Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Microtubule-associated protein 6

Gene

Map6

Organism
Rattus norvegicus (Rat)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Involved in microtubule stabilization in many cell types, including neuronal cells. Specifically has microtubule cold stabilizing activity. Involved in dendrite morphogenesis and maintenance by regulating lysosomal trafficking via its interaction with TMEM106B.4 Publications

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Transport

Keywords - Ligandi

Calmodulin-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Microtubule-associated protein 6
Short name:
MAP-6
Alternative name(s):
145-kDa STOP
Short name:
STOP145
Stable tubule-only polypeptide
Short name:
STOP
Gene namesi
Name:Map6
Synonyms:Mtap6
OrganismiRattus norvegicus (Rat)
Taxonomic identifieri10116 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeRattus
Proteomesi
  • UP000002494 Componenti: Unplaced

Organism-specific databases

RGDi61804. Map6.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton, Golgi apparatus, Microtubule

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003440461 – 952Microtubule-associated protein 6Add BLAST952

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Lipidationi5S-palmitoyl cysteineBy similarity1
Lipidationi10S-palmitoyl cysteineBy similarity1
Lipidationi11S-palmitoyl cysteineBy similarity1
Modified residuei98PhosphoserineBy similarity1
Modified residuei141PhosphotyrosineBy similarity1
Modified residuei185PhosphoserineCombined sources1
Modified residuei207PhosphoserineBy similarity1
Modified residuei590PhosphoserineCombined sources1
Modified residuei681PhosphoserineCombined sources1
Modified residuei736PhosphoserineCombined sources1
Modified residuei951PhosphoserineCombined sources1

Keywords - PTMi

Lipoprotein, Palmitate, Phosphoprotein

Proteomic databases

PaxDbiQ63560.
PRIDEiQ63560.

PTM databases

iPTMnetiQ63560.
PhosphoSitePlusiQ63560.

Expressioni

Tissue specificityi

Isoform 1 is specifically expressed in adult brain. Isoform 2 is predominantly expressed in embryonic brain; expression persists at low levels in the adult brain.1 Publication

Developmental stagei

Isoform 2 is expressed in embryonic brain.1 Publication

Gene expression databases

BgeeiENSRNOG00000027204.

Interactioni

Subunit structurei

Interacts with calmodulin (via C-terminus); the interaction is dependent on Ca2+ (PubMed:8700896, PubMed:11413126). Interacts with TMEM106B (By similarity). Interacts with ZDHHC13 (via ANK repeats) (By similarity). Interacts with ZDHHC17 (via ANK repeats) (By similarity).By similarity2 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
Tmem106bQ6AYA56EBI-1638469,EBI-9316198

GO - Molecular functioni

Protein-protein interaction databases

BioGridi248100. 1 interactor.
IntActiQ63560. 3 interactors.
STRINGi10116.ENSRNOP00000032018.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Repeati222 – 267Mc-1Add BLAST46
Repeati268 – 313Mc-2Add BLAST46
Repeati314 – 359Mc-3Add BLAST46
Repeati360 – 405Mc-4Add BLAST46
Repeati406 – 451Mc-5Add BLAST46

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni1 – 15Calmodulin-bindingAdd BLAST15
Regioni116 – 139Mn 1Add BLAST24
Regioni124 – 138Calmodulin-bindingAdd BLAST15
Regioni151 – 174Mn 2Add BLAST24
Regioni160 – 174Calmodulin-bindingAdd BLAST15
Regioni187 – 201Calmodulin-bindingAdd BLAST15
Regioni222 – 4515 X approximate tandem repeat McAdd BLAST230
Regioni235 – 249Calmodulin-bindingAdd BLAST15
Regioni280 – 294Calmodulin-bindingAdd BLAST15
Regioni325 – 339Calmodulin-bindingAdd BLAST15
Regioni373 – 387Calmodulin-bindingAdd BLAST15
Regioni421 – 435Calmodulin-bindingAdd BLAST15
Regioni473 – 496Mn 3Add BLAST24
Regioni481 – 495Calmodulin-bindingAdd BLAST15
Regioni532 – 546Calmodulin-bindingAdd BLAST15
Regioni559 – 573Calmodulin-bindingAdd BLAST15

Sequence similaritiesi

Belongs to the STOP family.Curated

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiENOG410IIA0. Eukaryota.
ENOG4110KV2. LUCA.
HOGENOMiHOG000113479.
HOVERGENiHBG053112.
InParanoidiQ63560.
KOiK10432.
PhylomeDBiQ63560.

Family and domain databases

InterProiIPR007882. MAP6.
[Graphical view]
PANTHERiPTHR14759. PTHR14759. 2 hits.

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q63560-1) [UniParc]FASTAAdd to basket
Also known as: N-STOP, Neuronal STOP

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAWPCITRAC CIARFWNQLD KADIAVPLVF TKYSEATEHP GAPPQPPAPP
60 70 80 90 100
QPGLAPPSRA VAIETQPAQG ESDAVARATG PAPGPSGDRE TAAAPGRSGL
110 120 130 140 150
GLGAASGSTS GSGPADSVMR QDYRAWKVQR PEPSCRPRSE YQPSDAPFER
160 170 180 190 200
ETQYQKDFRA WPLPRRGDHP WIPKPVQIPA TSQPSPPVLG MPKRRPQSQE
210 220 230 240 250
RGPIQLSADA RDPEGAGGAG VPAAGKASGA DQRDTRRKAG PAWMVTRTEG
260 270 280 290 300
HEEKPLPPAQ SQTQEGGPAA GKASGADQRD TRRKAGPAWM VTRTEGHEEK
310 320 330 340 350
PLPPAQSQTQ EGGPAAGKAS GADQRDTRRK AGPAWMVTRT EGHEETPLPP
360 370 380 390 400
AQSQTQEGGP AAGKASGADQ RDTRRKAGPA WMVTRTEGHE ETPLPPAQSQ
410 420 430 440 450
TQEGGPAAGK ASGADERDTR RKAGPAWMVR RSEGHEQTTA AHAQGTGPEG
460 470 480 490 500
GKGRAVADAL NRQIREEVTS TVSSSYRNEF RAWTDIKPVK PIKAKPQYKP
510 520 530 540 550
PDDKMVHETS YSAQFKGEAS KPTTADNKVV DRRRIRSLYS EPFKESPKVE
560 570 580 590 600
KPSVQSSKPK KTSTSQKPLR KAKDKQVASG QAAKKKTTES PSATKPDDKE
610 620 630 640 650
QSKEMNNKLA EAKESRVKPT SDKNQGPVAK EPHKDQGPVA PGLPKGQGPA
660 670 680 690 700
VQEPLKDQGP MVPGLPKDQA PVVPGSLKGQ SPTAPGPPKD QGAVLLGPMK
710 720 730 740 750
DLGPVAPASV KDQDHMASEL LKNKDSVPLA PAKAQSPLLP EPLKNQSPVV
760 770 780 790 800
PARAKDQSFP APAPTPLKDP GPVIPEPEKD GAPMVPERRK DQNASIMASL
810 820 830 840 850
KNEAPVASES VKNQGLGGPE PAKDTGTDLK GHGSVFVAPV KSQGPVVPEP
860 870 880 890 900
TKGQDPIIPA LAKDQGPILP EPPKNQGPPV VLGPIKNQDP VIPVPLKGQD
910 920 930 940 950
PVVPAPTKDP GPTAPDPLKS QGPRGPQLPT VSPSPPVMIP TVPHAEYIEG

SP
Length:952
Mass (Da):100,485
Last modified:November 1, 1996 - v1
Checksum:i3599A5069096FA73
GO
Isoform 2 (identifier: Q63560-2) [UniParc]FASTAAdd to basket
Also known as: E-STOP, Early STOP

The sequence of this isoform differs from the canonical sequence as follows:
     325-325: R → RDTRRKAGPAWMVTRTEGHEEKPLPPAQSQTQEGGPAAGKASGADQR
     615-952: Missing.

Show »
Length:660
Mass (Da):70,622
Checksum:iBCB5494CC1734875
GO

Sequence cautioni

The sequence AAH78848 differs from that shown. Contaminating sequence. Potential poly-A sequence.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_034728325R → RDTRRKAGPAWMVTRTEGHE EKPLPPAQSQTQEGGPAAGK ASGADQR in isoform 2. 2 Publications1
Alternative sequenceiVSP_034729615 – 952Missing in isoform 2. 2 PublicationsAdd BLAST338

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X93495 mRNA. Translation: CAA63762.1.
AJ002556 mRNA. Translation: CAA05555.1.
BC078848 mRNA. Translation: AAH78848.1. Sequence problems.
RefSeqiNP_058900.1. NM_017204.1. [Q63560-1]
UniGeneiRn.37490.

Genome annotation databases

GeneIDi29457.
KEGGirno:29457.
UCSCiRGD:61804. rat. [Q63560-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X93495 mRNA. Translation: CAA63762.1.
AJ002556 mRNA. Translation: CAA05555.1.
BC078848 mRNA. Translation: AAH78848.1. Sequence problems.
RefSeqiNP_058900.1. NM_017204.1. [Q63560-1]
UniGeneiRn.37490.

3D structure databases

ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi248100. 1 interactor.
IntActiQ63560. 3 interactors.
STRINGi10116.ENSRNOP00000032018.

PTM databases

iPTMnetiQ63560.
PhosphoSitePlusiQ63560.

Proteomic databases

PaxDbiQ63560.
PRIDEiQ63560.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

GeneIDi29457.
KEGGirno:29457.
UCSCiRGD:61804. rat. [Q63560-1]

Organism-specific databases

CTDi4135.
RGDi61804. Map6.

Phylogenomic databases

eggNOGiENOG410IIA0. Eukaryota.
ENOG4110KV2. LUCA.
HOGENOMiHOG000113479.
HOVERGENiHBG053112.
InParanoidiQ63560.
KOiK10432.
PhylomeDBiQ63560.

Miscellaneous databases

PROiQ63560.

Gene expression databases

BgeeiENSRNOG00000027204.

Family and domain databases

InterProiIPR007882. MAP6.
[Graphical view]
PANTHERiPTHR14759. PTHR14759. 2 hits.
ProtoNetiSearch...

Entry informationi

Entry nameiMAP6_RAT
AccessioniPrimary (citable) accession number: Q63560
Secondary accession number(s): O88748, Q6AYX8
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 22, 2008
Last sequence update: November 1, 1996
Last modified: November 2, 2016
This is version 87 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.