Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Espin

Gene

Espn

Organism
Rattus norvegicus (Rat)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Multifunctional actin-bundling protein. Plays a major role in regulating the organization, dimensions, dynamics and signaling capacities of the actin filament-rich, microvillus-type specializations that mediate sensory transduction in variouS mechanosensory and chemosensory cells.1 Publication

GO - Molecular functioni

  • actin filament binding Source: UniProtKB
  • SH3 domain binding Source: UniProtKB

GO - Biological processi

  • actin filament bundle assembly Source: RGD
  • actin filament organization Source: UniProtKB
  • sensory perception of sound Source: UniProtKB-KW
Complete GO annotation...

Keywords - Biological processi

Hearing

Keywords - Ligandi

Actin-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Espin
Alternative name(s):
Ectoplasmic specialization protein
Gene namesi
Name:Espn
OrganismiRattus norvegicus (Rat)
Taxonomic identifieri10116 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeRattus
Proteomesi
  • UP000002494 Componenti: Chromosome 5

Organism-specific databases

RGDi620652. Espn.

Subcellular locationi

Isoform 1 :
  • Cytoplasmcytoskeleton
  • Cell junction

  • Note: Isoform 1 localizes to parallel actin bundles of ectoplasmic specializations between neighboring Sertoli cells and at sites where Sertoli cells contact the heads of elongate spermatids.
Isoform 2 :

GO - Cellular componenti

  • actin cytoskeleton Source: MGI
  • brush border Source: UniProtKB
  • cell junction Source: UniProtKB-SubCell
  • cytoplasm Source: MGI
  • dendritic spine Source: UniProtKB-SubCell
  • filamentous actin Source: UniProtKB
  • microvillus Source: MGI
  • stereocilium Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Cell junction, Cell projection, Cytoplasm, Cytoskeleton

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003346681 – 837EspinAdd BLAST837

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei337PhosphoserineCombined sources1
Modified residuei341PhosphoserineCombined sources1
Modified residuei400PhosphoserineCombined sources1
Modified residuei401PhosphoserineCombined sources1
Modified residuei497PhosphoserineCombined sources1
Modified residuei504PhosphoserineCombined sources1
Modified residuei531PhosphoserineCombined sources1
Modified residuei631PhosphoserineBy similarity1
Modified residuei670PhosphoserineCombined sources1
Modified residuei674PhosphoserineCombined sources1
Modified residuei680PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiQ63618.
PRIDEiQ63618.

PTM databases

iPTMnetiQ63618.
PhosphoSitePlusiQ63618.

Expressioni

Tissue specificityi

Expressed at high concentration in the microvillar parallel actin bundle (PAB) of hair cells stereocilia in the cochlea and vestibular system. Detected also at high levels of a number of other sensory cell types, including taste receptor cells, solitary chemoreceptor cells, vomeronasal sensory neurons and Merkel cells. Isoform 1 is detected in testis. Isoforms 2 is detected in small intestine and kidney (at protein level). Isoforms 3, 4, 6 and 8 are expressed in Purkinje cells dentritic spines.4 Publications

Developmental stagei

Isoform 2 accumulates in the brush border during enterocyte differentiation and migration along the crypt-villus axis in adults.1 Publication

Gene expression databases

BgeeiENSRNOG00000010270.
ExpressionAtlasiQ63618. baseline and differential.
GenevisibleiQ63618. RN.

Interactioni

Subunit structurei

Monomer (By similarity). Interacts with PFN2 (By similarity). Binds F-actin in a Ca2+-resistant fashion. Interacts (via N-terminal) with BAIAP2 (via SH3-domain).By similarity3 Publications

GO - Molecular functioni

  • actin filament binding Source: UniProtKB
  • SH3 domain binding Source: UniProtKB

Protein-protein interaction databases

MINTiMINT-258272.
STRINGi10116.ENSRNOP00000039445.

Structurei

3D structure databases

ProteinModelPortaliQ63618.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Repeati1 – 31ANK 1Add BLAST31
Repeati35 – 66ANK 2Add BLAST32
Repeati69 – 99ANK 3Add BLAST31
Repeati103 – 132ANK 4Add BLAST30
Repeati137 – 167ANK 5Add BLAST31
Repeati171 – 201ANK 6Add BLAST31
Repeati205 – 235ANK 7Add BLAST31
Repeati238 – 267ANK 8Add BLAST30
Repeati270 – 299ANK 9Add BLAST30
Domaini635 – 652WH2PROSITE-ProRule annotationAdd BLAST18

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili738 – 814Sequence analysisAdd BLAST77

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi412 – 455Pro-richAdd BLAST44
Compositional biasi582 – 604Pro-richAdd BLAST23
Compositional biasi617 – 620Poly-Ser4

Domaini

The WH2-domain binds actin monomer and mediated actin bundle assembly.By similarity

Sequence similaritiesi

Contains 9 ANK repeats.PROSITE-ProRule annotation
Contains 1 WH2 domain.PROSITE-ProRule annotation

Keywords - Domaini

ANK repeat, Coiled coil, Repeat

Phylogenomic databases

eggNOGiKOG0504. Eukaryota.
COG0666. LUCA.
GeneTreeiENSGT00600000084407.
HOVERGENiHBG100662.
InParanoidiQ63618.
PhylomeDBiQ63618.

Family and domain databases

Gene3Di1.25.40.20. 1 hit.
InterProiIPR002110. Ankyrin_rpt.
IPR020683. Ankyrin_rpt-contain_dom.
IPR030233. Espn.
IPR003124. WH2_dom.
[Graphical view]
PANTHERiPTHR24153:SF14. PTHR24153:SF14. 2 hits.
PfamiPF12796. Ank_2. 2 hits.
PF02205. WH2. 1 hit.
[Graphical view]
SMARTiSM00248. ANK. 8 hits.
SM00246. WH2. 1 hit.
[Graphical view]
SUPFAMiSSF48403. SSF48403. 1 hit.
PROSITEiPS50297. ANK_REP_REGION. 1 hit.
PS50088. ANK_REPEAT. 6 hits.
PS51082. WH2. 1 hit.
[Graphical view]

Sequences (8)i

Sequence statusi: Complete.

This entry describes 8 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q63618-1) [UniParc]FASTAAdd to basket
Also known as: large

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MALEQAMQAA RRGDLDVLRS LHAAGLLGPS LRDPLDALPV HHAARSGKLH
60 70 80 90 100
CLRYLVEEVA LPAVSRARNG ATPAHDAAAT GYLSCLQWLL TQGGCRVQEK
110 120 130 140 150
DNSGATVLHL AARFGHPDVV NWLLYQGGAN SAITTDTGAL PIHYAAAKGD
160 170 180 190 200
LPSMKLLVGH YPEGVNAQTN NGATPLYLAC QEGHLEVTKY LVQECSADPH
210 220 230 240 250
LRAQDGMTPL HAAAQMGHNP VLVWLVSFAD VSFEQDHDGA TAMHFAASRG
260 270 280 290 300
HTKVLSWLLL HGAEISQDLW GGTPLHDAAE NGELECCQIL AVNGAGLDVR
310 320 330 340 350
DHDGYTAADL ADFNGHTHCS RYLRTVQTLS LEHRVLSRDP SMDLEAKQPD
360 370 380 390 400
SGMSSPNTTM SVQPPNFDLG SPTSTLSNYD SCSSSHSSSK GQRSTRGARS
410 420 430 440 450
SDLQSYMDML NPEPRSKQGK PSSLPPPPPP SFPPPPPPGT QLPPPPPGYP
460 470 480 490 500
APNPPVGLHL DNIYMQTKNK LRHVEVDSLK KEPSSGDGYS GLRRQDSGLL
510 520 530 540 550
RQDSELLLRH NTGLRRQDSD RKQRSFSKQP STGDYYRQLG RSPGEPLAAR
560 570 580 590 600
PGMAHSEEAA LLPGNHVHNG CSADSKASRE LPPPPPPPPL PEALSSPPPA
610 620 630 640 650
PPLPIEGAGA ACGQRRSSSS TGSTKSFNMM SPTGDNSELL AEIKAGKSLK
660 670 680 690 700
PTPQSKGLTT VFSGSGQPAS QPESPQPAVS PGPSRARSPT PPASGPQPLL
710 720 730 740 750
NGSIVPAPPA TLAPGVHLDV EALIPTLDEQ GRPIPEWKRQ VMVRKLQQKM
760 770 780 790 800
QEEEEQRRKE EEEEARLASL PAWRRDILRK KLEEEREQKR KEEERQKLEE
810 820 830
IQRAKEQSEK LRTLGYDEAK LAPWQRQVIL KKGEIPK
Length:837
Mass (Da):90,569
Last modified:November 1, 1998 - v2
Checksum:i64F3C2C23980CA72
GO
Isoform 2 (identifier: Q63618-2) [UniParc]FASTAAdd to basket
Also known as: small

The sequence of this isoform differs from the canonical sequence as follows:
     1-609: Missing.
     610-622: AACGQRRSSSSTG → MNSQGPLRGGRMP
     671-671: Q → QVGTGRVPRPGSQCLPSAQPYRFSRQ

Show »
Length:253
Mass (Da):28,240
Checksum:iDBC40BB6B605F416
GO
Isoform 3 (identifier: Q63618-3) [UniParc]FASTAAdd to basket
Also known as: Purkinje cell espin 1

The sequence of this isoform differs from the canonical sequence as follows:
     1-326: Missing.
     327-329: QTL → MGD

Show »
Length:511
Mass (Da):55,696
Checksum:iFFF7608F1416911E
GO
Isoform 4 (identifier: Q63618-4) [UniParc]FASTAAdd to basket
Also known as: Purkinje cell espin 1+

The sequence of this isoform differs from the canonical sequence as follows:
     1-326: Missing.
     327-329: QTL → MGD
     622-622: G → GKVRILRHRK

Show »
Length:520
Mass (Da):56,883
Checksum:iBBE9BC8762A658F9
GO
Isoform 5 (identifier: Q63618-5) [UniParc]FASTAAdd to basket
Also known as: 3B

The sequence of this isoform differs from the canonical sequence as follows:
     1-522: Missing.
     523-558: QRSFSKQPSTGDYYRQLGRSPGEPLAARPGMAHSEE → MAHSEEVRVHQPAPAGCTGSNPVSHSSLSGPSAPPQ

Show »
Length:315
Mass (Da):33,968
Checksum:i4D6CEBEE8E098D60
GO
Isoform 6 (identifier: Q63618-6) [UniParc]FASTAAdd to basket
Also known as: Purkinje cell espin 2

The sequence of this isoform differs from the canonical sequence as follows:
     1-326: Missing.
     327-329: QTL → MGD
     483-558: Missing.

Show »
Length:435
Mass (Da):47,198
Checksum:i2A9718BE8E574536
GO
Isoform 7 (identifier: Q63618-7) [UniParc]FASTAAdd to basket
Also known as: 3A

The sequence of this isoform differs from the canonical sequence as follows:
     1-552: Missing.

Show »
Length:285
Mass (Da):31,063
Checksum:iCE8819F12C00975E
GO
Isoform 8 (identifier: Q63618-8) [UniParc]FASTAAdd to basket
Also known as: Purkinje cell espin 2+

The sequence of this isoform differs from the canonical sequence as follows:
     1-326: Missing.
     327-329: QTL → MGD
     483-558: Missing.
     622-622: G → GKVRILRHRK

Show »
Length:444
Mass (Da):48,386
Checksum:i2DC996CBCEDBD5E0
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0337411 – 609Missing in isoform 2. 1 PublicationAdd BLAST609
Alternative sequenceiVSP_0337421 – 552Missing in isoform 7. 1 PublicationAdd BLAST552
Alternative sequenceiVSP_0337431 – 522Missing in isoform 5. 1 PublicationAdd BLAST522
Alternative sequenceiVSP_0337441 – 326Missing in isoform 3, isoform 4, isoform 6 and isoform 8. 1 PublicationAdd BLAST326
Alternative sequenceiVSP_033745327 – 329QTL → MGD in isoform 3, isoform 4, isoform 6 and isoform 8. 1 Publication3
Alternative sequenceiVSP_033746483 – 558Missing in isoform 6 and isoform 8. 1 PublicationAdd BLAST76
Alternative sequenceiVSP_033747523 – 558QRSFS…AHSEE → MAHSEEVRVHQPAPAGCTGS NPVSHSSLSGPSAPPQ in isoform 5. 1 PublicationAdd BLAST36
Alternative sequenceiVSP_033748610 – 622AACGQ…SSSTG → MNSQGPLRGGRMP in isoform 2. 1 PublicationAdd BLAST13
Alternative sequenceiVSP_033749622G → GKVRILRHRK in isoform 4 and isoform 8. 1 Publication1
Alternative sequenceiVSP_033750671Q → QVGTGRVPRPGSQCLPSAQP YRFSRQ in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U46007 mRNA. Translation: AAC53594.1.
AF076856 mRNA. Translation: AAC69563.1.
AF540946 mRNA. Translation: AAO50330.1.
AF540947 mRNA. Translation: AAO50331.1.
AF540948 mRNA. Translation: AAO50332.1.
AF540949 mRNA. Translation: AAO50333.1.
AY587568 mRNA. Translation: AAT46470.1.
AY587569 mRNA. Translation: AAT46471.1.
RefSeqiXP_006239546.1. XM_006239484.3. [Q63618-2]
UniGeneiRn.91373.

Genome annotation databases

EnsembliENSRNOT00000013646; ENSRNOP00000013645; ENSRNOG00000010270. [Q63618-2]
GeneIDi56227.
UCSCiRGD:620652. rat. [Q63618-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U46007 mRNA. Translation: AAC53594.1.
AF076856 mRNA. Translation: AAC69563.1.
AF540946 mRNA. Translation: AAO50330.1.
AF540947 mRNA. Translation: AAO50331.1.
AF540948 mRNA. Translation: AAO50332.1.
AF540949 mRNA. Translation: AAO50333.1.
AY587568 mRNA. Translation: AAT46470.1.
AY587569 mRNA. Translation: AAT46471.1.
RefSeqiXP_006239546.1. XM_006239484.3. [Q63618-2]
UniGeneiRn.91373.

3D structure databases

ProteinModelPortaliQ63618.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

MINTiMINT-258272.
STRINGi10116.ENSRNOP00000039445.

PTM databases

iPTMnetiQ63618.
PhosphoSitePlusiQ63618.

Proteomic databases

PaxDbiQ63618.
PRIDEiQ63618.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSRNOT00000013646; ENSRNOP00000013645; ENSRNOG00000010270. [Q63618-2]
GeneIDi56227.
UCSCiRGD:620652. rat. [Q63618-1]

Organism-specific databases

CTDi83715.
RGDi620652. Espn.

Phylogenomic databases

eggNOGiKOG0504. Eukaryota.
COG0666. LUCA.
GeneTreeiENSGT00600000084407.
HOVERGENiHBG100662.
InParanoidiQ63618.
PhylomeDBiQ63618.

Miscellaneous databases

PROiQ63618.

Gene expression databases

BgeeiENSRNOG00000010270.
ExpressionAtlasiQ63618. baseline and differential.
GenevisibleiQ63618. RN.

Family and domain databases

Gene3Di1.25.40.20. 1 hit.
InterProiIPR002110. Ankyrin_rpt.
IPR020683. Ankyrin_rpt-contain_dom.
IPR030233. Espn.
IPR003124. WH2_dom.
[Graphical view]
PANTHERiPTHR24153:SF14. PTHR24153:SF14. 2 hits.
PfamiPF12796. Ank_2. 2 hits.
PF02205. WH2. 1 hit.
[Graphical view]
SMARTiSM00248. ANK. 8 hits.
SM00246. WH2. 1 hit.
[Graphical view]
SUPFAMiSSF48403. SSF48403. 1 hit.
PROSITEiPS50297. ANK_REP_REGION. 1 hit.
PS50088. ANK_REPEAT. 6 hits.
PS51082. WH2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiESPN_RAT
AccessioniPrimary (citable) accession number: Q63618
Secondary accession number(s): Q6GYS2
, Q6GYS3, Q80ZB6, Q80ZB7, Q80ZB8, Q80ZB9, Q9Z2B4
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 20, 2008
Last sequence update: November 1, 1998
Last modified: November 2, 2016
This is version 105 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.