SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q63622

- DLG2_RAT

UniProt

Q63622 - DLG2_RAT

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Disks large homolog 2
Gene
Dlg2, Dlgh2
Organism
Rattus norvegicus (Rat)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Required for perception of chronic pain through NMDA receptor signaling. Regulates surface expression of NMDA receptors in dorsal horn neurons of the spinal cord. Interacts with the cytoplasmic tail of NMDA receptor subunits as well as inward rectifying potassium channels. Involved in regulation of synaptic stability at cholinergic synapses. Part of the postsynaptic protein scaffold of excitatory synapses By similarity.

GO - Molecular functioni

  1. PDZ domain binding Source: RGD
  2. protein C-terminus binding Source: UniProtKB
  3. protein binding Source: IntAct
  4. protein heterodimerization activity Source: RGD
  5. protein phosphatase binding Source: BHF-UCL
Complete GO annotation...

GO - Biological processi

  1. negative regulation of phosphatase activity Source: UniProtKB
  2. neuronal ion channel clustering Source: RGD
  3. receptor clustering Source: RGD
Complete GO annotation...

Names & Taxonomyi

Protein namesi
Recommended name:
Disks large homolog 2
Alternative name(s):
Channel-associated protein of synapse-110
Short name:
Chapsyn-110
Postsynaptic density protein PSD-93
Gene namesi
Name:Dlg2
Synonyms:Dlgh2
OrganismiRattus norvegicus (Rat)
Taxonomic identifieri10116 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeRattus
ProteomesiUP000002494: Unplaced

Organism-specific databases

RGDi619895. Dlg2.

Subcellular locationi

Membrane; Lipid-anchor. Cell junctionsynapsepostsynaptic cell membranepostsynaptic density. Cell junctionsynapse
Note: Concentrated in soma and postsynaptic density of a subset of neurons.2 Publications

GO - Cellular componenti

  1. cell junction Source: UniProtKB-KW
  2. cytoplasm Source: RGD
  3. dendrite Source: RGD
  4. juxtaparanode region of axon Source: MGI
  5. membrane Source: RGD
  6. neuronal cell body Source: RGD
  7. postsynaptic density Source: UniProtKB
  8. postsynaptic membrane Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Cell junction, Cell membrane, Membrane, Postsynaptic cell membrane, Synapse

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi5 – 51C → S: Loss of palmitoylation and targeting to postsynaptic density. 1 Publication
Mutagenesisi7 – 71C → S: Loss of palmitoylation and targeting to postsynaptic density. 1 Publication

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 852852Disks large homolog 2
PRO_0000094555Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Lipidationi5 – 51S-palmitoyl cysteine1 Publication
Lipidationi7 – 71S-palmitoyl cysteine1 Publication
Modified residuei28 – 281Phosphoserine By similarity
Modified residuei58 – 581Phosphotyrosine By similarity
Modified residuei65 – 651Phosphoserine By similarity
Modified residuei414 – 4141Phosphoserine By similarity
Modified residuei505 – 5051Phosphotyrosine By similarity
Modified residuei732 – 7321Phosphotyrosine By similarity
Modified residuei737 – 7371Phosphotyrosine By similarity

Post-translational modificationi

Palmitoylation of isoform 1 and isoform 2 is not required for targeting to postsynaptic density.1 Publication

Keywords - PTMi

Lipoprotein, Palmitate, Phosphoprotein

Proteomic databases

PaxDbiQ63622.
PRIDEiQ63622.

PTM databases

PhosphoSiteiQ63622.

Expressioni

Tissue specificityi

Brain. High levels in cerebellar Purkinje cells. Expressed in pyramidal cells of the Ammons's horn and granular cells of the dentate gyrus in the hippocampus as well as cerebral cortex and striatum. High levels in dorsal horn of spinal cord.2 Publications

Developmental stagei

High levels in developing brain and spinal chord, sensory neurons of dorsal root and trigeminal ganglia, myenteric neurons of the intestine as well as in non-neuronal cells of adrenal, thymus and submandibular glands of E15 embryos.1 Publication

Gene expression databases

GenevestigatoriQ63622.

Interactioni

Subunit structurei

Interacts through its PDZ domains with NETO1. Interacts with NOS1/nNOS through second PDZ domain. Interacts with KCNJ2/Kir2.1 (via C-terminus) through one of its PDZ domains By similarity. Interacts with KCNJ4 By similarity. Interacts with FRMPD4 (via C-terminus). Interacts with LRFN1. Interacts with LRFN2 and LRFN4. Interacts with FASLG By similarity.3 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
ATP2B2Q01814-12EBI-396947,EBI-1174262From a different organism.
ATP2B4P23634-62EBI-396947,EBI-1174437From a different organism.
DgkiQ810C53EBI-396947,EBI-8523614
DgkzO085604EBI-396947,EBI-8570505
KIF1BO60333-33EBI-396947,EBI-465669From a different organism.
Map1aP349264EBI-396947,EBI-631571

Protein-protein interaction databases

BioGridi248965. 7 interactions.
IntActiQ63622. 15 interactions.
MINTiMINT-155119.

Structurei

Secondary structure

Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Beta strandi93 – 10210
Beta strandi109 – 1135
Helixi121 – 1233
Beta strandi127 – 1326
Helixi137 – 1415
Beta strandi149 – 1535
Helixi163 – 17210
Beta strandi175 – 18410

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
4H11X-ray1.67A/B93-188[»]
ProteinModelPortaliQ63622.
SMRiQ63622. Positions 95-185, 190-283, 418-514, 539-852.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini98 – 18487PDZ 1
Add
BLAST
Domaini193 – 27987PDZ 2
Add
BLAST
Domaini421 – 50181PDZ 3
Add
BLAST
Domaini536 – 60671SH3
Add
BLAST
Domaini662 – 837176Guanylate kinase-like
Add
BLAST

Sequence similaritiesi

Belongs to the MAGUK family.
Contains 3 PDZ (DHR) domains.
Contains 1 SH3 domain.

Keywords - Domaini

Repeat, SH3 domain

Phylogenomic databases

eggNOGiCOG0194.
HOGENOMiHOG000232102.
HOVERGENiHBG107814.
KOiK12075.

Family and domain databases

Gene3Di2.30.42.10. 3 hits.
3.40.50.300. 2 hits.
InterProiIPR016313. DLG1.
IPR008145. GK/Ca_channel_bsu.
IPR008144. Guanylate_kin-like.
IPR020590. Guanylate_kinase_CS.
IPR019590. MAGUK_PEST_N.
IPR027417. P-loop_NTPase.
IPR001478. PDZ.
IPR019583. PDZ_assoc.
IPR011511. SH3_2.
IPR001452. SH3_domain.
[Graphical view]
PANTHERiPTHR23119. PTHR23119. 1 hit.
PfamiPF00625. Guanylate_kin. 1 hit.
PF10608. MAGUK_N_PEST. 1 hit.
PF00595. PDZ. 3 hits.
PF10600. PDZ_assoc. 1 hit.
PF07653. SH3_2. 1 hit.
[Graphical view]
PIRSFiPIRSF001741. MAGUK_DLGH. 1 hit.
SMARTiSM00072. GuKc. 1 hit.
SM00228. PDZ. 3 hits.
SM00326. SH3. 1 hit.
[Graphical view]
SUPFAMiSSF50044. SSF50044. 2 hits.
SSF50156. SSF50156. 3 hits.
SSF52540. SSF52540. 1 hit.
PROSITEiPS00856. GUANYLATE_KINASE_1. 1 hit.
PS50052. GUANYLATE_KINASE_2. 1 hit.
PS50106. PDZ. 3 hits.
PS50002. SH3. 1 hit.
[Graphical view]

Sequences (7)i

Sequence statusi: Complete.

This entry describes 7 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q63622-1) [UniParc]FASTAAdd to Basket

Also known as: PSD-93b

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MFFACYCALR TNVKKYRYQD EDGPHDHSLP RLTHEVRGPE LVHVSEKNLS    50
QIENVHGYVL QSHISPLKAS PAPIIVNTDT LDTIPYVNGT EIEYEFEEIT 100
LERGNSGLGF SIAGGTDNPH IGDDPGIFIT KIIPGGAAAE DGRLRVNDCI 150
LRVNEVDVSE VSHSKAVEAL KEAGSIVRLY VRRRRPILET VVEIKLFKGP 200
KGLGFSIAGG VGNQHIPGDN SIYVTKIIDG GAAQKDGRLQ VGDRLLMVNN 250
YSLEEVTHEE AVAILKNTSD VVYLKVGKPT TIYMTDPYGP PDITHSYSPP 300
MENHLLSGNN GTLEYKTSLP PISPGRYSPI PKHMLVEDDY TRPPEPVYST 350
VNKLCDKPAS PRHYSPVECD KSFLLSTPYP HYHLGLLPDS DMTSHSQHST 400
ATRQPSVTLQ RAISLEGEPR KVVLHKGSTG LGFNIVGGED GEGIFVSFIL 450
AGGPADLSGE LQRGDQILSV NGIDLRGASH EQAAAALKGA GQTVTIIAQY 500
QPEDYARFEA KIHDLREQMM NHSMSSGSGS LRTNQKRSLY VRAMFDYDKS 550
KDSGLPSQGL SFKYGDILHV INASDDEWWQ ARRVILDGDS EEMGVIPSKR 600
RVERKERARL KTVKFNAKPG VIDSKGDIPG LGDDGYGTKT LRGQEDLILS 650
YEPVTRQEIN YTRPVIILGP MKDRINDDLI SEFPDKFGSC VPHTTRPKRD 700
YEVDGRDYHF VISREQMEKD IQEHKFIEAG QYNDNLYGTS VQSVRFVAER 750
GKHCILDVSG NAIKRLQVAQ LYPIAIFIKP KSLEPLMEMN KRLTEEQAKK 800
TYDRAIKLEQ EFGEYFTAIV QGDTLEDIYN QCKLVIEEQS GPFIWIPSKE 850
KL 852
Length:852
Mass (Da):94,934
Last modified:November 1, 1997 - v1
Checksum:iF8D414A8B9CF5B09
GO
Isoform 2 (identifier: Q63622-2) [UniParc]FASTAAdd to Basket

Also known as: PSD-93a

The sequence of this isoform differs from the canonical sequence as follows:
     1-13: MFFACYCALRTNV → MICHCKVACTNNTLSLMFGC

Show »
Length:859
Mass (Da):95,585
Checksum:i4843703C194A1CE8
GO
Isoform 3 (identifier: Q63622-3) [UniParc]FASTAAdd to Basket

Also known as: PSD-93c

The sequence of this isoform differs from the canonical sequence as follows:
     1-61: Missing.
     62-68: SHISPLK → MQHAFIP
     341-392: Missing.

Show »
Length:739
Mass (Da):81,962
Checksum:i6C33B93499B8E70A
GO
Isoform 4 (identifier: Q63622-4) [UniParc]FASTAAdd to Basket

Also known as: PSD-93-delta

The sequence of this isoform differs from the canonical sequence as follows:
     1-68: MFFACYCALR...VLQSHISPLK → MNAYLTKQHS...CPHGWFSPAQ

Show »
Length:887
Mass (Da):97,938
Checksum:iFBB0E9EF8F855A59
GO
Isoform 5 (identifier: Q63622-5) [UniParc]FASTAAdd to Basket

Also known as: PSD-93d

The sequence of this isoform differs from the canonical sequence as follows:
     1-246: Missing.

Note: No experimental confirmation available.

Show »
Length:606
Mass (Da):68,062
Checksum:iF87FF88D002EA965
GO
Isoform 6 (identifier: Q63622-6) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     450-454: Missing.
     626-641: Missing.

Show »
Length:831
Mass (Da):92,978
Checksum:i0B9B45B7A317B263
GO
Isoform 7 (identifier: Q63622-7) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     626-641: GDIPGLGDDGYGTKTL → GSFNDKRKKSFIFSRKFPFYKNKEQSEQETSDPE

Show »
Length:870
Mass (Da):97,486
Checksum:iA6890D04BE125927
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 246246Missing in isoform 5.
VSP_015525Add
BLAST
Alternative sequencei1 – 6868MFFAC…ISPLK → MNAYLTKQHSCSRGSDGMDA GRGVPTLIRDAHCACGWQRN AQGLGYSSQTMPSSGPGGPA SNRTKLVTLWDSVRKSPHKT STKGKGNCGERCACPHGWFS PAQ in isoform 4.
VSP_015526Add
BLAST
Alternative sequencei1 – 6161Missing in isoform 3.
VSP_015527Add
BLAST
Alternative sequencei1 – 1313MFFAC…LRTNV → MICHCKVACTNNTLSLMFGC in isoform 2.
VSP_015528Add
BLAST
Alternative sequencei62 – 687SHISPLK → MQHAFIP in isoform 3.
VSP_015529
Alternative sequencei341 – 39252Missing in isoform 3.
VSP_015530Add
BLAST
Alternative sequencei450 – 4545Missing in isoform 6.
VSP_015531
Alternative sequencei626 – 64116Missing in isoform 6.
VSP_015533Add
BLAST
Alternative sequencei626 – 64116GDIPG…GTKTL → GSFNDKRKKSFIFSRKFPFY KNKEQSEQETSDPE in isoform 7.
VSP_015532Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti181 – 1822VR → IL in AAC52643. 1 Publication
Sequence conflicti228 – 2281I → M in AAC52643. 1 Publication
Sequence conflicti326 – 3261R → K in AAC52643. 1 Publication
Sequence conflicti339 – 3391D → E in AAB48562. 1 Publication
Sequence conflicti464 – 4652GD → RK in AAC52643. 1 Publication
Sequence conflicti474 – 4741D → H1 Publication
Sequence conflicti476 – 4761R → P1 Publication
Sequence conflicti478 – 4781A → D1 Publication
Sequence conflicti484 – 4863AAA → LP in AAC52643. 1 Publication
Sequence conflicti506 – 5061A → S in AAC52643. 1 Publication
Sequence conflicti569 – 5691H → N in AAC52643. 1 Publication
Sequence conflicti586 – 5861L → Q in AAC52643. 1 Publication
Sequence conflicti627 – 6304DIPG → TSR1 Publication
Sequence conflicti639 – 6391K → A in AAB48562. 1 Publication
Sequence conflicti726 – 7261F → L in AAB53243. 1 Publication
Sequence conflicti733 – 7331N → Y in AAC52643. 1 Publication
Sequence conflicti749 – 7491E → V in AAB53243. 1 Publication
Sequence conflicti756 – 7561L → H in AAC52643. 1 Publication
Sequence conflicti791 – 7922KR → NG1 Publication
Sequence conflicti794 – 7941T → M1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
U49049 mRNA. Translation: AAB53243.1.
U50717 mRNA. Translation: AAC52643.1.
U53368 mRNA. Translation: AAB48562.1.
PIRiT10811.
RefSeqiNP_071618.1. NM_022282.1.
UniGeneiRn.202966.

Genome annotation databases

GeneIDi64053.
KEGGirno:64053.
UCSCiRGD:619895. rat. [Q63622-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
U49049 mRNA. Translation: AAB53243.1 .
U50717 mRNA. Translation: AAC52643.1 .
U53368 mRNA. Translation: AAB48562.1 .
PIRi T10811.
RefSeqi NP_071618.1. NM_022282.1.
UniGenei Rn.202966.

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
4H11 X-ray 1.67 A/B 93-188 [» ]
ProteinModelPortali Q63622.
SMRi Q63622. Positions 95-185, 190-283, 418-514, 539-852.
ModBasei Search...

Protein-protein interaction databases

BioGridi 248965. 7 interactions.
IntActi Q63622. 15 interactions.
MINTi MINT-155119.

PTM databases

PhosphoSitei Q63622.

Proteomic databases

PaxDbi Q63622.
PRIDEi Q63622.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

GeneIDi 64053.
KEGGi rno:64053.
UCSCi RGD:619895. rat. [Q63622-1 ]

Organism-specific databases

CTDi 1740.
RGDi 619895. Dlg2.

Phylogenomic databases

eggNOGi COG0194.
HOGENOMi HOG000232102.
HOVERGENi HBG107814.
KOi K12075.

Miscellaneous databases

NextBioi 612717.
PROi Q63622.

Gene expression databases

Genevestigatori Q63622.

Family and domain databases

Gene3Di 2.30.42.10. 3 hits.
3.40.50.300. 2 hits.
InterProi IPR016313. DLG1.
IPR008145. GK/Ca_channel_bsu.
IPR008144. Guanylate_kin-like.
IPR020590. Guanylate_kinase_CS.
IPR019590. MAGUK_PEST_N.
IPR027417. P-loop_NTPase.
IPR001478. PDZ.
IPR019583. PDZ_assoc.
IPR011511. SH3_2.
IPR001452. SH3_domain.
[Graphical view ]
PANTHERi PTHR23119. PTHR23119. 1 hit.
Pfami PF00625. Guanylate_kin. 1 hit.
PF10608. MAGUK_N_PEST. 1 hit.
PF00595. PDZ. 3 hits.
PF10600. PDZ_assoc. 1 hit.
PF07653. SH3_2. 1 hit.
[Graphical view ]
PIRSFi PIRSF001741. MAGUK_DLGH. 1 hit.
SMARTi SM00072. GuKc. 1 hit.
SM00228. PDZ. 3 hits.
SM00326. SH3. 1 hit.
[Graphical view ]
SUPFAMi SSF50044. SSF50044. 2 hits.
SSF50156. SSF50156. 3 hits.
SSF52540. SSF52540. 1 hit.
PROSITEi PS00856. GUANYLATE_KINASE_1. 1 hit.
PS50052. GUANYLATE_KINASE_2. 1 hit.
PS50106. PDZ. 3 hits.
PS50002. SH3. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

  1. "Heteromultimerization and NMDA receptor-clustering activity of Chapsyn-110, a member of the PSD-95 family of proteins."
    Kim E., Cho K.-O., Rothschild A., Sheng M.
    Neuron 17:103-113(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  2. "Interaction of nitric oxide synthase with the postsynaptic density protein PSD-95 and alpha1-syntrophin mediated by PDZ domains."
    Brenman J.E., Chao D.S., Gee S.H., McGee A.W., Craven S.E., Santillano D.R., Wu Z., Huang F., Xia H., Peters M.F., Froehner S.C., Bredt D.S.
    Cell 84:757-767(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 6).
  3. Irie M., Hata Y., Takai Y.
    Submitted (SEP-1996) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  4. "An alternatively spliced isoform of PSD-93/chapsyn 110 binds to the inwardly rectifying potassium channel, Kir2.1."
    Leyland M.L., Dart C.
    J. Biol. Chem. 279:43427-43436(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: PARTIAL NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4), TISSUE SPECIFICITY.
  5. "Cloning and characterization of postsynaptic density 93, a nitric oxide synthase interacting protein."
    Brenman J.E., Christopherson K.S., Craven S.E., McGee A.W., Bredt D.S.
    J. Neurosci. 16:7407-7415(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3 AND 5), SUBCELLULAR LOCATION, TISSUE SPECIFICITY, DEVELOPMENTAL STAGE, INTERACTION WITH NOS1.
  6. "Ion channel clustering by membrane-associated guanylate kinases. Differential regulation by N-terminal lipid and metal binding motifs."
    El-Husseini A.E., Topinka J.R., Lehrer-Graiwer J.E., Firestein B.L., Craven S.E., Aoki C., Bredt D.S.
    J. Biol. Chem. 275:23904-23910(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: MUTAGENESIS OF CYS-5 AND CYS-7, PALMITOYLATION AT CYS-5 AND CYS-7.
  7. "Postsynaptic targeting of MAGUKs mediated by distinct N-terminal domains."
    Firestein B.L., Craven S.E., Bredt D.S.
    NeuroReport 11:3479-3484(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: SUBCELLULAR LOCATION.
  8. "SALM synaptic cell adhesion-like molecules regulate the differentiation of excitatory synapses."
    Ko J., Kim S., Chung H.S., Kim K., Han K., Kim H., Jun H., Kaang B.-K., Kim E.
    Neuron 50:233-245(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH LRFN1.
  9. "Preso, a novel PSD-95-interacting FERM and PDZ domain protein that regulates dendritic spine morphogenesis."
    Lee H.W., Choi J., Shin H., Kim K., Yang J., Na M., Choi S.Y., Kang G.B., Eom S.H., Kim H., Kim E.
    J. Neurosci. 28:14546-14556(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH FRMPD4.

Entry informationi

Entry nameiDLG2_RAT
AccessioniPrimary (citable) accession number: Q63622
Secondary accession number(s): P70548, Q62939
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: November 1, 1997
Last modified: July 9, 2014
This is version 131 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi