Q63622 (DLG2_RAT) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 29, 2013.
Version 118.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Disks large homolog 2 Alternative name(s): Channel-associated protein of synapse-110 Short name=Chapsyn-110 Postsynaptic density protein PSD-93 | ||||
| Gene names |
| ||||
| Organism | Rattus norvegicus (Rat) [Reference proteome] | ||||
| Taxonomic identifier | 10116 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Rattus![]() |
Protein attributes
| Sequence length | 852 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Required for perception of chronic pain through NMDA receptor signaling. Regulates surface expression of NMDA receptors in dorsal horn neurons of the spinal cord. Interacts with the cytoplasmic tail of NMDA receptor subunits as well as inward rectifying potassium channels. Involved in regulation of synaptic stability at cholinergic synapses. Part of the postsynaptic protein scaffold of excitatory synapses By similarity. |
| Subunit structure | Interacts through its PDZ domains with NETO1. Interacts with NOS1/nNOS through second PDZ domain. Interacts with KCNJ2/Kir2.1 (via C-terminus) through one of its PDZ domains By similarity. Interacts with FRMPD4 (via C-terminus). Interacts with LRFN1. Interacts with LRFN2 and LRFN4. Interacts with FASLG By similarity. Ref.5 Ref.8 Ref.9 |
| Subcellular location | Membrane; Lipid-anchor. Cell junction › synapse › postsynaptic cell membrane › postsynaptic density. Cell junction › synapse. Note: Concentrated in soma and postsynaptic density of a subset of neurons. Ref.5 Ref.7 |
| Tissue specificity | Brain. High levels in cerebellar Purkinje cells. Expressed in pyramidal cells of the Ammons's horn and granular cells of the dentate gyrus in the hippocampus as well as cerebral cortex and striatum. High levels in dorsal horn of spinal cord. Ref.4 Ref.5 |
| Developmental stage | High levels in developing brain and spinal chord, sensory neurons of dorsal root and trigeminal ganglia, myenteric neurons of the intestine as well as in non-neuronal cells of adrenal, thymus and submandibular glands of E15 embryos. Ref.5 |
| Post-translational modification | Palmitoylation of isoform 1 and isoform 2 is not required for targeting to postsynaptic density. Ref.6 |
| Sequence similarities | Belongs to the MAGUK family. Contains 1 guanylate kinase-like domain. Contains 3 PDZ (DHR) domains. Contains 1 SH3 domain. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| ATP2B2 | Q01814-1 | 2 | EBI-396947,EBI-1174262 | From a different organism. |
| ATP2B4 | P23634-6 | 2 | EBI-396947,EBI-1174437 | From a different organism. |
| KIF1B | O60333-3 | 3 | EBI-396947,EBI-465669 | From a different organism. |
| Map1a | P34926 | 4 | EBI-396947,EBI-631571 |
Alternative products
| This entry describes 7 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q63622-1) Also known as: PSD-93b; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q63622-2) Also known as: PSD-93a; The sequence of this isoform differs from the canonical sequence as follows: 1-13: MFFACYCALRTNV → MICHCKVACTNNTLSLMFGC | ||||||
| Isoform 3 (identifier: Q63622-3) Also known as: PSD-93c; The sequence of this isoform differs from the canonical sequence as follows: 1-61: Missing. 62-68: SHISPLK → MQHAFIP 341-392: Missing. | ||||||
| Isoform 4 (identifier: Q63622-4) Also known as: PSD-93-delta; The sequence of this isoform differs from the canonical sequence as follows: 1-68: MFFACYCALR...VLQSHISPLK → MNAYLTKQHS...CPHGWFSPAQ | ||||||
| Isoform 5 (identifier: Q63622-5) Also known as: PSD-93d; The sequence of this isoform differs from the canonical sequence as follows: 1-246: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 6 (identifier: Q63622-6) The sequence of this isoform differs from the canonical sequence as follows: 450-454: Missing. 626-641: Missing. | ||||||
| Isoform 7 (identifier: Q63622-7) The sequence of this isoform differs from the canonical sequence as follows: 626-641: GDIPGLGDDGYGTKTL → GSFNDKRKKSFIFSRKFPFYKNKEQSEQETSDPE |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 852 | 852 | Disks large homolog 2 | PRO_0000094555 | |||||
Regions | |||||||||
| Domain | 98 – 184 | 87 | PDZ 1 | ||||||
| Domain | 193 – 279 | 87 | PDZ 2 | ||||||
| Domain | 421 – 501 | 81 | PDZ 3 | ||||||
| Domain | 536 – 606 | 71 | SH3 | ||||||
| Domain | 662 – 837 | 176 | Guanylate kinase-like | ||||||
Amino acid modifications | |||||||||
| Modified residue | 28 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 58 | 1 | Phosphotyrosine By similarity | ||||||
| Modified residue | 62 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 175 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 340 | 1 | Phosphotyrosine By similarity | ||||||
| Modified residue | 348 | 1 | Phosphotyrosine By similarity | ||||||
| Modified residue | 365 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 406 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 414 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 500 | 1 | Phosphotyrosine By similarity | ||||||
| Modified residue | 505 | 1 | Phosphotyrosine By similarity | ||||||
| Modified residue | 732 | 1 | Phosphotyrosine By similarity | ||||||
| Modified residue | 737 | 1 | Phosphotyrosine By similarity | ||||||
| Lipidation | 5 | 1 | S-palmitoyl cysteine Ref.6 | ||||||
| Lipidation | 7 | 1 | S-palmitoyl cysteine Ref.6 | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 246 | 246 | Missing in isoform 5. | VSP_015525 | |||||
| Alternative sequence | 1 – 68 | 68 | MFFAC…ISPLK → MNAYLTKQHSCSRGSDGMDA GRGVPTLIRDAHCACGWQRN AQGLGYSSQTMPSSGPGGPA SNRTKLVTLWDSVRKSPHKT STKGKGNCGERCACPHGWFS PAQ in isoform 4. | VSP_015526 | |||||
| Alternative sequence | 1 – 61 | 61 | Missing in isoform 3. | VSP_015527 | |||||
| Alternative sequence | 1 – 13 | 13 | MFFAC…LRTNV → MICHCKVACTNNTLSLMFGC in isoform 2. | VSP_015528 | |||||
| Alternative sequence | 62 – 68 | 7 | SHISPLK → MQHAFIP in isoform 3. | VSP_015529 | |||||
| Alternative sequence | 341 – 392 | 52 | Missing in isoform 3. | VSP_015530 | |||||
| Alternative sequence | 450 – 454 | 5 | Missing in isoform 6. | VSP_015531 | |||||
| Alternative sequence | 626 – 641 | 16 | Missing in isoform 6. | VSP_015533 | |||||
| Alternative sequence | 626 – 641 | 16 | GDIPG…GTKTL → GSFNDKRKKSFIFSRKFPFY KNKEQSEQETSDPE in isoform 7. | VSP_015532 | |||||
Experimental info | |||||||||
| Mutagenesis | 5 | 1 | C → S: Loss of palmitoylation and targeting to postsynaptic density. Ref.6 | ||||||
| Mutagenesis | 7 | 1 | C → S: Loss of palmitoylation and targeting to postsynaptic density. Ref.6 | ||||||
| Sequence conflict | 181 – 182 | 2 | VR → IL in AAC52643. Ref.2 | ||||||
| Sequence conflict | 228 | 1 | I → M in AAC52643. Ref.2 | ||||||
| Sequence conflict | 326 | 1 | R → K in AAC52643. Ref.2 | ||||||
| Sequence conflict | 339 | 1 | D → E in AAB48562. Ref.3 | ||||||
| Sequence conflict | 464 – 465 | 2 | GD → RK in AAC52643. Ref.2 | ||||||
| Sequence conflict | 474 | 1 | D → H Ref.2 | ||||||
| Sequence conflict | 476 | 1 | R → P Ref.2 | ||||||
| Sequence conflict | 478 | 1 | A → D Ref.2 | ||||||
| Sequence conflict | 484 – 486 | 3 | AAA → LP in AAC52643. Ref.2 | ||||||
| Sequence conflict | 506 | 1 | A → S in AAC52643. Ref.2 | ||||||
| Sequence conflict | 569 | 1 | H → N in AAC52643. Ref.2 | ||||||
| Sequence conflict | 586 | 1 | L → Q in AAC52643. Ref.2 | ||||||
| Sequence conflict | 627 – 630 | 4 | DIPG → TSR Ref.5 | ||||||
| Sequence conflict | 639 | 1 | K → A in AAB48562. Ref.3 | ||||||
| Sequence conflict | 726 | 1 | F → L in AAB53243. Ref.1 | ||||||
| Sequence conflict | 733 | 1 | N → Y in AAC52643. Ref.2 | ||||||
| Sequence conflict | 749 | 1 | E → V in AAB53243. Ref.1 | ||||||
| Sequence conflict | 756 | 1 | L → H in AAC52643. Ref.2 | ||||||
| Sequence conflict | 791 – 792 | 2 | KR → NG Ref.2 | ||||||
| Sequence conflict | 794 | 1 | T → M Ref.2 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| [1] | "Heteromultimerization and NMDA receptor-clustering activity of Chapsyn-110, a member of the PSD-95 family of proteins." Kim E., Cho K.-O., Rothschild A., Sheng M. Neuron 17:103-113(1996) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [2] | "Interaction of nitric oxide synthase with the postsynaptic density protein PSD-95 and alpha1-syntrophin mediated by PDZ domains." Brenman J.E., Chao D.S., Gee S.H., McGee A.W., Craven S.E., Santillano D.R., Wu Z., Huang F., Xia H., Peters M.F., Froehner S.C., Bredt D.S. Cell 84:757-767(1996) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 6). |
| [3] | Irie M., Hata Y., Takai Y. Submitted (SEP-1996) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [4] | "An alternatively spliced isoform of PSD-93/chapsyn 110 binds to the inwardly rectifying potassium channel, Kir2.1." Leyland M.L., Dart C. J. Biol. Chem. 279:43427-43436(2004) [PubMed] [Europe PMC] [Abstract] Cited for: PARTIAL NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4), TISSUE SPECIFICITY. |
| [5] | "Cloning and characterization of postsynaptic density 93, a nitric oxide synthase interacting protein." Brenman J.E., Christopherson K.S., Craven S.E., McGee A.W., Bredt D.S. J. Neurosci. 16:7407-7415(1996) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3 AND 5), SUBCELLULAR LOCATION, TISSUE SPECIFICITY, DEVELOPMENTAL STAGE, INTERACTION WITH NOS1. |
| [6] | "Ion channel clustering by membrane-associated guanylate kinases. Differential regulation by N-terminal lipid and metal binding motifs." El-Husseini A.E., Topinka J.R., Lehrer-Graiwer J.E., Firestein B.L., Craven S.E., Aoki C., Bredt D.S. J. Biol. Chem. 275:23904-23910(2000) [PubMed] [Europe PMC] [Abstract] Cited for: MUTAGENESIS OF CYS-5 AND CYS-7, PALMITOYLATION AT CYS-5 AND CYS-7. |
| [7] | "Postsynaptic targeting of MAGUKs mediated by distinct N-terminal domains." Firestein B.L., Craven S.E., Bredt D.S. NeuroReport 11:3479-3484(2000) [PubMed] [Europe PMC] [Abstract] Cited for: SUBCELLULAR LOCATION. |
| [8] | "SALM synaptic cell adhesion-like molecules regulate the differentiation of excitatory synapses." Ko J., Kim S., Chung H.S., Kim K., Han K., Kim H., Jun H., Kaang B.-K., Kim E. Neuron 50:233-245(2006) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH LRFN1. |
| [9] | "Preso, a novel PSD-95-interacting FERM and PDZ domain protein that regulates dendritic spine morphogenesis." Lee H.W., Choi J., Shin H., Kim K., Yang J., Na M., Choi S.Y., Kang G.B., Eom S.H., Kim H., Kim E. J. Neurosci. 28:14546-14556(2008) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH FRMPD4. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | U49049 mRNA. Translation: AAB53243.1. U50717 mRNA. Translation: AAC52643.1. U53368 mRNA. Translation: AAB48562.1. | ||||||||||||
| IPI | IPI00327448. IPI00650085. IPI00650088. IPI00650099. IPI00650104. IPI00650105. IPI00650109. | ||||||||||||
| PIR | T10811. | ||||||||||||
| RefSeq | NP_071618.1. NM_022282.1. | ||||||||||||
| UniGene | Rn.202966. | ||||||||||||
3D structure databases | |||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||
| ProteinModelPortal | Q63622. | ||||||||||||
| SMR | Q63622. Positions 95-185, 190-283, 418-514, 539-852. | ||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| IntAct | Q63622. 8 interactions. | ||||||||||||
| MINT | MINT-155119. | ||||||||||||
PTM databases | |||||||||||||
| PhosphoSite | Q63622. | ||||||||||||
Proteomic databases | |||||||||||||
| PaxDb | Q63622. | ||||||||||||
| PRIDE | Q63622. | ||||||||||||
Protocols and materials databases | |||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||
Genome annotation databases | |||||||||||||
| GeneID | 64053. | ||||||||||||
| KEGG | rno:64053. | ||||||||||||
| UCSC | RGD:619895. rat. | ||||||||||||
Organism-specific databases | |||||||||||||
| CTD | 1740. | ||||||||||||
| RGD | 619895. Dlg2. | ||||||||||||
Phylogenomic databases | |||||||||||||
| eggNOG | COG0194. | ||||||||||||
| HOGENOM | HOG000232102. | ||||||||||||
| HOVERGEN | HBG107814. | ||||||||||||
| KO | K12075. | ||||||||||||
| OrthoDB | EOG447FSN. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | Q63622. | ||||||||||||
| Genevestigator | Q63622. | ||||||||||||
| GermOnline | ENSRNOG00000022635. Rattus norvegicus. | ||||||||||||
Family and domain databases | |||||||||||||
| InterPro | IPR008144. Guanylate_kin. IPR008145. Guanylate_kin/L-typ_Ca_channel. IPR020590. Guanylate_kinase_CS. IPR016313. M-assoc_guanylate_kinase. IPR019590. MAGUK_PEST_N. IPR027417. P-loop_NTPase. IPR001478. PDZ. IPR019583. PDZ_assoc. IPR011511. SH3_2. IPR001452. SH3_domain. [Graphical view] | ||||||||||||
| Pfam | PF00625. Guanylate_kin. 1 hit. PF10608. MAGUK_N_PEST. 1 hit. PF00595. PDZ. 3 hits. PF10600. PDZ_assoc. 1 hit. PF07653. SH3_2. 1 hit. [Graphical view] | ||||||||||||
| PIRSF | PIRSF001741. MAGUK_DLGH. 1 hit. | ||||||||||||
| SMART | SM00072. GuKc. 1 hit. SM00228. PDZ. 3 hits. SM00326. SH3. 1 hit. [Graphical view] | ||||||||||||
| SUPFAM | SSF50156. PDZ. 3 hits. SSF50044. SH3. 1 hit. SSF52540. SSF52540. 1 hit. | ||||||||||||
| PROSITE | PS00856. GUANYLATE_KINASE_1. 1 hit. PS50052. GUANYLATE_KINASE_2. 1 hit. PS50106. PDZ. 3 hits. PS50002. SH3. 1 hit. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other | |||||||||||||
| NextBio | 612717. | ||||||||||||
Entry information
| Entry name | DLG2_RAT | ||||||||
| Accession | Primary (citable) accession number: Q63622 Secondary accession number(s): P70548, Q62939 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
