Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Microtubule-associated protein 6

Gene

Map6

Organism
Rattus norvegicus (Rat)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Involved in microtubule stabilization in many cell types, including neuronal cells (PubMed:8700896, PubMed:9660871, PubMed:3456161, PubMed:11413126, PubMed:28521134). Specifically has microtubule cold stabilizing activity (PubMed:3456161). Involved in dendrite morphogenesis and maintenance by regulating lysosomal trafficking via its interaction with TMEM106B (By similarity). Regulates KIF5A-mediated axonal cargo transport (PubMed:28521134). Regulates axonal growth during neuron polarization (PubMed:28521134).By similarity5 Publications

GO - Molecular functioni

  • calmodulin binding Source: UniProtKB-KW
  • microtubule binding Source: UniProtKB

GO - Biological processi

  • axonal transport of mitochondrion Source: UniProtKB
  • dendrite morphogenesis Source: UniProtKB
  • lysosome localization Source: UniProtKB
  • microtubule cytoskeleton organization Source: InterPro
  • positive regulation of axonogenesis Source: UniProtKB
  • regulation of microtubule cytoskeleton organization Source: UniProtKB

Keywordsi

Molecular functionCalmodulin-binding
Biological processTransport

Names & Taxonomyi

Protein namesi
Recommended name:
Microtubule-associated protein 6
Short name:
MAP-6
Alternative name(s):
145-kDa STOP
Short name:
STOP145
Stable tubule-only polypeptide
Short name:
STOP
Gene namesi
Name:Map6
Synonyms:Mtap6
OrganismiRattus norvegicus (Rat)
Taxonomic identifieri10116 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeRattus
Proteomesi
  • UP000002494 Componenti: Unplaced

Organism-specific databases

RGDi61804 Map6

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell projection, Cytoplasm, Cytoplasmic vesicle, Cytoskeleton, Golgi apparatus, Membrane, Microtubule

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi5C → G: Loss of palmitoylation. Loss of Golgi and secretory vesicle localization; when associated with G-10 and G-11. Loss of axonal polarization; when associated with G-10 and G-11. Increased dendrite localization without affecting association with microtubules; when associated with G-10 and G-11. 1 Publication1
Mutagenesisi10 – 11CC → GG: Loss of Golgi and secretory vesicle localization; when associated with G-5. Loss of axonal polarization; when associated with G-5. Increased dendrite localization without affecting association with microtubules; when associated with G-5. 1 Publication2

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003440461 – 952Microtubule-associated protein 6Add BLAST952

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Lipidationi5S-palmitoyl cysteine1 Publication1
Lipidationi10S-palmitoyl cysteine1 Publication1
Lipidationi11S-palmitoyl cysteine1 Publication1
Modified residuei98PhosphoserineBy similarity1
Modified residuei141PhosphotyrosineBy similarity1
Modified residuei185PhosphoserineCombined sources1
Modified residuei207PhosphoserineBy similarity1
Modified residuei590PhosphoserineCombined sources1
Modified residuei681PhosphoserineCombined sources1
Modified residuei736PhosphoserineCombined sources1
Modified residuei951PhosphoserineCombined sources1

Post-translational modificationi

Palmitoylated. Probably depalmitoylated by ABHD17A, ABHD17B and ABHD17C. During neuronal polarization, palmitoylation and depalmitoylation cycles regulate MAP6 shuttling between secretory vesicles and microtubules, and its polarized distribution in the axon.1 Publication

Keywords - PTMi

Lipoprotein, Palmitate, Phosphoprotein

Proteomic databases

PaxDbiQ63560
PRIDEiQ63560

PTM databases

iPTMnetiQ63560
PhosphoSitePlusiQ63560

Expressioni

Tissue specificityi

Isoform 1 is specifically expressed in adult brain. Isoform 2 is predominantly expressed in embryonic brain; expression persists at low levels in the adult brain.1 Publication

Developmental stagei

At E17.5, expressed in brain including hippocampus and corpus callosum (PubMed:28521134). Isoform 1: Expression begins after birth at P1-P5 stages and is maintained in adults (PubMed:9660871, PubMed:28521134). Expressed in mature neurons (PubMed:28521134). Isoform 2: Expressed at E13, E16 and E18 stages (PubMed:9660871, PubMed:28521134). Expression is increased at P1-P5 stages and persists at low levels in the adult brain (PubMed:9660871, PubMed:28521134). Expressed in unpolarized hippocampal neurons and throughout neuronal development (PubMed:28521134).2 Publications

Interactioni

Subunit structurei

Interacts with calmodulin (via C-terminus); the interaction is dependent on Ca2+ (PubMed:8700896, PubMed:11413126). Interacts with TMEM106B (By similarity). Interacts with ZDHHC13 (via ANK repeats) (By similarity). Interacts with ZDHHC17 (via ANK repeats) (By similarity).By similarity2 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
Tmem106bQ6AYA56EBI-1638469,EBI-9316198

GO - Molecular functioni

  • calmodulin binding Source: UniProtKB-KW
  • microtubule binding Source: UniProtKB

Protein-protein interaction databases

BioGridi248100, 2 interactors
IntActiQ63560, 3 interactors
MINTiQ63560
STRINGi10116.ENSRNOP00000032018

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Repeati222 – 267Mc-11 PublicationAdd BLAST46
Repeati268 – 313Mc-21 PublicationAdd BLAST46
Repeati314 – 359Mc-31 PublicationAdd BLAST46
Repeati360 – 405Mc-41 PublicationAdd BLAST46
Repeati406 – 451Mc-51 PublicationAdd BLAST46

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni1 – 15Calmodulin-binding1 PublicationAdd BLAST15
Regioni116 – 139Mn 11 PublicationAdd BLAST24
Regioni124 – 138Calmodulin-binding1 PublicationAdd BLAST15
Regioni151 – 174Mn 21 PublicationAdd BLAST24
Regioni160 – 174Calmodulin-binding1 PublicationAdd BLAST15
Regioni187 – 201Calmodulin-binding1 PublicationAdd BLAST15
Regioni222 – 4515 X approximate tandem repeat Mc1 PublicationAdd BLAST230
Regioni235 – 249Calmodulin-binding1 PublicationAdd BLAST15
Regioni280 – 294Calmodulin-binding1 PublicationAdd BLAST15
Regioni325 – 339Calmodulin-binding1 PublicationAdd BLAST15
Regioni373 – 387Calmodulin-binding1 PublicationAdd BLAST15
Regioni421 – 435Calmodulin-binding1 PublicationAdd BLAST15
Regioni473 – 496Mn 31 PublicationAdd BLAST24
Regioni481 – 495Calmodulin-binding1 PublicationAdd BLAST15
Regioni532 – 546Calmodulin-binding1 PublicationAdd BLAST15
Regioni559 – 573Calmodulin-binding1 PublicationAdd BLAST15

Sequence similaritiesi

Belongs to the STOP family.Curated

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiENOG410IIA0 Eukaryota
ENOG4110KV2 LUCA
HOGENOMiHOG000113479
HOVERGENiHBG053112
InParanoidiQ63560
KOiK10432
PhylomeDBiQ63560

Family and domain databases

InterProiView protein in InterPro
IPR007882 MAP6
PANTHERiPTHR14759 PTHR14759, 2 hits

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q63560-1) [UniParc]FASTAAdd to basket
Also known as: N-STOP, Neuronal STOP

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAWPCITRAC CIARFWNQLD KADIAVPLVF TKYSEATEHP GAPPQPPAPP
60 70 80 90 100
QPGLAPPSRA VAIETQPAQG ESDAVARATG PAPGPSGDRE TAAAPGRSGL
110 120 130 140 150
GLGAASGSTS GSGPADSVMR QDYRAWKVQR PEPSCRPRSE YQPSDAPFER
160 170 180 190 200
ETQYQKDFRA WPLPRRGDHP WIPKPVQIPA TSQPSPPVLG MPKRRPQSQE
210 220 230 240 250
RGPIQLSADA RDPEGAGGAG VPAAGKASGA DQRDTRRKAG PAWMVTRTEG
260 270 280 290 300
HEEKPLPPAQ SQTQEGGPAA GKASGADQRD TRRKAGPAWM VTRTEGHEEK
310 320 330 340 350
PLPPAQSQTQ EGGPAAGKAS GADQRDTRRK AGPAWMVTRT EGHEETPLPP
360 370 380 390 400
AQSQTQEGGP AAGKASGADQ RDTRRKAGPA WMVTRTEGHE ETPLPPAQSQ
410 420 430 440 450
TQEGGPAAGK ASGADERDTR RKAGPAWMVR RSEGHEQTTA AHAQGTGPEG
460 470 480 490 500
GKGRAVADAL NRQIREEVTS TVSSSYRNEF RAWTDIKPVK PIKAKPQYKP
510 520 530 540 550
PDDKMVHETS YSAQFKGEAS KPTTADNKVV DRRRIRSLYS EPFKESPKVE
560 570 580 590 600
KPSVQSSKPK KTSTSQKPLR KAKDKQVASG QAAKKKTTES PSATKPDDKE
610 620 630 640 650
QSKEMNNKLA EAKESRVKPT SDKNQGPVAK EPHKDQGPVA PGLPKGQGPA
660 670 680 690 700
VQEPLKDQGP MVPGLPKDQA PVVPGSLKGQ SPTAPGPPKD QGAVLLGPMK
710 720 730 740 750
DLGPVAPASV KDQDHMASEL LKNKDSVPLA PAKAQSPLLP EPLKNQSPVV
760 770 780 790 800
PARAKDQSFP APAPTPLKDP GPVIPEPEKD GAPMVPERRK DQNASIMASL
810 820 830 840 850
KNEAPVASES VKNQGLGGPE PAKDTGTDLK GHGSVFVAPV KSQGPVVPEP
860 870 880 890 900
TKGQDPIIPA LAKDQGPILP EPPKNQGPPV VLGPIKNQDP VIPVPLKGQD
910 920 930 940 950
PVVPAPTKDP GPTAPDPLKS QGPRGPQLPT VSPSPPVMIP TVPHAEYIEG

SP
Length:952
Mass (Da):100,485
Last modified:November 1, 1996 - v1
Checksum:i3599A5069096FA73
GO
Isoform 2 (identifier: Q63560-2) [UniParc]FASTAAdd to basket
Also known as: E-STOP, Early STOP

The sequence of this isoform differs from the canonical sequence as follows:
     325-325: R → RDTRRKAGPAWMVTRTEGHEEKPLPPAQSQTQEGGPAAGKASGADQR
     615-952: Missing.

Show »
Length:660
Mass (Da):70,622
Checksum:iBCB5494CC1734875
GO

Sequence cautioni

The sequence AAH78848 differs from that shown. Contaminating sequence. Potential poly-A sequence.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_034728325R → RDTRRKAGPAWMVTRTEGHE EKPLPPAQSQTQEGGPAAGK ASGADQR in isoform 2. 2 Publications1
Alternative sequenceiVSP_034729615 – 952Missing in isoform 2. 2 PublicationsAdd BLAST338

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X93495 mRNA Translation: CAA63762.1
AJ002556 mRNA Translation: CAA05555.1
BC078848 mRNA Translation: AAH78848.1 Sequence problems.
RefSeqiNP_058900.1, NM_017204.1 [Q63560-1]
UniGeneiRn.37490

Genome annotation databases

GeneIDi29457
KEGGirno:29457
UCSCiRGD:61804 rat [Q63560-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiMAP6_RAT
AccessioniPrimary (citable) accession number: Q63560
Secondary accession number(s): O88748, Q6AYX8
Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 22, 2008
Last sequence update: November 1, 1996
Last modified: March 28, 2018
This is version 97 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health