SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q62758

- 5HT4R_RAT

UniProt

Q62758 - 5HT4R_RAT

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
5-hydroxytryptamine receptor 4
Gene
Htr4
Organism
Rattus norvegicus (Rat)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at transcript leveli

Functioni

This is one of the several different receptors for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. The activity of this receptor is mediated by G proteins that stimulate adenylate cyclase.

GO - Molecular functioni

  1. serotonin receptor activity Source: RGD

GO - Biological processi

  1. adenylate cyclase-activating G-protein coupled receptor signaling pathway Source: RGD
  2. cognition Source: RGD
  3. gamma-aminobutyric acid signaling pathway Source: RGD
  4. regulation of appetite Source: InterPro
  5. serotonin receptor signaling pathway Source: GOC
  6. synaptic transmission Source: InterPro
Complete GO annotation...

Keywords - Molecular functioni

G-protein coupled receptor, Receptor, Transducer

Names & Taxonomyi

Protein namesi
Recommended name:
5-hydroxytryptamine receptor 4
Short name:
5-HT-4
Short name:
5-HT4
Alternative name(s):
Serotonin receptor 4
Gene namesi
Name:Htr4
OrganismiRattus norvegicus (Rat)
Taxonomic identifieri10116 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeRattus
ProteomesiUP000002494: Unplaced

Organism-specific databases

RGDi2850. Htr4.

Subcellular locationi

Cell membrane; Multi-pass membrane protein. Endosome
Note: Interaction with SNX27 mediates recruitment to early endosomes, while interaction with SLC9A3R1 and EZR might target the protein to specialized subcellular regions, such as microvilli By similarity.

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 1919Extracellular By similarity
Add
BLAST
Transmembranei20 – 4021Helical; Name=1; By similarity
Add
BLAST
Topological domaini41 – 5818Cytoplasmic By similarity
Add
BLAST
Transmembranei59 – 7921Helical; Name=2; By similarity
Add
BLAST
Topological domaini80 – 9314Extracellular By similarity
Add
BLAST
Transmembranei94 – 11623Helical; Name=3; By similarity
Add
BLAST
Topological domaini117 – 13721Cytoplasmic By similarity
Add
BLAST
Transmembranei138 – 15821Helical; Name=4; By similarity
Add
BLAST
Topological domaini159 – 19234Extracellular By similarity
Add
BLAST
Transmembranei193 – 21321Helical; Name=5; By similarity
Add
BLAST
Topological domaini214 – 26047Cytoplasmic By similarity
Add
BLAST
Transmembranei261 – 28121Helical; Name=6; By similarity
Add
BLAST
Topological domaini282 – 29413Extracellular By similarity
Add
BLAST
Transmembranei295 – 31521Helical; Name=7; By similarity
Add
BLAST
Topological domaini316 – 40691Cytoplasmic By similarity
Add
BLAST

GO - Cellular componenti

  1. endosome Source: UniProtKB-SubCell
  2. integral component of plasma membrane Source: InterPro
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Endosome, Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 4064065-hydroxytryptamine receptor 4
PRO_0000068968Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi7 – 71N-linked (GlcNAc...) Reviewed prediction
Disulfide bondi93 ↔ 184 By similarity
Lipidationi329 – 3291S-palmitoyl cysteine By similarity

Keywords - PTMi

Disulfide bond, Glycoprotein, Lipoprotein, Palmitate

Proteomic databases

PaxDbiQ62758.
PRIDEiQ62758.

PTM databases

PhosphoSiteiQ62758.

Expressioni

Tissue specificityi

In brain, isoform 5-HT4S is restricted to the striatum, but isoform 5-HT4L is expressed throughout the brain, except in the cerebellum. In peripheral tissues, differential expression is also observed in the atrium of the heart where only isoform 5-HT4S is detectable.

Gene expression databases

GenevestigatoriQ62758.

Interactioni

Subunit structurei

May interact with INADL, MAGI2, MPP3, NOS1, SLC9A3R1, SEC23A and SNX27. May form a complex including SLC9A3R1 and EZR By similarity. Interacts (via C-terminus 330-346 AA) with GRK5; this interaction is promoted by 5-HT (serotonin) By similarity.

Structurei

3D structure databases

ProteinModelPortaliQ62758.

Family & Domainsi

Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG262978.
HOGENOMiHOG000239242.
HOVERGENiHBG106962.
InParanoidiQ62758.
KOiK04160.
PhylomeDBiQ62758.

Family and domain databases

Gene3Di1.20.1070.10. 1 hit.
InterProiIPR001520. 5HT4_rcpt.
IPR000276. GPCR_Rhodpsn.
IPR017452. GPCR_Rhodpsn_7TM.
[Graphical view]
PANTHERiPTHR24249:SF33. PTHR24249:SF33. 1 hit.
PfamiPF00001. 7tm_1. 1 hit.
[Graphical view]
PRINTSiPR01059. 5HT4RECEPTR.
PR00237. GPCRRHODOPSN.
PROSITEiPS00237. G_PROTEIN_RECEP_F1_1. 1 hit.
PS50262. G_PROTEIN_RECEP_F1_2. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. Align

Note: Additional isoforms seem to exist.

Isoform 5-HT4L (identifier: Q62758-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MDRLDANVSS NEGFGSVEKV VLLTFFAMVI LMAILGNLLV MVAVCRDRQL    50
RKIKTNYFIV SLAFADLLVS VLVNAFGAIE LVQDIWFYGE MFCLVRTSLD 100
VLLTTASIFH LCCISLDRYY AICCQPLVYR NKMTPLRIAL MLGGCWVIPM 150
FISFLPIMQG WNNIGIVDVI EKRKFNHNSN STFCVFMVNK PYAITCSVVA 200
FYIPFLLMVL AYYRIYVTAK EHAQQIQMLQ RAGATSESRP QTADQHSTHR 250
MRTETKAAKT LCVIMGCFCF CWAPFFVTNI VDPFIDYTVP EKVWTAFLWL 300
GYINSGLNPF LYAFLNKSFR RAFLIILCCD DERYKRPPIL GQTVPCSTTT 350
INGSTHVLRD TVECGGQWES RCHLTATSPL VAAQPVIRRP QDNDLEDSCS 400
LKRSQS 406
Length:406
Mass (Da):46,107
Last modified:November 1, 1996 - v1
Checksum:iA1889155A08930B4
GO
Isoform 5-HT4S (identifier: Q62758-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     360-406: DTVECGGQWESRCHLTATSPLVAAQPVIRRPQDNDLEDSCSLKRSQS → YTVLHSGQHQELEKLPIHNDPESLESCF

Show »
Length:387
Mass (Da):44,173
Checksum:i09B2236DF4978D3A
GO
Isoform 5-HT4(E) (identifier: Q62758-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     359-406: RDTVECGGQWESRCHLTATSPLVAAQPVIRRPQDNDLEDSCSLKRSQS → SFPLLFCNRPVPV

Show »
Length:371
Mass (Da):42,254
Checksum:i7D5F0B514486BDA1
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei359 – 40648RDTVE…KRSQS → SFPLLFCNRPVPV in isoform 5-HT4(E).
VSP_001855Add
BLAST
Alternative sequencei360 – 40647DTVEC…KRSQS → YTVLHSGQHQELEKLPIHND PESLESCF in isoform 5-HT4S.
VSP_001854Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti74 – 752NA → MP in CAA09599. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
U20907 mRNA. Translation: AAC52233.1.
U20906 mRNA. Translation: AAC52232.1.
Z48153 mRNA. Translation: CAA88170.1.
AJ011370 mRNA. Translation: CAA09599.1.
PIRiS55549.
S55550.
RefSeqiNP_036985.1. NM_012853.1. [Q62758-1]
UniGeneiRn.10094.

Genome annotation databases

GeneIDi25324.
KEGGirno:25324.
UCSCiRGD:2850. rat. [Q62758-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
U20907 mRNA. Translation: AAC52233.1 .
U20906 mRNA. Translation: AAC52232.1 .
Z48153 mRNA. Translation: CAA88170.1 .
AJ011370 mRNA. Translation: CAA09599.1 .
PIRi S55549.
S55550.
RefSeqi NP_036985.1. NM_012853.1. [Q62758-1 ]
UniGenei Rn.10094.

3D structure databases

ProteinModelPortali Q62758.
ModBasei Search...
MobiDBi Search...

Chemistry

BindingDBi Q62758.
ChEMBLi CHEMBL4317.
GuidetoPHARMACOLOGYi 9.

Protein family/group databases

GPCRDBi Search...

PTM databases

PhosphoSitei Q62758.

Proteomic databases

PaxDbi Q62758.
PRIDEi Q62758.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

GeneIDi 25324.
KEGGi rno:25324.
UCSCi RGD:2850. rat. [Q62758-1 ]

Organism-specific databases

CTDi 3360.
RGDi 2850. Htr4.

Phylogenomic databases

eggNOGi NOG262978.
HOGENOMi HOG000239242.
HOVERGENi HBG106962.
InParanoidi Q62758.
KOi K04160.
PhylomeDBi Q62758.

Miscellaneous databases

NextBioi 606177.
PROi Q62758.

Gene expression databases

Genevestigatori Q62758.

Family and domain databases

Gene3Di 1.20.1070.10. 1 hit.
InterProi IPR001520. 5HT4_rcpt.
IPR000276. GPCR_Rhodpsn.
IPR017452. GPCR_Rhodpsn_7TM.
[Graphical view ]
PANTHERi PTHR24249:SF33. PTHR24249:SF33. 1 hit.
Pfami PF00001. 7tm_1. 1 hit.
[Graphical view ]
PRINTSi PR01059. 5HT4RECEPTR.
PR00237. GPCRRHODOPSN.
PROSITEi PS00237. G_PROTEIN_RECEP_F1_1. 1 hit.
PS50262. G_PROTEIN_RECEP_F1_2. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

  1. "The 5-HT4 receptor: molecular cloning and pharmacological characterization of two splice variants."
    Gerald C., Adham N., Kao H.T., Olsen M.A., Laz T.M., Schechter L.E., Bard J.A., Vaysse P., Hartig P.R., Branchek T.A., Weinshank R.L.
    EMBO J. 14:2806-2815(1995) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA].
    Tissue: Brain.
  2. "Expression of serotonin receptor mRNAs in blood vessels."
    Ullmer C., Schmuck K., Kalkman H.O., Luebbert H.
    FEBS Lett. 370:215-221(1995) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 165-259.
    Tissue: Brain.
  3. "Novel brain-specific 5-HT4 receptor splice variants show marked constitutive activity: role of the C-terminal intracellular domain."
    Claeysen S., Sebben M., Becamel C., Bockaert J., Dumuis A.
    Mol. Pharmacol. 55:910-920(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 5-HT4(E)).
    Tissue: Brain.

Entry informationi

Entry namei5HT4R_RAT
AccessioniPrimary (citable) accession number: Q62758
Secondary accession number(s): O89034, Q62757, Q63006
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: November 1, 1996
Last modified: June 11, 2014
This is version 117 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. 7-transmembrane G-linked receptors
    List of 7-transmembrane G-linked receptor entries
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi