Q62758 (5HT4R_RAT) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 3, 2013.
Version 105.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: 5-hydroxytryptamine receptor 4 Short name=5-HT-4 Short name=5-HT4 Alternative name(s): Serotonin receptor 4 | ||
| Gene names |
| ||
| Organism | Rattus norvegicus (Rat) [Reference proteome] | ||
| Taxonomic identifier | 10116 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Rattus![]() |
Protein attributes
| Sequence length | 406 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Function | This is one of the several different receptors for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. The activity of this receptor is mediated by G proteins that stimulate adenylate cyclase. |
| Subunit structure | May interact with INADL, MAGI2, MPP3, NOS1, SLC9A3R1, SEC23A and SNX27. May form a complex including SLC9A3R1 and EZR By similarity. Interacts (via C-terminus 330-346 AA) with GRK5; this interaction is promoted by 5-HT (serotonin) By similarity. |
| Subcellular location | Cell membrane; Multi-pass membrane protein. Endosome. Note: Interaction with SNX27 mediates recruitment to early endosomes, while interaction with SLC9A3R1 and EZR might target the protein to specialized subcellular regions, such as microvilli By similarity. |
| Tissue specificity | In brain, isoform 5-HT4S is restricted to the striatum, but isoform 5-HT4L is expressed throughout the brain, except in the cerebellum. In peripheral tissues, differential expression is also observed in the atrium of the heart where only isoform 5-HT4S is detectable. |
| Sequence similarities | Belongs to the G-protein coupled receptor 1 family. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cell membrane Endosome Membrane |
| Coding sequence diversity | Alternative splicing |
| Domain | Transmembrane Transmembrane helix |
| Molecular function | G-protein coupled receptor Receptor Transducer |
| PTM | Disulfide bond Glycoprotein Lipoprotein Palmitate |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | adenylate cyclase-activating G-protein coupled receptor signaling pathway Inferred from mutant phenotype Ref.1. Source: RGD cognitionTraceable author statement PubMed 11986365. Source: RGD gamma-aminobutyric acid signaling pathwayInferred from mutant phenotype PubMed 11986365. Source: RGD |
| Cellular_component | endosome Inferred from electronic annotation. Source: UniProtKB-SubCell integral to membraneInferred from electronic annotation. Source: UniProtKB-KW plasma membraneInferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular_function | serotonin receptor activity Inferred from mutant phenotype Ref.3Ref.1. Source: RGD |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] Note: Additional isoforms seem to exist. | ||||||
| Isoform 5-HT4L (identifier: Q62758-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 5-HT4S (identifier: Q62758-2) The sequence of this isoform differs from the canonical sequence as follows: 360-406: DTVECGGQWESRCHLTATSPLVAAQPVIRRPQDNDLEDSCSLKRSQS → YTVLHSGQHQELEKLPIHNDPESLESCF | ||||||
| Isoform 5-HT4(E) (identifier: Q62758-3) The sequence of this isoform differs from the canonical sequence as follows: 359-406: RDTVECGGQWESRCHLTATSPLVAAQPVIRRPQDNDLEDSCSLKRSQS → SFPLLFCNRPVPV |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 406 | 406 | 5-hydroxytryptamine receptor 4 | PRO_0000068968 | |||||||
Regions | |||||||||||
| Topological domain | 1 – 19 | 19 | Extracellular By similarity | ||||||||
| Transmembrane | 20 – 40 | 21 | Helical; Name=1; By similarity | ||||||||
| Topological domain | 41 – 58 | 18 | Cytoplasmic By similarity | ||||||||
| Transmembrane | 59 – 79 | 21 | Helical; Name=2; By similarity | ||||||||
| Topological domain | 80 – 93 | 14 | Extracellular By similarity | ||||||||
| Transmembrane | 94 – 116 | 23 | Helical; Name=3; By similarity | ||||||||
| Topological domain | 117 – 137 | 21 | Cytoplasmic By similarity | ||||||||
| Transmembrane | 138 – 158 | 21 | Helical; Name=4; By similarity | ||||||||
| Topological domain | 159 – 192 | 34 | Extracellular By similarity | ||||||||
| Transmembrane | 193 – 213 | 21 | Helical; Name=5; By similarity | ||||||||
| Topological domain | 214 – 260 | 47 | Cytoplasmic By similarity | ||||||||
| Transmembrane | 261 – 281 | 21 | Helical; Name=6; By similarity | ||||||||
| Topological domain | 282 – 294 | 13 | Extracellular By similarity | ||||||||
| Transmembrane | 295 – 315 | 21 | Helical; Name=7; By similarity | ||||||||
| Topological domain | 316 – 406 | 91 | Cytoplasmic By similarity | ||||||||
Amino acid modifications | |||||||||||
| Lipidation | 329 | 1 | S-palmitoyl cysteine By similarity | ||||||||
| Glycosylation | 7 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Disulfide bond | 93 ↔ 184 | By similarity | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 359 – 406 | 48 | RDTVE…KRSQS → SFPLLFCNRPVPV in isoform 5-HT4(E). | VSP_001855 | |||||||
| Alternative sequence | 360 – 406 | 47 | DTVEC…KRSQS → YTVLHSGQHQELEKLPIHND PESLESCF in isoform 5-HT4S. | VSP_001854 | |||||||
Experimental info | |||||||||||
| Sequence conflict | 74 – 75 | 2 | NA → MP in CAA09599. Ref.3 | ||||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| [1] | "The 5-HT4 receptor: molecular cloning and pharmacological characterization of two splice variants." Gerald C., Adham N., Kao H.T., Olsen M.A., Laz T.M., Schechter L.E., Bard J.A., Vaysse P., Hartig P.R., Branchek T.A., Weinshank R.L. EMBO J. 14:2806-2815(1995) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA]. Tissue: Brain. |
| [2] | "Expression of serotonin receptor mRNAs in blood vessels." Ullmer C., Schmuck K., Kalkman H.O., Luebbert H. FEBS Lett. 370:215-221(1995) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 165-259. Tissue: Brain. |
| [3] | "Novel brain-specific 5-HT4 receptor splice variants show marked constitutive activity: role of the C-terminal intracellular domain." Claeysen S., Sebben M., Becamel C., Bockaert J., Dumuis A. Mol. Pharmacol. 55:910-920(1999) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 5-HT4(E)). Tissue: Brain. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | U20907 mRNA. Translation: AAC52233.1. U20906 mRNA. Translation: AAC52232.1. Z48153 mRNA. Translation: CAA88170.1. AJ011370 mRNA. Translation: CAA09599.1. |
| IPI | IPI00208196. IPI00231823. IPI00231824. |
| PIR | S55549. S55550. |
| RefSeq | NP_036985.1. NM_012853.1. |
| UniGene | Rn.10094. |
3D structure databases | |
| ProteinModelPortal | Q62758. |
| ModBase | Search... |
Protein family/group databases | |
| GPCRDB | Search... |
PTM databases | |
| PhosphoSite | Q62758. |
Proteomic databases | |
| PaxDb | Q62758. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| GeneID | 25324. |
| KEGG | rno:25324. |
| UCSC | RGD:2850. rat. |
Organism-specific databases | |
| CTD | 3360. |
| RGD | 2850. Htr4. |
Phylogenomic databases | |
| eggNOG | NOG262978. |
| HOGENOM | HOG000239242. |
| HOVERGEN | HBG106962. |
| InParanoid | Q62758. |
| KO | K04160. |
Gene expression databases | |
| ArrayExpress | Q62758. |
| Genevestigator | Q62758. |
| GermOnline | ENSRNOG00000019134. Rattus norvegicus. |
Family and domain databases | |
| InterPro | IPR001520. 5HT4_rcpt. IPR000276. GPCR_Rhodpsn. IPR017452. GPCR_Rhodpsn_7TM. [Graphical view] |
| Pfam | PF00001. 7tm_1. 1 hit. [Graphical view] |
| PRINTS | PR01059. 5HT4RECEPTR. PR00237. GPCRRHODOPSN. |
| PROSITE | PS00237. G_PROTEIN_RECEP_F1_1. 1 hit. PS50262. G_PROTEIN_RECEP_F1_2. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| BindingDB | Q62758. |
| ChEMBL | CHEMBL4317. |
| NextBio | 606177. |
Entry information
| Entry name | 5HT4R_RAT | ||||||||
| Accession | Primary (citable) accession number: Q62758 Secondary accession number(s): O89034, Q62757, Q63006 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| 7-transmembrane G-linked receptors List of 7-transmembrane G-linked receptor entries |
| SIMILARITY comments Index of protein domains and families |

Clusters with
