Q62976 (KCMA1_RAT) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 3, 2013.
Version 109.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Calcium-activated potassium channel subunit alpha-1 Alternative name(s): BK channel BKCA alpha Calcium-activated potassium channel, subfamily M subunit alpha-1 K(VCA)alpha KCa1.1 Maxi K channel Short name=MaxiK Slo-alpha Slo1 Slowpoke homolog Short name=Slo homolog | ||||
| Gene names |
| ||||
| Organism | Rattus norvegicus (Rat) [Reference proteome] | ||||
| Taxonomic identifier | 10116 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Rattus![]() |
Protein attributes
| Sequence length | 1209 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Potassium channel activated by both membrane depolarization or increase in cytosolic Ca2+ that mediates export of K+. It is also activated by the concentration of cytosolic Mg2+. Its activation dampens the excitatory events that elevate the cytosolic Ca2+ concentration and/or depolarize the cell membrane. It therefore contributes to repolarization of the membrane potential. Plays a key role in controlling excitability in a number of systems, such as regulation of the contraction of smooth muscle, the tuning of hair cells in the cochlea, regulation of transmitter release, and innate immunity. In smooth muscles, its activation by high level of Ca2+, caused by ryanodine receptors in the sarcoplasmic reticulum, regulates the membrane potential. In cochlea cells, its number and kinetic properties partly determine the characteristic frequency of each hair cell and thereby helps to establish a tonotopic map. Kinetics of KCNMA1 channels are determined by alternative splicing, phosphorylation status and its combination with modulating beta subunits. Highly sensitive to both iberiotoxin (IbTx) and charybdotoxin (CTX). |
| Enzyme regulation | Ethanol and carbon monoxide-bound heme increase channel activation. Heme inhibits channel activation. Ref.6 |
| Subunit structure | Homotetramer; which constitutes the calcium-activated potassium channel. Interacts with beta subunits KCNMB1, KCNMB2, KCNMB3 and KCNMB4. Interacts with gamma subunits LRRC26, LRRC38, LRRC52 and LRRC55. Beta and gamma subunits are accessory, and modulate its activity By similarity. |
| Subcellular location | Cell membrane; Multi-pass membrane protein. Isoform 7: Endoplasmic reticulum membrane; Multi-pass membrane protein. Note: Has a dominant-negative effect on other isoforms, preventing their localization to the cell membrane. |
| Domain | The S0 segment is essential for the modulation by the accessory beta subunits KCNMB1, KCNMB2, KCNMB3 and KCNMB4 By similarity. The S4 segment, which is characterized by a series of positively charged amino acids at every third position, is part of the voltage-sensor By similarity. The pore-forming domain (also referred as P region) is imbedded into the membrane, and forms the selectivity filter of the pore. It contains the signature sequence of potassium channels that displays selectivity to potassium By similarity. The RCK N-terminal domain mediates the homotetramerization, thereby promoting the assembly of monomers into functional potassium channel. It includes binding sites for Ca2+ and Mg2+ By similarity. The calcium bowl constitutes one of the Ca2+ sensors and probably acts as a Ca2+-binding site. There are however other Ca2+ sensors regions required for activation of the channel By similarity. The heme-binding motif mediates inhibition of channel activation by heme. Carbon monoxide-bound heme leads to increased channel activation. |
| Post-translational modification | Phosphorylated Probable. Phosphorylation by kinases such as PKA and/or PKG. In smooth muscles, phosphorylation affects its activity By similarity. |
| Miscellaneous | The protein was initially thought to contain two functionally distinct parts: The core channel (from the N-terminus to the S9 segment) that mediates the channel activity, and the cytoplasmic tail (from the S9 segment to the C-terminus) that mediates the calcium sensing. The situation is however more complex, since the core channel contains binding sites for Ca2+ and Mg2+. |
| Sequence similarities | Belongs to the potassium channel family. Calcium-activated (TC 1.A.1.3) subfamily. KCa1.1/KCNMA1 sub-subfamily. [View classification] Contains 1 RCK N-terminal domain. |
| Sequence caution | The sequence AAB51398.1 differs from that shown. Reason: Frameshift at position 1203. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| Mbp | P02688 | 4 | EBI-1638146,EBI-1638296 |
Alternative products
| This entry describes 7 isoforms produced by alternative splicing. [Align] [Select] Note: May be partially controlled by hormonal stress. Additional isoforms seem to exist. | ||||||
| Isoform 1 (identifier: Q62976-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q62976-2) Also known as: B; C; cvb1; cvb2; The sequence of this isoform differs from the canonical sequence as follows: 1-30: Missing. 644-647: Missing. 949-975: Missing. | ||||||
| Isoform 3 (identifier: Q62976-3) The sequence of this isoform differs from the canonical sequence as follows: 1-30: Missing. 644-647: Missing. 949-975: Missing. 1203-1209: KKEMVYR → NNRRCWWFSKRQDIHQQKRNGLQMRRIMPIPETFKSSP | ||||||
| Isoform 4 (identifier: Q62976-8) Also known as: STTEX; The sequence of this isoform differs from the canonical sequence as follows: 703-703: L → LIYSKMSIYKRMSRACCFDCGRSERDCSCMSGRVRGNVDTLERNFPLSSVSVNDCSTSFRAF 949-975: Missing. | ||||||
| Isoform 5 (identifier: Q62976-9) Also known as: A; The sequence of this isoform differs from the canonical sequence as follows: 644-647: Missing. 949-975: Missing. 1128-1165: RYVITNPPYE...AGQSRASLSH → SNRRCWWFSK...PIPETFKSSP 1166-1209: Missing. | ||||||
| Isoform 6 (identifier: Q62976-10) Also known as: SLON-1; The sequence of this isoform differs from the canonical sequence as follows: 1-30: Missing. 949-975: Missing. | ||||||
| Isoform 7 (identifier: Q62976-11) Also known as: SV1; The sequence of this isoform differs from the canonical sequence as follows: 181-181: L → AFERSSLLARISIQKDGCQCVLFSSHFMPRLLM |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1209 | 1209 | Calcium-activated potassium channel subunit alpha-1 | PRO_0000054137 | |||||
Regions | |||||||||
| Topological domain | 1 – 87 | 87 | Extracellular Potential | ||||||
| Transmembrane | 88 – 108 | 21 | Helical; Name=Segment S0; Potential | ||||||
| Topological domain | 109 – 179 | 71 | Cytoplasmic Potential | ||||||
| Transmembrane | 180 – 200 | 21 | Helical; Name=Segment S1; Potential | ||||||
| Topological domain | 201 – 215 | 15 | Extracellular Potential | ||||||
| Transmembrane | 216 – 236 | 21 | Helical; Name=Segment S2; Potential | ||||||
| Topological domain | 237 – 240 | 4 | Cytoplasmic Potential | ||||||
| Transmembrane | 241 – 261 | 21 | Helical; Name=Segment S3; Potential | ||||||
| Topological domain | 262 – 265 | 4 | Extracellular Potential | ||||||
| Transmembrane | 266 – 286 | 21 | Helical; Voltage-sensor; Name=Segment S4; Potential | ||||||
| Topological domain | 287 – 301 | 15 | Cytoplasmic Potential | ||||||
| Transmembrane | 302 – 322 | 21 | Helical; Name=Segment S5; Potential | ||||||
| Topological domain | 323 – 336 | 14 | Extracellular Potential | ||||||
| Intramembrane | 337 – 359 | 23 | Pore-forming; Name=P region; Potential | ||||||
| Topological domain | 360 – 368 | 9 | Extracellular Potential | ||||||
| Transmembrane | 369 – 389 | 21 | Helical; Name=Segment S6; Potential | ||||||
| Topological domain | 390 – 1209 | 820 | Cytoplasmic Potential | ||||||
| Domain | 416 – 559 | 144 | RCK N-terminal | ||||||
| Region | 557 – 577 | 21 | Segment S7 | ||||||
| Region | 614 – 634 | 21 | Segment S8 | ||||||
| Region | 682 – 686 | 5 | Heme-binding motif | ||||||
| Region | 784 – 804 | 21 | Segment S9 | ||||||
| Region | 1006 – 1026 | 21 | Segment S10 | ||||||
| Motif | 353 – 356 | 4 | Selectivity for potassium | ||||||
| Motif | 977 – 999 | 23 | Calcium bowl | ||||||
| Compositional bias | 4 – 11 | 8 | Poly-Gly | ||||||
| Compositional bias | 17 – 25 | 9 | Poly-Gly | ||||||
| Compositional bias | 45 – 61 | 17 | Poly-Ser | ||||||
Sites | |||||||||
| Metal binding | 440 | 1 | Magnesium By similarity | ||||||
| Metal binding | 463 | 1 | Magnesium By similarity | ||||||
| Metal binding | 465 | 1 | Magnesium By similarity | ||||||
| Metal binding | 986 | 1 | Calcium; via carbonyl oxygen By similarity | ||||||
| Metal binding | 989 | 1 | Calcium; via carbonyl oxygen By similarity | ||||||
| Metal binding | 992 | 1 | Calcium By similarity | ||||||
| Metal binding | 994 | 1 | Calcium By similarity | ||||||
Amino acid modifications | |||||||||
| Modified residue | 712 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 1062 | 1 | Phosphothreonine By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 30 | 30 | Missing in isoform 2, isoform 3 and isoform 6. | VSP_009970 | |||||
| Alternative sequence | 181 | 1 | L → AFERSSLLARISIQKDGCQC VLFSSHFMPRLLM in isoform 7. | VSP_009971 | |||||
| Alternative sequence | 644 – 647 | 4 | Missing in isoform 2, isoform 3 and isoform 5. | VSP_009973 | |||||
| Alternative sequence | 703 | 1 | L → LIYSKMSIYKRMSRACCFDC GRSERDCSCMSGRVRGNVDT LERNFPLSSVSVNDCSTSFR AF in isoform 4. | VSP_009974 | |||||
| Alternative sequence | 949 – 975 | 27 | Missing in isoform 2, isoform 3, isoform 4, isoform 5 and isoform 6. | VSP_009976 | |||||
| Alternative sequence | 1128 – 1165 | 38 | RYVIT…ASLSH → SNRRCWWFSKRQDIHQQKRN GLQMRRIMPIPETFKSSP in isoform 5. | VSP_009978 | |||||
| Alternative sequence | 1166 – 1209 | 44 | Missing in isoform 5. | VSP_009979 | |||||
| Alternative sequence | 1203 – 1209 | 7 | KKEMVYR → NNRRCWWFSKRQDIHQQKRN GLQMRRIMPIPETFKSSP in isoform 3. | VSP_009982 | |||||
Experimental info | |||||||||
| Mutagenesis | 685 – 686 | 2 | CH → SR: Loss of heme-induced channel inhibition as well as carbon monoxide-induced channel activation. Ref.6 | ||||||
| Sequence conflict | 33 | 1 | Missing in AAB51398. Ref.1 | ||||||
| Sequence conflict | 33 | 1 | Missing in AAA99161. Ref.4 | ||||||
| Sequence conflict | 132 | 1 | I → V in AAP82452. Ref.7 | ||||||
| Sequence conflict | 158 | 1 | G → V in AAC32866. Ref.5 | ||||||
| Sequence conflict | 164 | 1 | K → E in AAB51398. Ref.1 | ||||||
| Sequence conflict | 176 | 1 | L → P in AAP82451. Ref.7 | ||||||
| Sequence conflict | 205 | 1 | E → Q in AAC32866. Ref.5 | ||||||
| Sequence conflict | 238 | 1 | N → K in AAP82451. Ref.7 | ||||||
| Sequence conflict | 266 | 1 | N → D in AAP82451. Ref.7 | ||||||
| Sequence conflict | 279 | 1 | R → I in AAP82451. Ref.7 | ||||||
| Sequence conflict | 281 | 1 | I → V in AAP82452. Ref.7 | ||||||
| Sequence conflict | 286 | 1 | I → S in AAP82452. Ref.7 | ||||||
| Sequence conflict | 296 | 1 | S → N in AAP82450. Ref.7 | ||||||
| Sequence conflict | 338 | 1 | L → P in AAA99161. Ref.4 | ||||||
| Sequence conflict | 353 | 1 | T → A in AAP82452. Ref.7 | ||||||
| Sequence conflict | 364 | 1 | T → S in AAA99161. Ref.4 | ||||||
| Sequence conflict | 364 | 1 | T → TLGT in AAP82452. Ref.7 | ||||||
| Sequence conflict | 446 | 1 | N → S in AAP82451. Ref.7 | ||||||
| Sequence conflict | 450 | 1 | N → D in AAP82451. Ref.7 | ||||||
| Sequence conflict | 468 | 1 | Q → K in AAB51398. Ref.1 | ||||||
| Sequence conflict | 470 | 1 | S → P in AAP82452. Ref.7 | ||||||
| Sequence conflict | 479 | 1 | R → T in AAA99161. Ref.4 | ||||||
| Sequence conflict | 549 | 1 | A → S in AAC32866. Ref.5 | ||||||
| Sequence conflict | 552 | 1 | L → H in AAP82452. Ref.7 | ||||||
| Sequence conflict | 553 | 1 | A → V in AAP82454. Ref.6 | ||||||
| Sequence conflict | 600 | 1 | N → T in AAB51398. Ref.1 | ||||||
| Sequence conflict | 605 | 1 | E → G in AAA99161. Ref.4 | ||||||
| Sequence conflict | 637 | 1 | K → R in AAP82452. Ref.7 | ||||||
| Sequence conflict | 659 | 1 | I → T in AAB96356. Ref.3 | ||||||
| Sequence conflict | 660 | 1 | Q → R in AAB51398. Ref.1 | ||||||
| Sequence conflict | 677 | 1 | R → K in AAB51398. Ref.1 | ||||||
| Sequence conflict | 685 – 687 | 3 | CHD → YHE in AAP82452. Ref.7 | ||||||
| Sequence conflict | 734 | 1 | R → K in AAD34786. Ref.2 | ||||||
| Sequence conflict | 739 | 1 | L → S in AAP82454. Ref.6 | ||||||
| Sequence conflict | 762 | 1 | F → L in AAA99161. Ref.4 | ||||||
| Sequence conflict | 780 | 1 | A → V in AAP82454. Ref.6 | ||||||
| Sequence conflict | 806 | 1 | N → NRN in AAP82451. Ref.7 | ||||||
| Sequence conflict | 864 | 1 | I → L in AAC32866. Ref.5 | ||||||
| Sequence conflict | 885 | 1 | L → V in AAC32866. Ref.5 | ||||||
| Sequence conflict | 940 | 1 | I → T in AAP82453. Ref.6 | ||||||
| Sequence conflict | 989 | 1 | D → G in AAP82451. Ref.7 | ||||||
| Sequence conflict | 1005 | 1 | P → L in AAA99161. Ref.4 | ||||||
| Sequence conflict | 1012 | 1 | F → S in AAC32866. Ref.5 | ||||||
| Sequence conflict | 1093 | 1 | Y → C in AAP82452. Ref.7 | ||||||
| Sequence conflict | 1107 | 1 | L → F in AAP82451. Ref.7 | ||||||
| Sequence conflict | 1173 | 1 | S → P in AAP82453. Ref.6 | ||||||
| Sequence conflict | 1188 | 1 | N → S in AAP82454. Ref.6 | ||||||
| Sequence conflict | 1203 | 1 | K → NR in AAB51398. Ref.1 | ||||||
| Sequence conflict | 1203 | 1 | K → NR in AAD34786. Ref.2 | ||||||
| Sequence conflict | 1203 | 1 | K → NR in AAP82454. Ref.6 | ||||||
| Sequence conflict | 1203 | 1 | K → NR in AAP82451. Ref.7 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| [1] | "Increased expression of Ca2+-sensitive K+ channels in aorta of hypertensive rats." Liu Y., Pleyte K., Knaus H.-G., Rusch N.J. Hypertension 30:1403-1409(1997) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2). Strain: Sprague-Dawley. Tissue: Aortic smooth muscle. |
| [2] | "Functional characteristics of two BKCa channel variants differentially expressed in rat brain tissues." Ha T.S., Jeong S.Y., Cho S.-W., Jeon H.-K., Roh G.S., Choi W.S., Park C.-S. Eur. J. Biochem. 267:910-918(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Strain: Sprague-Dawley. Tissue: Brain. |
| [3] | Reimann F. Submitted (NOV-1995) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4). Strain: Sprague-Dawley. Tissue: Brain cortex. |
| [4] | "Cloning and expression of smooth muscle specific isoforms of a rat calcium-activated potassium channel." Lawrence K.M., Fenech C.J., Zhang H., Bolton T.B. Submitted (APR-1996) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3). Strain: Wistar HsdOla. Tissue: Myometrium. |
| [5] | "Identification and localization of Ca(2+)-activated K+ channels in rat sciatic nerve." Mi H., Harris-Warrick R.M., Deerinck T.J., Inman I., Ellisman M.H., Schwarz T.L. Glia 26:166-175(1999) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-1028 (ISOFORM 6). Strain: Sprague-Dawley. |
| [6] | "Heme is a carbon monoxide receptor for large-conductance Ca2+-activated K+ channels." Jaggar J.H., Li A., Parfenova H., Liu J., Umstot E.S., Dopico A.M., Leffler C.W. Circ. Res. 97:805-812(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 62-1209 (ISOFORM 2), ENZYME REGULATION, MUTAGENESIS OF 685-CYS-HIS-686. Strain: Sprague-Dawley. Tissue: Cerebral artery. |
| [7] | "Slo subunits cloned from freshly isolated rat cerebral artery myocytes." Liu J., Asuncion-Chin M.T., Liu P., Dopico A.M. Submitted (JUN-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 62-1209 (ISOFORMS 2 AND 5). Strain: Sprague-Dawley. Tissue: Aorta and Cerebral artery. |
| [8] | "A novel MaxiK splice variant exhibits dominant-negative properties for surface expression." Zarei M.M., Zhu N., Alioua A., Eghbali M., Stefani E., Toro L. J. Biol. Chem. 276:16232-16239(2001) [PubMed] [Europe PMC] [Abstract] Cited for: ALTERNATIVE SPLICING (ISOFORM 7). |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | U93052 mRNA. Translation: AAB51398.1. Frameshift. AF135265 mRNA. Translation: AAD34786.1. U40603 mRNA. Translation: AAB96356.1. U55995 mRNA. Translation: AAA99161.1. AF083341 mRNA. Translation: AAC32866.1. AY330290 mRNA. Translation: AAP82450.1. AY330291 mRNA. Translation: AAP82451.1. AY330292 mRNA. Translation: AAP82452.1. AY330293 mRNA. Translation: AAP82453.2. AY330294 mRNA. Translation: AAP82454.1. |
| IPI | IPI00411170. IPI00411171. IPI00411260. IPI00411261. IPI00411262. IPI00411267. IPI00411268. |
| RefSeq | NP_114016.1. NM_031828.1. |
| UniGene | Rn.30616. |
3D structure databases | |
| ProteinModelPortal | Q62976. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q62976. 42 interactions. |
| MINT | MINT-1203282. |
Protein family/group databases | |
| TCDB | 1.A.1.3.2. voltage-gated ion channel (VIC) superfamily. |
PTM databases | |
| PhosphoSite | Q62976. |
Proteomic databases | |
| PaxDb | Q62976. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| GeneID | 83731. |
| KEGG | rno:83731. |
Organism-specific databases | |
| CTD | 3778. |
| RGD | 620715. Kcnma1. |
Phylogenomic databases | |
| eggNOG | COG1226. |
| HOVERGEN | HBG052222. |
| KO | K04936. |
| OrthoDB | EOG4QFWCD. |
Gene expression databases | |
| ArrayExpress | Q62976. |
| Genevestigator | Q62976. |
Family and domain databases | |
| Gene3D | 3.40.50.720. 1 hit. |
| InterPro | IPR024939. Ca-act_K_channel_Slo. IPR005821. Ion_trans_dom. IPR003091. K_chnl. IPR003929. K_chnl_Ca-activ_BK_asu. IPR016040. NAD(P)-bd_dom. IPR003148. RCK_N. [Graphical view] |
| PANTHER | PTHR10027:SF3. PTHR10027:SF3. 1 hit. |
| Pfam | PF03493. BK_channel_a. 1 hit. PF00520. Ion_trans. 1 hit. PF02254. TrkA_N. 1 hit. [Graphical view] |
| PRINTS | PR01449. BKCHANNELA. PR00169. KCHANNEL. |
| PROSITE | PS51201. RCK_N. False negative. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChEMBL | CHEMBL5505. |
| NextBio | 616325. |
Entry information
| Entry name | KCMA1_RAT | ||||||||
| Accession | Primary (citable) accession number: Q62976 Secondary accession number(s): O08626 Q9WUI3 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| SIMILARITY comments Index of protein domains and families |

Clusters with
