1 Publication

    Keywords - PTMi

    Lipoprotein, Palmitate, Phosphoprotein

    Proteomic databases

    PaxDbiQ63622.
    PRIDEiQ63622.

    PTM databases

    PhosphoSiteiQ63622.

    Expressioni

    Tissue specificityi

    Brain. High levels in cerebellar Purkinje cells. Expressed in pyramidal cells of the Ammons's horn and granular cells of the dentate gyrus in the hippocampus as well as cerebral cortex and striatum. High levels in dorsal horn of spinal cord.2 Publications

    Developmental stagei

    High levels in developing brain and spinal chord, sensory neurons of dorsal root and trigeminal ganglia, myenteric neurons of the intestine as well as in non-neuronal cells of adrenal, thymus and submandibular glands of E15 embryos.1 Publication

    Gene expression databases

    GenevestigatoriQ63622.

    Interactioni

    Subunit structurei

    Interacts through its PDZ domains with NETO1. Interacts with NOS1/nNOS through second PDZ domain. Interacts with KCNJ2/Kir2.1 (via C-terminus) through one of its PDZ domains By similarity. Interacts with KCNJ4 By similarity. Interacts with FRMPD4 (via C-terminus). Interacts with LRFN1. Interacts with LRFN2 and LRFN4. Interacts with FASLG By similarity.By similarity

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    ATP2B2Q01814-12EBI-396947,EBI-1174262From a different organism.
    ATP2B4P23634-62EBI-396947,EBI-1174437From a different organism.
    DgkiQ810C53EBI-396947,EBI-8523614
    DgkzO085604EBI-396947,EBI-8570505
    KIF1BO60333-33EBI-396947,EBI-465669From a different organism.
    Map1aP349264EBI-396947,EBI-631571

    Protein-protein interaction databases

    BioGridi248965. 7 interactions.
    IntActiQ63622. 15 interactions.
    MINTiMINT-155119.

    Structurei

    Secondary structure

    1
    852
    Legend: HelixTurnBeta strand
    Show more details
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Beta strandi93 – 10210
    Beta strandi109 – 1135
    Helixi121 – 1233
    Beta strandi127 – 1326
    Helixi137 – 1415
    Beta strandi149 – 1535
    Helixi163 – 17210
    Beta strandi175 – 18410

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    EntryMethodResolution (Å)ChainPositionsPDBsum
    4H11X-ray1.67A/B93-188[»]
    ProteinModelPortaliQ63622.
    SMRiQ63622. Positions 95-185, 190-283, 418-514, 539-852.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini98 – 18487PDZ 1PROSITE-ProRule annotationAdd
    BLAST
    Domaini193 – 27987PDZ 2PROSITE-ProRule annotationAdd
    BLAST
    Domaini421 – 50181PDZ 3PROSITE-ProRule annotationAdd
    BLAST
    Domaini536 – 60671SH3PROSITE-ProRule annotationAdd
    BLAST
    Domaini662 – 837176Guanylate kinase-likePROSITE-ProRule annotationAdd
    BLAST

    Sequence similaritiesi

    Belongs to the MAGUK family.Curated
    Contains 1 guanylate kinase-like domain.PROSITE-ProRule annotation
    Contains 3 PDZ (DHR) domains.PROSITE-ProRule annotation
    Contains 1 SH3 domain.PROSITE-ProRule annotation

    Keywords - Domaini

    Repeat, SH3 domain

    Phylogenomic databases

    eggNOGiCOG0194.
    HOGENOMiHOG000232102.
    HOVERGENiHBG107814.
    KOiK12075.

    Family and domain databases

    Gene3Di2.30.42.10. 3 hits.
    3.40.50.300. 2 hits.
    InterProiIPR016313. DLG1.
    IPR008145. GK/Ca_channel_bsu.
    IPR008144. Guanylate_kin-like.
    IPR020590. Guanylate_kinase_CS.
    IPR019590. MAGUK_PEST_N.
    IPR027417. P-loop_NTPase.
    IPR001478. PDZ.
    IPR019583. PDZ_assoc.
    IPR011511. SH3_2.
    IPR001452. SH3_domain.
    [Graphical view]
    PANTHERiPTHR23119. PTHR23119. 1 hit.
    PfamiPF00625. Guanylate_kin. 1 hit.
    PF10608. MAGUK_N_PEST. 1 hit.
    PF00595. PDZ. 3 hits.
    PF10600. PDZ_assoc. 1 hit.
    PF07653. SH3_2. 1 hit.
    [Graphical view]
    PIRSFiPIRSF001741. MAGUK_DLGH. 1 hit.
    SMARTiSM00072. GuKc. 1 hit.
    SM00228. PDZ. 3 hits.
    SM00326. SH3. 1 hit.
    [Graphical view]
    SUPFAMiSSF50044. SSF50044. 2 hits.
    SSF50156. SSF50156. 3 hits.
    SSF52540. SSF52540. 1 hit.
    PROSITEiPS00856. GUANYLATE_KINASE_1. 1 hit.
    PS50052. GUANYLATE_KINASE_2. 1 hit.
    PS50106. PDZ. 3 hits.
    PS50002. SH3. 1 hit.
    [Graphical view]

    Sequences (7)i

    Sequence statusi: Complete.

    This entry describes 7 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q63622-1) [UniParc]FASTAAdd to Basket

    Also known as: PSD-93b

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MFFACYCALR TNVKKYRYQD EDGPHDHSLP RLTHEVRGPE LVHVSEKNLS    50
    QIENVHGYVL QSHISPLKAS PAPIIVNTDT LDTIPYVNGT EIEYEFEEIT 100
    LERGNSGLGF SIAGGTDNPH IGDDPGIFIT KIIPGGAAAE DGRLRVNDCI 150
    LRVNEVDVSE VSHSKAVEAL KEAGSIVRLY VRRRRPILET VVEIKLFKGP 200
    KGLGFSIAGG VGNQHIPGDN SIYVTKIIDG GAAQKDGRLQ VGDRLLMVNN 250
    YSLEEVTHEE AVAILKNTSD VVYLKVGKPT TIYMTDPYGP PDITHSYSPP 300
    MENHLLSGNN GTLEYKTSLP PISPGRYSPI PKHMLVEDDY TRPPEPVYST 350
    VNKLCDKPAS PRHYSPVECD KSFLLSTPYP HYHLGLLPDS DMTSHSQHST 400
    ATRQPSVTLQ RAISLEGEPR KVVLHKGSTG LGFNIVGGED GEGIFVSFIL 450
    AGGPADLSGE LQRGDQILSV NGIDLRGASH EQAAAALKGA GQTVTIIAQY 500
    QPEDYARFEA KIHDLREQMM NHSMSSGSGS LRTNQKRSLY VRAMFDYDKS 550
    KDSGLPSQGL SFKYGDILHV INASDDEWWQ ARRVILDGDS EEMGVIPSKR 600
    RVERKERARL KTVKFNAKPG VIDSKGDIPG LGDDGYGTKT LRGQEDLILS 650
    YEPVTRQEIN YTRPVIILGP MKDRINDDLI SEFPDKFGSC VPHTTRPKRD 700
    YEVDGRDYHF VISREQMEKD IQEHKFIEAG QYNDNLYGTS VQSVRFVAER 750
    GKHCILDVSG NAIKRLQVAQ LYPIAIFIKP KSLEPLMEMN KRLTEEQAKK 800
    TYDRAIKLEQ EFGEYFTAIV QGDTLEDIYN QCKLVIEEQS GPFIWIPSKE 850
    KL 852
    Length:852
    Mass (Da):94,934
    Last modified:November 1, 1997 - v1
    Checksum:iF8D414A8B9CF5B09
    GO
    Isoform 2 (identifier: Q63622-2) [UniParc]FASTAAdd to Basket

    Also known as: PSD-93a

    The sequence of this isoform differs from the canonical sequence as follows:
         1-13: MFFACYCALRTNV → MICHCKVACTNNTLSLMFGC

    Show »
    Length:859
    Mass (Da):95,585
    Checksum:i4843703C194A1CE8
    GO
    Isoform 3 (identifier: Q63622-3) [UniParc]FASTAAdd to Basket

    Also known as: PSD-93c

    The sequence of this isoform differs from the canonical sequence as follows:
         1-61: Missing.
         62-68: SHISPLK → MQHAFIP
         341-392: Missing.

    Show »
    Length:739
    Mass (Da):81,962
    Checksum:i6C33B93499B8E70A
    GO
    Isoform 4 (identifier: Q63622-4) [UniParc]FASTAAdd to Basket

    Also known as: PSD-93-delta

    The sequence of this isoform differs from the canonical sequence as follows:
         1-68: MFFACYCALR...VLQSHISPLK → MNAYLTKQHS...CPHGWFSPAQ

    Show »
    Length:887
    Mass (Da):97,938
    Checksum:iFBB0E9EF8F855A59
    GO
    Isoform 5 (identifier: Q63622-5) [UniParc]FASTAAdd to Basket

    Also known as: PSD-93d

    The sequence of this isoform differs from the canonical sequence as follows:
         1-246: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:606
    Mass (Da):68,062
    Checksum:iF87FF88D002EA965
    GO
    Isoform 6 (identifier: Q63622-6) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         450-454: Missing.
         626-641: Missing.

    Show »
    Length:831
    Mass (Da):92,978
    Checksum:i0B9B45B7A317B263
    GO
    Isoform 7 (identifier: Q63622-7) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         626-641: GDIPGLGDDGYGTKTL → GSFNDKRKKSFIFSRKFPFYKNKEQSEQETSDPE

    Show »
    Length:870
    Mass (Da):97,486
    Checksum:iA6890D04BE125927
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti181 – 1822VR → IL in AAC52643. (PubMed:8625413)Curated
    Sequence conflicti228 – 2281I → M in AAC52643. (PubMed:8625413)Curated
    Sequence conflicti326 – 3261R → K in AAC52643. (PubMed:8625413)Curated
    Sequence conflicti339 – 3391D → E in AAB48562. 1 PublicationCurated
    Sequence conflicti464 – 4652GD → RK in AAC52643. (PubMed:8625413)Curated
    Sequence conflicti474 – 4741D → H(PubMed:8625413)Curated
    Sequence conflicti476 – 4761R → P(PubMed:8625413)Curated
    Sequence conflicti478 – 4781A → D(PubMed:8625413)Curated
    Sequence conflicti484 – 4863AAA → LP in AAC52643. (PubMed:8625413)Curated
    Sequence conflicti506 – 5061A → S in AAC52643. (PubMed:8625413)Curated
    Sequence conflicti569 – 5691H → N in AAC52643. (PubMed:8625413)Curated
    Sequence conflicti586 – 5861L → Q in AAC52643. (PubMed:8625413)Curated
    Sequence conflicti627 – 6304DIPG → TSR(PubMed:8922396)Curated
    Sequence conflicti639 – 6391K → A in AAB48562. 1 PublicationCurated
    Sequence conflicti726 – 7261F → L in AAB53243. (PubMed:8755482)Curated
    Sequence conflicti733 – 7331N → Y in AAC52643. (PubMed:8625413)Curated
    Sequence conflicti749 – 7491E → V in AAB53243. (PubMed:8755482)Curated
    Sequence conflicti756 – 7561L → H in AAC52643. (PubMed:8625413)Curated
    Sequence conflicti791 – 7922KR → NG(PubMed:8625413)Curated
    Sequence conflicti794 – 7941T → M(PubMed:8625413)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 246246Missing in isoform 5. 1 PublicationVSP_015525Add
    BLAST
    Alternative sequencei1 – 6868MFFAC…ISPLK → MNAYLTKQHSCSRGSDGMDA GRGVPTLIRDAHCACGWQRN AQGLGYSSQTMPSSGPGGPA SNRTKLVTLWDSVRKSPHKT STKGKGNCGERCACPHGWFS PAQ in isoform 4. CuratedVSP_015526Add
    BLAST
    Alternative sequencei1 – 6161Missing in isoform 3. 1 PublicationVSP_015527Add
    BLAST
    Alternative sequencei1 – 1313MFFAC…LRTNV → MICHCKVACTNNTLSLMFGC in isoform 2. 1 PublicationVSP_015528Add
    BLAST
    Alternative sequencei62 – 687SHISPLK → MQHAFIP in isoform 3. 1 PublicationVSP_015529
    Alternative sequencei341 – 39252Missing in isoform 3. 1 PublicationVSP_015530Add
    BLAST
    Alternative sequencei450 – 4545Missing in isoform 6. 1 PublicationVSP_015531
    Alternative sequencei626 – 64116Missing in isoform 6. 1 PublicationVSP_015533Add
    BLAST
    Alternative sequencei626 – 64116GDIPG…GTKTL → GSFNDKRKKSFIFSRKFPFY KNKEQSEQETSDPE in isoform 7. CuratedVSP_015532Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    U49049 mRNA. Translation: AAB53243.1.
    U50717 mRNA. Translation: AAC52643.1.
    U53368 mRNA. Translation: AAB48562.1.
    PIRiT10811.
    RefSeqiNP_071618.1. NM_022282.1.
    UniGeneiRn.202966.

    Genome annotation databases

    GeneIDi64053.
    KEGGirno:64053.
    UCSCiRGD:619895. rat. [Q63622-1]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    U49049 mRNA. Translation: AAB53243.1 .
    U50717 mRNA. Translation: AAC52643.1 .
    U53368 mRNA. Translation: AAB48562.1 .
    PIRi T10811.
    RefSeqi NP_071618.1. NM_022282.1.
    UniGenei Rn.202966.

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    Entry Method Resolution (Å) Chain Positions PDBsum
    4H11 X-ray 1.67 A/B 93-188 [» ]
    ProteinModelPortali Q63622.
    SMRi Q63622. Positions 95-185, 190-283, 418-514, 539-852.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 248965. 7 interactions.
    IntActi Q63622. 15 interactions.
    MINTi MINT-155119.

    PTM databases

    PhosphoSitei Q63622.

    Proteomic databases

    PaxDbi Q63622.
    PRIDEi Q63622.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    GeneIDi 64053.
    KEGGi rno:64053.
    UCSCi RGD:619895. rat. [Q63622-1 ]

    Organism-specific databases

    CTDi 1740.
    RGDi 619895. Dlg2.

    Phylogenomic databases

    eggNOGi COG0194.
    HOGENOMi HOG000232102.
    HOVERGENi HBG107814.
    KOi K12075.

    Miscellaneous databases

    NextBioi 612717.
    PROi Q63622.

    Gene expression databases

    Genevestigatori Q63622.

    Family and domain databases

    Gene3Di 2.30.42.10. 3 hits.
    3.40.50.300. 2 hits.
    InterProi IPR016313. DLG1.
    IPR008145. GK/Ca_channel_bsu.
    IPR008144. Guanylate_kin-like.
    IPR020590. Guanylate_kinase_CS.
    IPR019590. MAGUK_PEST_N.
    IPR027417. P-loop_NTPase.
    IPR001478. PDZ.
    IPR019583. PDZ_assoc.
    IPR011511. SH3_2.
    IPR001452. SH3_domain.
    [Graphical view ]
    PANTHERi PTHR23119. PTHR23119. 1 hit.
    Pfami PF00625. Guanylate_kin. 1 hit.
    PF10608. MAGUK_N_PEST. 1 hit.
    PF00595. PDZ. 3 hits.
    PF10600. PDZ_assoc. 1 hit.
    PF07653. SH3_2. 1 hit.
    [Graphical view ]
    PIRSFi PIRSF001741. MAGUK_DLGH. 1 hit.
    SMARTi SM00072. GuKc. 1 hit.
    SM00228. PDZ. 3 hits.
    SM00326. SH3. 1 hit.
    [Graphical view ]
    SUPFAMi SSF50044. SSF50044. 2 hits.
    SSF50156. SSF50156. 3 hits.
    SSF52540. SSF52540. 1 hit.
    PROSITEi PS00856. GUANYLATE_KINASE_1. 1 hit.
    PS50052. GUANYLATE_KINASE_2. 1 hit.
    PS50106. PDZ. 3 hits.
    PS50002. SH3. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Heteromultimerization and NMDA receptor-clustering activity of Chapsyn-110, a member of the PSD-95 family of proteins."
      Kim E., Cho K.-O., Rothschild A., Sheng M.
      Neuron 17:103-113(1996) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    2. "Interaction of nitric oxide synthase with the postsynaptic density protein PSD-95 and alpha1-syntrophin mediated by PDZ domains."
      Brenman J.E., Chao D.S., Gee S.H., McGee A.W., Craven S.E., Santillano D.R., Wu Z., Huang F., Xia H., Peters M.F., Froehner S.C., Bredt D.S.
      Cell 84:757-767(1996) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 6).
    3. Irie M., Hata Y., Takai Y.
      Submitted (SEP-1996) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    4. "An alternatively spliced isoform of PSD-93/chapsyn 110 binds to the inwardly rectifying potassium channel, Kir2.1."
      Leyland M.L., Dart C.
      J. Biol. Chem. 279:43427-43436(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: PARTIAL NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4), TISSUE SPECIFICITY.
    5. "Cloning and characterization of postsynaptic density 93, a nitric oxide synthase interacting protein."
      Brenman J.E., Christopherson K.S., Craven S.E., McGee A.W., Bredt D.S.
      J. Neurosci. 16:7407-7415(1996) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3 AND 5), SUBCELLULAR LOCATION, TISSUE SPECIFICITY, DEVELOPMENTAL STAGE, INTERACTION WITH NOS1.
    6. "Ion channel clustering by membrane-associated guanylate kinases. Differential regulation by N-terminal lipid and metal binding motifs."
      El-Husseini A.E., Topinka J.R., Lehrer-Graiwer J.E., Firestein B.L., Craven S.E., Aoki C., Bredt D.S.
      J. Biol. Chem. 275:23904-23910(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: MUTAGENESIS OF CYS-5 AND CYS-7, PALMITOYLATION AT CYS-5 AND CYS-7.
    7. "Postsynaptic targeting of MAGUKs mediated by distinct N-terminal domains."
      Firestein B.L., Craven S.E., Bredt D.S.
      NeuroReport 11:3479-3484(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: SUBCELLULAR LOCATION.
    8. "SALM synaptic cell adhesion-like molecules regulate the differentiation of excitatory synapses."
      Ko J., Kim S., Chung H.S., Kim K., Han K., Kim H., Jun H., Kaang B.-K., Kim E.
      Neuron 50:233-245(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH LRFN1.
    9. "Preso, a novel PSD-95-interacting FERM and PDZ domain protein that regulates dendritic spine morphogenesis."
      Lee H.W., Choi J., Shin H., Kim K., Yang J., Na M., Choi S.Y., Kang G.B., Eom S.H., Kim H., Kim E.
      J. Neurosci. 28:14546-14556(2008) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH FRMPD4.

    Entry informationi

    Entry nameiDLG2_RAT
    AccessioniPrimary (citable) accession number: Q63622
    Secondary accession number(s): P70548, Q62939
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: November 1, 1997
    Last sequence update: November 1, 1997
    Last modified: October 1, 2014
    This is version 132 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Reference proteome

    Documents

    1. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    2. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3