Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Espin

Gene

Espn

Organism
Rattus norvegicus (Rat)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Multifunctional actin-bundling protein. Plays a major role in regulating the organization, dimensions, dynamics and signaling capacities of the actin filament-rich, microvillus-type specializations that mediate sensory transduction in variouS mechanosensory and chemosensory cells.1 Publication

GO - Molecular functioni

  • actin filament binding Source: UniProtKB
  • SH3 domain binding Source: UniProtKB

GO - Biological processi

  • actin filament bundle assembly Source: RGD
  • actin filament organization Source: UniProtKB
  • sensory perception of sound Source: UniProtKB-KW
Complete GO annotation...

Keywords - Biological processi

Hearing

Keywords - Ligandi

Actin-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Espin
Alternative name(s):
Ectoplasmic specialization protein
Gene namesi
Name:Espn
OrganismiRattus norvegicus (Rat)
Taxonomic identifieri10116 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeRattus
Proteomesi
  • UP000002494 Componenti: Chromosome 5

Organism-specific databases

RGDi620652. Espn.

Subcellular locationi

Isoform 1 :
  • Cytoplasmcytoskeleton
  • Cell junction

  • Note: Isoform 1 localizes to parallel actin bundles of ectoplasmic specializations between neighboring Sertoli cells and at sites where Sertoli cells contact the heads of elongate spermatids.
Isoform 2 :

GO - Cellular componenti

  • actin cytoskeleton Source: MGI
  • brush border Source: UniProtKB
  • cell junction Source: UniProtKB-SubCell
  • cytoplasm Source: MGI
  • dendritic spine Source: UniProtKB-SubCell
  • filamentous actin Source: UniProtKB
  • microvillus Source: MGI
  • stereocilium Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Cell junction, Cell projection, Cytoplasm, Cytoskeleton

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 837837EspinPRO_0000334668Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei337 – 3371PhosphoserineCombined sources
Modified residuei341 – 3411PhosphoserineCombined sources
Modified residuei400 – 4001PhosphoserineCombined sources
Modified residuei401 – 4011PhosphoserineCombined sources
Modified residuei497 – 4971PhosphoserineCombined sources
Modified residuei504 – 5041PhosphoserineCombined sources
Modified residuei531 – 5311PhosphoserineCombined sources
Modified residuei631 – 6311PhosphoserineBy similarity
Modified residuei670 – 6701PhosphoserineCombined sources
Modified residuei674 – 6741PhosphoserineCombined sources
Modified residuei680 – 6801PhosphoserineCombined sources

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiQ63618.
PRIDEiQ63618.

PTM databases

iPTMnetiQ63618.
PhosphoSiteiQ63618.

Expressioni

Tissue specificityi

Expressed at high concentration in the microvillar parallel actin bundle (PAB) of hair cells stereocilia in the cochlea and vestibular system. Detected also at high levels of a number of other sensory cell types, including taste receptor cells, solitary chemoreceptor cells, vomeronasal sensory neurons and Merkel cells. Isoform 1 is detected in testis. Isoforms 2 is detected in small intestine and kidney (at protein level). Isoforms 3, 4, 6 and 8 are expressed in Purkinje cells dentritic spines.4 Publications

Developmental stagei

Isoform 2 accumulates in the brush border during enterocyte differentiation and migration along the crypt-villus axis in adults.1 Publication

Gene expression databases

ExpressionAtlasiQ63618. baseline and differential.
GenevisibleiQ63618. RN.

Interactioni

Subunit structurei

Monomer (By similarity). Interacts with PFN2 (By similarity). Binds F-actin in a Ca2+-resistant fashion. Interacts (via N-terminal) with BAIAP2 (via SH3-domain).By similarity3 Publications

GO - Molecular functioni

  • actin filament binding Source: UniProtKB
  • SH3 domain binding Source: UniProtKB

Protein-protein interaction databases

MINTiMINT-258272.
STRINGi10116.ENSRNOP00000039445.

Structurei

3D structure databases

ProteinModelPortaliQ63618.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Repeati1 – 3131ANK 1Add
BLAST
Repeati35 – 6632ANK 2Add
BLAST
Repeati69 – 9931ANK 3Add
BLAST
Repeati103 – 13230ANK 4Add
BLAST
Repeati137 – 16731ANK 5Add
BLAST
Repeati171 – 20131ANK 6Add
BLAST
Repeati205 – 23531ANK 7Add
BLAST
Repeati238 – 26730ANK 8Add
BLAST
Repeati270 – 29930ANK 9Add
BLAST
Domaini635 – 65218WH2PROSITE-ProRule annotationAdd
BLAST

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili738 – 81477Sequence analysisAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi412 – 45544Pro-richAdd
BLAST
Compositional biasi582 – 60423Pro-richAdd
BLAST
Compositional biasi617 – 6204Poly-Ser

Domaini

The WH2-domain binds actin monomer and mediated actin bundle assembly.By similarity

Sequence similaritiesi

Contains 9 ANK repeats.PROSITE-ProRule annotation
Contains 1 WH2 domain.PROSITE-ProRule annotation

Keywords - Domaini

ANK repeat, Coiled coil, Repeat

Phylogenomic databases

eggNOGiKOG0504. Eukaryota.
COG0666. LUCA.
GeneTreeiENSGT00600000084407.
HOVERGENiHBG100662.
InParanoidiQ63618.
PhylomeDBiQ63618.

Family and domain databases

Gene3Di1.25.40.20. 1 hit.
InterProiIPR002110. Ankyrin_rpt.
IPR020683. Ankyrin_rpt-contain_dom.
IPR030233. Espn.
IPR003124. WH2_dom.
[Graphical view]
PANTHERiPTHR24153:SF14. PTHR24153:SF14. 2 hits.
PfamiPF12796. Ank_2. 2 hits.
PF02205. WH2. 1 hit.
[Graphical view]
SMARTiSM00248. ANK. 8 hits.
SM00246. WH2. 1 hit.
[Graphical view]
SUPFAMiSSF48403. SSF48403. 1 hit.
PROSITEiPS50297. ANK_REP_REGION. 1 hit.
PS50088. ANK_REPEAT. 6 hits.
PS51082. WH2. 1 hit.
[Graphical view]

Sequences (8)i

Sequence statusi: Complete.

This entry describes 8 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q63618-1) [UniParc]FASTAAdd to basket

Also known as: large

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MALEQAMQAA RRGDLDVLRS LHAAGLLGPS LRDPLDALPV HHAARSGKLH
60 70 80 90 100
CLRYLVEEVA LPAVSRARNG ATPAHDAAAT GYLSCLQWLL TQGGCRVQEK
110 120 130 140 150
DNSGATVLHL AARFGHPDVV NWLLYQGGAN SAITTDTGAL PIHYAAAKGD
160 170 180 190 200
LPSMKLLVGH YPEGVNAQTN NGATPLYLAC QEGHLEVTKY LVQECSADPH
210 220 230 240 250
LRAQDGMTPL HAAAQMGHNP VLVWLVSFAD VSFEQDHDGA TAMHFAASRG
260 270 280 290 300
HTKVLSWLLL HGAEISQDLW GGTPLHDAAE NGELECCQIL AVNGAGLDVR
310 320 330 340 350
DHDGYTAADL ADFNGHTHCS RYLRTVQTLS LEHRVLSRDP SMDLEAKQPD
360 370 380 390 400
SGMSSPNTTM SVQPPNFDLG SPTSTLSNYD SCSSSHSSSK GQRSTRGARS
410 420 430 440 450
SDLQSYMDML NPEPRSKQGK PSSLPPPPPP SFPPPPPPGT QLPPPPPGYP
460 470 480 490 500
APNPPVGLHL DNIYMQTKNK LRHVEVDSLK KEPSSGDGYS GLRRQDSGLL
510 520 530 540 550
RQDSELLLRH NTGLRRQDSD RKQRSFSKQP STGDYYRQLG RSPGEPLAAR
560 570 580 590 600
PGMAHSEEAA LLPGNHVHNG CSADSKASRE LPPPPPPPPL PEALSSPPPA
610 620 630 640 650
PPLPIEGAGA ACGQRRSSSS TGSTKSFNMM SPTGDNSELL AEIKAGKSLK
660 670 680 690 700
PTPQSKGLTT VFSGSGQPAS QPESPQPAVS PGPSRARSPT PPASGPQPLL
710 720 730 740 750
NGSIVPAPPA TLAPGVHLDV EALIPTLDEQ GRPIPEWKRQ VMVRKLQQKM
760 770 780 790 800
QEEEEQRRKE EEEEARLASL PAWRRDILRK KLEEEREQKR KEEERQKLEE
810 820 830
IQRAKEQSEK LRTLGYDEAK LAPWQRQVIL KKGEIPK
Length:837
Mass (Da):90,569
Last modified:November 1, 1998 - v2
Checksum:i64F3C2C23980CA72
GO
Isoform 2 (identifier: Q63618-2) [UniParc]FASTAAdd to basket

Also known as: small

The sequence of this isoform differs from the canonical sequence as follows:
     1-609: Missing.
     610-622: AACGQRRSSSSTG → MNSQGPLRGGRMP
     671-671: Q → QVGTGRVPRPGSQCLPSAQPYRFSRQ

Show »
Length:253
Mass (Da):28,240
Checksum:iDBC40BB6B605F416
GO
Isoform 3 (identifier: Q63618-3) [UniParc]FASTAAdd to basket

Also known as: Purkinje cell espin 1

The sequence of this isoform differs from the canonical sequence as follows:
     1-326: Missing.
     327-329: QTL → MGD

Show »
Length:511
Mass (Da):55,696
Checksum:iFFF7608F1416911E
GO
Isoform 4 (identifier: Q63618-4) [UniParc]FASTAAdd to basket

Also known as: Purkinje cell espin 1+

The sequence of this isoform differs from the canonical sequence as follows:
     1-326: Missing.
     327-329: QTL → MGD
     622-622: G → GKVRILRHRK

Show »
Length:520
Mass (Da):56,883
Checksum:iBBE9BC8762A658F9
GO
Isoform 5 (identifier: Q63618-5) [UniParc]FASTAAdd to basket

Also known as: 3B

The sequence of this isoform differs from the canonical sequence as follows:
     1-522: Missing.
     523-558: QRSFSKQPSTGDYYRQLGRSPGEPLAARPGMAHSEE → MAHSEEVRVHQPAPAGCTGSNPVSHSSLSGPSAPPQ

Show »
Length:315
Mass (Da):33,968
Checksum:i4D6CEBEE8E098D60
GO
Isoform 6 (identifier: Q63618-6) [UniParc]FASTAAdd to basket

Also known as: Purkinje cell espin 2

The sequence of this isoform differs from the canonical sequence as follows:
     1-326: Missing.
     327-329: QTL → MGD
     483-558: Missing.

Show »
Length:435
Mass (Da):47,198
Checksum:i2A9718BE8E574536
GO
Isoform 7 (identifier: Q63618-7) [UniParc]FASTAAdd to basket

Also known as: 3A

The sequence of this isoform differs from the canonical sequence as follows:
     1-552: Missing.

Show »
Length:285
Mass (Da):31,063
Checksum:iCE8819F12C00975E
GO
Isoform 8 (identifier: Q63618-8) [UniParc]FASTAAdd to basket

Also known as: Purkinje cell espin 2+

The sequence of this isoform differs from the canonical sequence as follows:
     1-326: Missing.
     327-329: QTL → MGD
     483-558: Missing.
     622-622: G → GKVRILRHRK

Show »
Length:444
Mass (Da):48,386
Checksum:i2DC996CBCEDBD5E0
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 609609Missing in isoform 2. 1 PublicationVSP_033741Add
BLAST
Alternative sequencei1 – 552552Missing in isoform 7. 1 PublicationVSP_033742Add
BLAST
Alternative sequencei1 – 522522Missing in isoform 5. 1 PublicationVSP_033743Add
BLAST
Alternative sequencei1 – 326326Missing in isoform 3, isoform 4, isoform 6 and isoform 8. 1 PublicationVSP_033744Add
BLAST
Alternative sequencei327 – 3293QTL → MGD in isoform 3, isoform 4, isoform 6 and isoform 8. 1 PublicationVSP_033745
Alternative sequencei483 – 55876Missing in isoform 6 and isoform 8. 1 PublicationVSP_033746Add
BLAST
Alternative sequencei523 – 55836QRSFS…AHSEE → MAHSEEVRVHQPAPAGCTGS NPVSHSSLSGPSAPPQ in isoform 5. 1 PublicationVSP_033747Add
BLAST
Alternative sequencei610 – 62213AACGQ…SSSTG → MNSQGPLRGGRMP in isoform 2. 1 PublicationVSP_033748Add
BLAST
Alternative sequencei622 – 6221G → GKVRILRHRK in isoform 4 and isoform 8. 1 PublicationVSP_033749
Alternative sequencei671 – 6711Q → QVGTGRVPRPGSQCLPSAQP YRFSRQ in isoform 2. 1 PublicationVSP_033750

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U46007 mRNA. Translation: AAC53594.1.
AF076856 mRNA. Translation: AAC69563.1.
AF540946 mRNA. Translation: AAO50330.1.
AF540947 mRNA. Translation: AAO50331.1.
AF540948 mRNA. Translation: AAO50332.1.
AF540949 mRNA. Translation: AAO50333.1.
AY587568 mRNA. Translation: AAT46470.1.
AY587569 mRNA. Translation: AAT46471.1.
RefSeqiXP_006239546.1. XM_006239484.2. [Q63618-2]
UniGeneiRn.91373.

Genome annotation databases

EnsembliENSRNOT00000013646; ENSRNOP00000013645; ENSRNOG00000010270. [Q63618-2]
GeneIDi56227.
UCSCiRGD:620652. rat. [Q63618-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U46007 mRNA. Translation: AAC53594.1.
AF076856 mRNA. Translation: AAC69563.1.
AF540946 mRNA. Translation: AAO50330.1.
AF540947 mRNA. Translation: AAO50331.1.
AF540948 mRNA. Translation: AAO50332.1.
AF540949 mRNA. Translation: AAO50333.1.
AY587568 mRNA. Translation: AAT46470.1.
AY587569 mRNA. Translation: AAT46471.1.
RefSeqiXP_006239546.1. XM_006239484.2. [Q63618-2]
UniGeneiRn.91373.

3D structure databases

ProteinModelPortaliQ63618.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

MINTiMINT-258272.
STRINGi10116.ENSRNOP00000039445.

PTM databases

iPTMnetiQ63618.
PhosphoSiteiQ63618.

Proteomic databases

PaxDbiQ63618.
PRIDEiQ63618.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSRNOT00000013646; ENSRNOP00000013645; ENSRNOG00000010270. [Q63618-2]
GeneIDi56227.
UCSCiRGD:620652. rat. [Q63618-1]

Organism-specific databases

CTDi83715.
RGDi620652. Espn.

Phylogenomic databases

eggNOGiKOG0504. Eukaryota.
COG0666. LUCA.
GeneTreeiENSGT00600000084407.
HOVERGENiHBG100662.
InParanoidiQ63618.
PhylomeDBiQ63618.

Miscellaneous databases

PROiQ63618.

Gene expression databases

ExpressionAtlasiQ63618. baseline and differential.
GenevisibleiQ63618. RN.

Family and domain databases

Gene3Di1.25.40.20. 1 hit.
InterProiIPR002110. Ankyrin_rpt.
IPR020683. Ankyrin_rpt-contain_dom.
IPR030233. Espn.
IPR003124. WH2_dom.
[Graphical view]
PANTHERiPTHR24153:SF14. PTHR24153:SF14. 2 hits.
PfamiPF12796. Ank_2. 2 hits.
PF02205. WH2. 1 hit.
[Graphical view]
SMARTiSM00248. ANK. 8 hits.
SM00246. WH2. 1 hit.
[Graphical view]
SUPFAMiSSF48403. SSF48403. 1 hit.
PROSITEiPS50297. ANK_REP_REGION. 1 hit.
PS50088. ANK_REPEAT. 6 hits.
PS51082. WH2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Identification and characterization of espin, an actin-binding protein localized to the F-actin-rich junctional plaques of Sertoli cell ectoplasmic specializations."
    Bartles J.R., Wierda A., Zheng L.
    J. Cell Sci. 109:1229-1239(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), PROTEIN SEQUENCE OF 20-39; 556-568; 662-684; 775-779 AND 820-822, INTERACTION WITH F-ACTIN, SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
    Strain: Sprague-Dawley.
  2. "Small espin: a third actin-bundling protein and potential forked protein ortholog in brush border microvilli."
    Bartles J.R., Zheng L., Li A., Wierda A., Chen B.
    J. Cell Biol. 143:107-119(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), FUNCTION, SUBUNIT, INTERACTION WITH F-ACTIN, SUBCELLULAR LOCATION, TISSUE SPECIFICITY, DEVELOPMENTAL STAGE.
    Strain: Sprague-Dawley.
    Tissue: Kidney.
  3. "Novel espin actin-bundling proteins are localized to Purkinje cell dendritic spines and bind the Src homology 3 adapter protein insulin receptor substrate p53."
    Sekerkova G., Loomis P.A., Changyaleket B., Zheng L., Eytan R., Chen B., Mugnaini E., Bartles J.R.
    J. Neurosci. 23:1310-1319(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 3; 4; 6 AND 8), TISSUE SPECIFICITY, SUBCELLULAR LOCATION, INTERACTION WITH BAIAP2.
    Strain: Sprague-Dawley.
    Tissue: Cerebellum.
  4. "Espins are multifunctional actin cytoskeletal regulatory proteins in the microvilli of chemosensory and mechanosensory cells."
    Sekerkova G., Zheng L., Loomis P.A., Changyaleket B., Whitlon D.S., Mugnaini E., Bartles J.R.
    J. Neurosci. 24:5445-5456(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 5 AND 7), TISSUE SPECIFICITY.
    Strain: Sprague-Dawley.
  5. "Quantitative maps of protein phosphorylation sites across 14 different rat organs and tissues."
    Lundby A., Secher A., Lage K., Nordsborg N.B., Dmytriyev A., Lundby C., Olsen J.V.
    Nat. Commun. 3:876-876(2012) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-337; SER-341; SER-400; SER-401; SER-497; SER-504; SER-531; SER-670; SER-674 AND SER-680, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

Entry informationi

Entry nameiESPN_RAT
AccessioniPrimary (citable) accession number: Q63618
Secondary accession number(s): Q6GYS2
, Q6GYS3, Q80ZB6, Q80ZB7, Q80ZB8, Q80ZB9, Q9Z2B4
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 20, 2008
Last sequence update: November 1, 1998
Last modified: July 6, 2016
This is version 103 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.