Reviewed,
UniProtKB/Swiss-Prot Q62711 (PLCD4_RAT)
Last modified
February 9, 2010.
Version 67.
History...
Clusters with 100%,
90%,
50% identity |
Documents (1) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase delta-4 EC=3.1.4.11 Alternative name(s): Phosphoinositide phospholipase C-delta-4 Phospholipase C-delta-4 Short name=PLC-delta-4 | ||
| Gene names |
| ||
| Organism | Rattus norvegicus (Rat) | ||
| Taxonomic identifier | 10116 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Rattus |
Protein attributes
| Sequence length | 772 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Hydrolyzes the phosphatidylinositol 4,5-bisphosphate (PIP2) to generate 2 second messenger molecules diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3). DAG mediates the activation of protein kinase C (PKC), while IP3 releases Ca2+ from intracellular stores. Required for acrosome reaction in sperm during fertilization, probably by acting as an important enzyme for intracellular Ca2+ mobilization in the zona pellucida-induced acrosome reaction. May play a role in cell growth. Modulates the liver regeneration in cooperation with nuclear PKC. Overexpression upregulates the Erk signaling pathway and proliferation. Isoform 4 has no enzyme activity and acts as a negative regulator of phospholipases C, with a preference for PLC-delta family. Ref.1 Ref.3 |
| Catalytic activity | 1-phosphatidyl-1D-myo-inositol 4,5-bisphosphate + H2O = 1D-myo-inositol 1,4,5-trisphosphate + diacylglycerol. Ref.1 Ref.2 |
| Cofactor | Binds 3 calcium ions per subunit. Two of the calcium ions are bound to the C2 domain Probable. Ref.1 |
| Subunit structure | Interacts with GRIP1 By similarity. |
| Subcellular location | Endomembrane system; Peripheral membrane protein. Nucleus. Cytoplasm. Endoplasmic reticulum. Note: Localizes primarily to intracellular membranes mostly to the endoplasmic reticulum. Ref.2 Ref.5 Ref.6 |
| Tissue specificity | Present at high level in testis. Also present in brain > skeletal muscle > thyroid gland > stomach > thymus > aorta > heart (at protein level). Highly expressed in regenerating liver. Isoform 4 is weakly expressed compared to other isoforms but is expressed at high level in some neural cells. Ref.1 Ref.2 |
| Developmental stage | Increases at the transition from G1- to S-phase, and the continues to the end of M-phase. Almost disappears when cells re-enter the next G1-phase. Ref.2 |
| Induction | By serum treatment. Ref.2 |
| Domain | The PDZ-binding motif mediates the interaction with GRIP1 By similarity. Ref.5 Ref.4 The C2 domain mediates pre-localization to the membrane prior to Ca2+ import and non-selective Ca2+-mediated targeting to various cellular membranes. Ref.5 Ref.4 The PH domain is not a critical determinant of the membrane localization. The PH domain of isoform 4 is necessary and sufficient to inhibit enzyme activity of other PLC-delta enzymes. Ref.5 Ref.4 |
| Sequence similarities | Contains 1 C2 domain. Contains 3 EF-hand domains. Contains 1 PH domain. Contains 1 PI-PLC X-box domain. Contains 1 PI-PLC Y-box domain. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Lipid degradation |
| Cellular component | Cytoplasm Endoplasmic reticulum Membrane Nucleus |
| Coding sequence diversity | Alternative splicing |
| Domain | Repeat |
| Ligand | Calcium Metal-binding |
| Molecular function | Hydrolase Transducer |
| Gene Ontology (GO) | |
| Biological process | intracellular signaling cascade Ref.1 Traceable author statement. Source: RGD lipid catabolic processInferred from electronic annotation. Source: UniProtKB-KW |
| Cellular component | endoplasmic reticulum Inferred from electronic annotation. Source: UniProtKB-SubCell extrinsic to membraneInferred from electronic annotation. Source: UniProtKB-SubCell nucleusInferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular function | calcium ion binding Inferred from electronic annotation. Source: UniProtKB-KW phosphoinositide phospholipase C activity Ref.1Inferred from direct assay. Source: RGD signal transducer activityInferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q62711-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q62711-2) Also known as: ALT I; The sequence of this isoform differs from the canonical sequence as follows: 487-487: K → KVMKCPMSCLLICVHVLAQAPNSIPESILLP | ||||||
| Isoform 3 (identifier: Q62711-3) Also known as: ALT II; The sequence of this isoform differs from the canonical sequence as follows: 487-487: K → KAPNSIPESILLP | ||||||
| Isoform 4 (identifier: Q62711-4) Also known as: ALT III; The sequence of this isoform differs from the canonical sequence as follows: 424-487: EQLRGKILVK...QASGNKSKNK → VMKCPMSCLLICVHVLAQAPNSIPESILLPKR | ||||||
| Note: Inactive. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 772 | 772 | 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase delta-4 | PRO_0000306829 | |||||
Regions | |||||||||
| Domain | 16 – 124 | 109 | PH | ||||||
| Domain | 134 – 169 | 36 | EF-hand 1 | ||||||
| Domain | 170 – 205 | 36 | EF-hand 2 | ||||||
| Domain | 203 – 237 | 35 | EF-hand 3 | ||||||
| Domain | 290 – 435 | 146 | PI-PLC X-box | ||||||
| Domain | 503 – 619 | 117 | PI-PLC Y-box | ||||||
| Domain | 624 – 729 | 106 | C2 | ||||||
| Calcium binding | 147 – 158 | 12 | 1 Potential | ||||||
| Calcium binding | 183 – 194 | 12 | 2 Potential | ||||||
| Region | 26 – 53 | 28 | Substrate binding By similarity | ||||||
| Motif | 741 – 744 | 4 | PDZ-binding | ||||||
| Compositional bias | 448 – 453 | 6 | Poly-Glu | ||||||
Sites | |||||||||
| Active site | 305 | 1 | By similarity | ||||||
| Active site | 350 | 1 | By similarity | ||||||
| Metal binding | 306 | 1 | Calcium 1; catalytic By similarity | ||||||
| Metal binding | 335 | 1 | Calcium 1; catalytic By similarity | ||||||
| Metal binding | 337 | 1 | Calcium 1; catalytic By similarity | ||||||
| Metal binding | 662 | 1 | Calcium 2 By similarity | ||||||
| Metal binding | 686 | 1 | Calcium 2 By similarity | ||||||
| Metal binding | 715 | 1 | Calcium 3 By similarity | ||||||
| Metal binding | 716 | 1 | Calcium 3; via carbonyl oxygen By similarity | ||||||
| Binding site | 433 | 1 | Substrate By similarity | ||||||
| Binding site | 435 | 1 | Substrate By similarity | ||||||
| Binding site | 532 | 1 | Substrate By similarity | ||||||
| Binding site | 559 | 1 | Substrate By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 424 – 487 | 64 | EQLRG…KSKNK → VMKCPMSCLLICVHVLAQAP NSIPESILLPKR in isoform 4. | VSP_028507 | |||||
| Alternative sequence | 487 | 1 | K → KVMKCPMSCLLICVHVLAQA PNSIPESILLP in isoform 2. | VSP_028508 | |||||
| Alternative sequence | 487 | 1 | K → KAPNSIPESILLP in isoform 3. | VSP_028509 | |||||
Experimental info | |||||||||
| Mutagenesis | 36 | 1 | R → G: Only retains weak enzyme activity and abolishes the ability of isoform 4 to act as a negative regulator. Ref.3 | ||||||
| Mutagenesis | 714 | 1 | K → E: Abolishes affinity for POPC/POPS in the absence of Ca(2+); when associated with E-718. Ref.4 | ||||||
| Mutagenesis | 717 | 1 | S → D: Induces a larger Ca(2+)-dependence. Ref.4 | ||||||
| Mutagenesis | 718 | 1 | R → E: Abolishes affinity for POPC/POPS in the absence of Ca(2+); when associated with E-714. Ref.4 | ||||||
| Sequence conflict | 395 | 1 | M → ML in BAA09046. Ref.2 | ||||||
| Sequence conflict | 416 | 1 | Missing in BAA09046. Ref.2 | ||||||
| Sequence conflict | 425 | 1 | Missing in BAA09046. Ref.2 | ||||||
| Sequence conflict | 757 | 1 | I → H in BAA09046. Ref.2 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| [1] | "Molecular cloning, splice variants, expression, and purification of phospholipase C-delta 4." Lee S.B., Rhee S.-G. J. Biol. Chem. 271:25-31(1996) [PubMed: 8550568] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2 AND 3), FUNCTION, ENZYME ACTIVITY, COFACTOR, TISSUE SPECIFICITY. Strain: Sprague-Dawley. Tissue: Brain. |
| [2] | "A new phospholipase C delta 4 is induced at S-phase of the cell cycle and appears in the nucleus." Liu N., Fukami K., Yu H., Takenawa T. J. Biol. Chem. 271:355-360(1996) [PubMed: 8550586] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), ENZYME ACTIVITY, SUBCELLULAR LOCATION, TISSUE SPECIFICITY, DEVELOPMENTAL STAGE, INDUCTION. Strain: Donryu. |
| [3] | "A novel phospholipase C delta4 (PLCdelta4) splice variant as a negative regulator of PLC." Nagano K., Fukami K., Minagawa T., Watanabe Y., Ozaki C., Takenawa T. J. Biol. Chem. 274:2872-2879(1999) [PubMed: 9915823] [Abstract] Cited for: ALTERNATIVE SPLICING (ISOFORM 4), FUNCTION (ISOFORM 4), MUTAGENESIS OF ARG-36. |
| [4] | "Membrane targeting of C2 domains of phospholipase C-delta isoforms." Ananthanarayanan B., Das S., Rhee S.-G., Murray D., Cho W. J. Biol. Chem. 277:3568-3575(2002) [PubMed: 11706040] [Abstract] Cited for: DOMAIN C2, MUTAGENESIS OF LYS-714; SER-717 AND ARG-718. |
| [5] | "The pleckstrin homology domain of phosphoinositide-specific phospholipase Cdelta4 is not a critical determinant of the membrane localization of the enzyme." Lee S.B., Varnai P., Balla A., Jalink K., Rhee S.G., Balla T. J. Biol. Chem. 279:24362-24371(2004) [PubMed: 15037625] [Abstract] Cited for: DOMAIN PH, SUBCELLULAR LOCATION. |
| [6] | "Expression of phosphoinositide-specific phospholipase C isoenzymes in cultured astrocytes." Lo Vasco V.R., Fabrizi C., Artico M., Cocco L., Billi A.M., Fumagalli L., Manzoli F.A. J. Cell. Biochem. 100:952-959(2007) [PubMed: 17063484] [Abstract] Cited for: SUBCELLULAR LOCATION. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | U16655 mRNA. Translation: AAC52346.1. D50455 mRNA. Translation: BAA09046.1. |
| IPI | IPI00206026. IPI00210334. IPI00777925. IPI00867935. |
| RefSeq | NP_542419.1. |
| UniGene | Rn.37434 |
3D structure databases | |
| HSSP | HSSP built from PDB template 1QAS based on UniProtKB P10688. |
| SMR | Q62711. Positions 194-765. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | Q62711. |
Genome annotation databases | |
| Ensembl | ENSRNOT00000041407; ENSRNOP00000039708; ENSRNOG00000016361; Rattus norvegicus. [Genome view] |
| GeneID | 140693. |
| KEGG | rno:140693. |
| UCSC | NM_080688. rat. |
Organism-specific databases | |
| CTD | 140693. |
| RGD | 621025. Plcd4. |
Phylogenomic databases | |
| eggNOG | roNOG13444. |
| HOVERGEN | Q62711. |
| PhylomeDB | Q62711. |
Enzyme and pathway databases | |
| BRENDA | 3.1.4.11. 248. |
Gene expression databases | |
| ArrayExpress | Q62711. |
| Genevestigator | Q62711. |
Family and domain databases | |
| InterPro | IPR000008. C2_Ca-dep. IPR008973. C2_Ca/lipid-bd_dom_CaLB. IPR018029. C2_membr_targeting. IPR011992. EF-hand-like_dom. IPR018247. EF_Hand_1_Ca_BS. IPR018249. EF_HAND_2. IPR002048. EF_hand_Ca_bd. IPR011993. PH_type. IPR015359. Phospholipase_C_EF-hand-like. IPR001192. Phospholipase_C_Pinositol-sp_C. IPR001711. Phospholipase_C_Pinositol-sp_Y. IPR017946. PLC-like_Pdiesterase_TIM-brl. IPR001849. Pleckstrin_homology. IPR000909. PLipase_C_PInositol-sp_X_dom. [Graphical view] |
| Gene3D | G3DSA:1.10.238.10. EF-Hand_type. 2 hits. G3DSA:2.30.29.30. PH_type. 1 hit. G3DSA:3.20.20.190. PLC-like_Pdiesterase_TIM-brl. 1 hit. |
| Pfam | PF00168. C2. 1 hit. PF09279. efhand_like. 1 hit. PF00388. PI-PLC-X. 1 hit. PF00387. PI-PLC-Y. 1 hit. [Graphical view] |
| PRINTS | PR00390. PHPHLIPASEC. |
| SMART | SM00239. C2. 1 hit. SM00054. EFh. 3 hits. SM00233. PH. 1 hit. SM00148. PLCXc. 1 hit. SM00149. PLCYc. 1 hit. [Graphical view] |
| PROSITE | PS50004. C2. 1 hit. PS00018. EF_HAND_1. 1 hit. PS50222. EF_HAND_2. 3 hits. PS50003. PH_DOMAIN. 1 hit. PS50007. PIPLC_X_DOMAIN. 1 hit. PS50008. PIPLC_Y_DOMAIN. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| NextBio | 620675. |
Entry information
| Entry name | PLCD4_RAT | ||||||||
| Accession | Primary (citable) accession number: Q62711 Secondary accession number(s): Q63693 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||

Clusters with


