Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q62711

- PLCD4_RAT

UniProt

Q62711 - PLCD4_RAT

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-4

Gene

Plcd4

Organism
Rattus norvegicus (Rat)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Hydrolyzes the phosphatidylinositol 4,5-bisphosphate (PIP2) to generate 2 second messenger molecules diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3). DAG mediates the activation of protein kinase C (PKC), while IP3 releases Ca2+ from intracellular stores. Required for acrosome reaction in sperm during fertilization, probably by acting as an important enzyme for intracellular Ca2+ mobilization in the zona pellucida-induced acrosome reaction. May play a role in cell growth. Modulates the liver regeneration in cooperation with nuclear PKC. Overexpression up-regulates the Erk signaling pathway and proliferation. Isoform 4 has no enzyme activity and acts as a negative regulator of phospholipases C, with a preference for PLC-delta family.1 Publication

Catalytic activityi

1-phosphatidyl-1D-myo-inositol 4,5-bisphosphate + H2O = 1D-myo-inositol 1,4,5-trisphosphate + diacylglycerol.2 Publications

Cofactori

Binds 3 calcium ions per subunit. Two of the calcium ions are bound to the C2 domain (Probable).1 Publication

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Active sitei305 – 3051PROSITE-ProRule annotation
Metal bindingi306 – 3061Calcium 1; catalyticBy similarity
Metal bindingi335 – 3351Calcium 1; catalyticBy similarity
Metal bindingi337 – 3371Calcium 1; catalyticBy similarity
Active sitei350 – 3501PROSITE-ProRule annotation
Binding sitei433 – 4331SubstrateBy similarity
Binding sitei435 – 4351SubstrateBy similarity
Binding sitei532 – 5321SubstrateBy similarity
Binding sitei559 – 5591SubstrateBy similarity
Metal bindingi662 – 6621Calcium 2By similarity
Metal bindingi686 – 6861Calcium 2By similarity
Metal bindingi715 – 7151Calcium 3By similarity
Metal bindingi716 – 7161Calcium 3; via carbonyl oxygenBy similarity

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Calcium bindingi147 – 158121PROSITE-ProRule annotationAdd
BLAST
Calcium bindingi183 – 194122PROSITE-ProRule annotationAdd
BLAST

GO - Molecular functioni

  1. calcium ion binding Source: InterPro
  2. phosphatidylinositol phospholipase C activity Source: RGD
  3. signal transducer activity Source: UniProtKB-KW

GO - Biological processi

  1. acrosome reaction Source: InterPro
  2. intracellular signal transduction Source: RGD
  3. lipid catabolic process Source: UniProtKB-KW
  4. phosphatidylinositol metabolic process Source: InterPro
Complete GO annotation...

Keywords - Molecular functioni

Hydrolase, Transducer

Keywords - Biological processi

Lipid degradation, Lipid metabolism

Keywords - Ligandi

Calcium, Metal-binding

Enzyme and pathway databases

BRENDAi3.1.4.11. 5301.

Names & Taxonomyi

Protein namesi
Recommended name:
1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-4 (EC:3.1.4.11)
Alternative name(s):
Phosphoinositide phospholipase C-delta-4
Phospholipase C-delta-4
Short name:
PLC-delta-4
Gene namesi
Name:Plcd4
OrganismiRattus norvegicus (Rat)
Taxonomic identifieri10116 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeRattus
ProteomesiUP000002494: Chromosome 9

Organism-specific databases

RGDi621025. Plcd4.

Subcellular locationi

Endomembrane system; Peripheral membrane protein. Nucleus. Cytoplasm. Endoplasmic reticulum
Note: Localizes primarily to intracellular membranes mostly to the endoplasmic reticulum.

GO - Cellular componenti

  1. endoplasmic reticulum Source: UniProtKB-KW
  2. membrane Source: UniProtKB-KW
  3. nucleus Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Endoplasmic reticulum, Membrane, Nucleus

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi36 – 361R → G: Only retains weak enzyme activity and abolishes the ability of isoform 4 to act as a negative regulator. 1 Publication
Mutagenesisi714 – 7141K → E: Abolishes affinity for POPC/POPS in the absence of Ca(2+); when associated with E-718. 1 Publication
Mutagenesisi717 – 7171S → D: Induces a larger Ca(2+)-dependence. 1 Publication
Mutagenesisi718 – 7181R → E: Abolishes affinity for POPC/POPS in the absence of Ca(2+); when associated with E-714. 1 Publication

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 7727721-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-4PRO_0000306829Add
BLAST

Proteomic databases

PRIDEiQ62711.

Expressioni

Tissue specificityi

Present at high level in testis. Also present in brain > skeletal muscle > thyroid gland > stomach > thymus > aorta > heart (at protein level). Highly expressed in regenerating liver. Isoform 4 is weakly expressed compared to other isoforms but is expressed at high level in some neural cells.2 Publications

Developmental stagei

Increases at the transition from G1- to S-phase, and the continues to the end of M-phase. Almost disappears when cells reenter the next G1-phase.1 Publication

Inductioni

By serum treatment.1 Publication

Gene expression databases

ExpressionAtlasiQ62711. baseline and differential.
GenevestigatoriQ62711.

Interactioni

Subunit structurei

Interacts with GRIP1.By similarity

Protein-protein interaction databases

STRINGi10116.ENSRNOP00000022234.

Structurei

3D structure databases

ProteinModelPortaliQ62711.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini16 – 124109PHPROSITE-ProRule annotationAdd
BLAST
Domaini134 – 16936EF-hand 1PROSITE-ProRule annotationAdd
BLAST
Domaini170 – 20536EF-hand 2PROSITE-ProRule annotationAdd
BLAST
Domaini203 – 23735EF-hand 3PROSITE-ProRule annotationAdd
BLAST
Domaini290 – 435146PI-PLC X-boxPROSITE-ProRule annotationAdd
BLAST
Domaini503 – 619117PI-PLC Y-boxPROSITE-ProRule annotationAdd
BLAST
Domaini624 – 729106C2PROSITE-ProRule annotationAdd
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni26 – 5328Substrate bindingBy similarityAdd
BLAST

Motif

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Motifi741 – 7444PDZ-binding

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi448 – 4536Poly-Glu

Domaini

The PDZ-binding motif mediates the interaction with GRIP1.By similarity
The C2 domain mediates pre-localization to the membrane prior to Ca2+ import and non-selective Ca2+-mediated targeting to various cellular membranes.
The PH domain is not a critical determinant of the membrane localization. The PH domain of isoform 4 is necessary and sufficient to inhibit enzyme activity of other PLC-delta enzymes.

Sequence similaritiesi

Contains 1 C2 domain.PROSITE-ProRule annotation
Contains 3 EF-hand domains.PROSITE-ProRule annotation
Contains 1 PH domain.PROSITE-ProRule annotation
Contains 1 PI-PLC X-box domain.PROSITE-ProRule annotation
Contains 1 PI-PLC Y-box domain.PROSITE-ProRule annotation

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiNOG149692.
GeneTreeiENSGT00760000118936.
HOGENOMiHOG000006871.
HOVERGENiHBG053610.
InParanoidiQ62711.
KOiK05857.
PhylomeDBiQ62711.

Family and domain databases

Gene3Di1.10.238.10. 2 hits.
2.30.29.30. 1 hit.
2.60.40.150. 1 hit.
3.20.20.190. 2 hits.
InterProiIPR000008. C2_dom.
IPR011992. EF-hand-dom_pair.
IPR018247. EF_Hand_1_Ca_BS.
IPR002048. EF_hand_dom.
IPR001849. PH_domain.
IPR011993. PH_like_dom.
IPR001192. PI-PLC_fam.
IPR028387. PLC-delta4.
IPR017946. PLC-like_Pdiesterase_TIM-brl.
IPR015359. PLipase_C_EF-hand-like.
IPR000909. PLipase_C_PInositol-sp_X_dom.
IPR001711. PLipase_C_Pinositol-sp_Y.
[Graphical view]
PANTHERiPTHR10336. PTHR10336. 1 hit.
PTHR10336:SF31. PTHR10336:SF31. 1 hit.
PfamiPF00168. C2. 1 hit.
PF09279. EF-hand_like. 1 hit.
PF00388. PI-PLC-X. 1 hit.
PF00387. PI-PLC-Y. 1 hit.
[Graphical view]
PRINTSiPR00390. PHPHLIPASEC.
SMARTiSM00239. C2. 1 hit.
SM00054. EFh. 3 hits.
SM00233. PH. 1 hit.
SM00148. PLCXc. 1 hit.
SM00149. PLCYc. 1 hit.
[Graphical view]
SUPFAMiSSF49562. SSF49562. 1 hit.
SSF51695. SSF51695. 1 hit.
PROSITEiPS50004. C2. 1 hit.
PS00018. EF_HAND_1. 1 hit.
PS50222. EF_HAND_2. 3 hits.
PS50003. PH_DOMAIN. 1 hit.
PS50007. PIPLC_X_DOMAIN. 1 hit.
PS50008. PIPLC_Y_DOMAIN. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q62711-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MASQIQKLLT TNQDLLLMQK GTMMRKVRTK SWKKLRYFRL QDDGMTVWHG
60 70 80 90 100
RHLESISKPT FSISDVERIR KGQDSELLRY LVEEFPLEQG FTIVFNGRRP
110 120 130 140 150
NLDLVANSVE EAQTWMRGLQ LLVDLVARMN YQEQLDQMLR EWFQQADRNQ
160 170 180 190 200
DSRMSFREAQ RLLLLMNVEM DEEYAFSLFQ EADVSQSNTL DSEEFVQFYK
210 220 230 240 250
ALTKRTEIEE LFENFSSDKQ KLTLLEFVDF LREEQKESDH SSDLALKLID
260 270 280 290 300
RYEPSENGRL LRVLSKDGFL SYLCSADGNI FNPDCLPIYQ DMTQPLSHYY
310 320 330 340 350
INSSHNTYLL GDQFCGQSSV EGYIRALKRG CRCVEVDTWD GPDGEPVVYH
360 370 380 390 400
GRTLTSRILF KDVLATLAQY AFQSSDYPLI LSLDNHCTWE QQKTMAHHLI
410 420 430 440 450
AILGEQLLST TLEEQLIDIM PSPEQLRGKI LVKGKKLRTI EVVESDKEEE
460 470 480 490 500
ELEKDEGSDL DPASAELDMQ SQPESQEQAS GNKSKNKKKF LLQSSTTILC
510 520 530 540 550
PDLSALVVYL RTAPFCSFTH SKENYHIYDI SSFSESKAKN LIREAGNEFV
560 570 580 590 600
QHNARQLCRV YPSGLRTDSS NYNPQEHWNV GCQMVAMNMQ TAGSAMDICD
610 620 630 640 650
GLFRQNGGSG YVLKPEFLRD TQSSFNPMKP VSLYKAQILV VQVISGQRLP
660 670 680 690 700
KVDKTKETTV VDPLVRVELY GVPEDTKQQE TSYVENNGIN PYWGETFYFQ
710 720 730 740 750
IQVPELAMLR FVVKDYSRTS RNNFIGQYTL PWTCMKHGYR HVSLLSKDGT
760 770
SLHPASIFVY TCMQEDLDMD EP
Length:772
Mass (Da):88,967
Last modified:November 1, 1996 - v1
Checksum:i5DD56D1D4AA21356
GO
Isoform 2 (identifier: Q62711-2) [UniParc]FASTAAdd to Basket

Also known as: ALT I

The sequence of this isoform differs from the canonical sequence as follows:
     487-487: K → KVMKCPMSCLLICVHVLAQAPNSIPESILLP

Show »
Length:802
Mass (Da):92,170
Checksum:i182467F673D92243
GO
Isoform 3 (identifier: Q62711-3) [UniParc]FASTAAdd to Basket

Also known as: ALT II

The sequence of this isoform differs from the canonical sequence as follows:
     487-487: K → KAPNSIPESILLP

Show »
Length:784
Mass (Da):90,199
Checksum:i17D1E14860897530
GO
Isoform 4 (identifier: Q62711-4) [UniParc]FASTAAdd to Basket

Also known as: ALT III

The sequence of this isoform differs from the canonical sequence as follows:
     424-487: EQLRGKILVK...QASGNKSKNK → VMKCPMSCLLICVHVLAQAPNSIPESILLPKR

Note: Inactive.

Show »
Length:740
Mass (Da):85,314
Checksum:iB0C008AAA45E7F9A
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti395 – 3951M → ML in BAA09046. (PubMed:8550586)Curated
Sequence conflicti416 – 4161Missing in BAA09046. (PubMed:8550586)Curated
Sequence conflicti425 – 4251Missing in BAA09046. (PubMed:8550586)Curated
Sequence conflicti757 – 7571I → H in BAA09046. (PubMed:8550586)Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei424 – 48764EQLRG…KSKNK → VMKCPMSCLLICVHVLAQAP NSIPESILLPKR in isoform 4. CuratedVSP_028507Add
BLAST
Alternative sequencei487 – 4871K → KVMKCPMSCLLICVHVLAQA PNSIPESILLP in isoform 2. 1 PublicationVSP_028508
Alternative sequencei487 – 4871K → KAPNSIPESILLP in isoform 3. 1 PublicationVSP_028509

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
U16655 mRNA. Translation: AAC52346.1.
D50455 mRNA. Translation: BAA09046.1.
RefSeqiNP_542419.1. NM_080688.1. [Q62711-1]
UniGeneiRn.37434.

Genome annotation databases

EnsembliENSRNOT00000041407; ENSRNOP00000039708; ENSRNOG00000016361. [Q62711-1]
GeneIDi140693.
KEGGirno:140693.
UCSCiRGD:621025. rat. [Q62711-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
U16655 mRNA. Translation: AAC52346.1 .
D50455 mRNA. Translation: BAA09046.1 .
RefSeqi NP_542419.1. NM_080688.1. [Q62711-1 ]
UniGenei Rn.37434.

3D structure databases

ProteinModelPortali Q62711.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

STRINGi 10116.ENSRNOP00000022234.

Chemistry

BindingDBi Q62711.

Proteomic databases

PRIDEi Q62711.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENSRNOT00000041407 ; ENSRNOP00000039708 ; ENSRNOG00000016361 . [Q62711-1 ]
GeneIDi 140693.
KEGGi rno:140693.
UCSCi RGD:621025. rat. [Q62711-1 ]

Organism-specific databases

CTDi 84812.
RGDi 621025. Plcd4.

Phylogenomic databases

eggNOGi NOG149692.
GeneTreei ENSGT00760000118936.
HOGENOMi HOG000006871.
HOVERGENi HBG053610.
InParanoidi Q62711.
KOi K05857.
PhylomeDBi Q62711.

Enzyme and pathway databases

BRENDAi 3.1.4.11. 5301.

Miscellaneous databases

NextBioi 620675.
PROi Q62711.

Gene expression databases

ExpressionAtlasi Q62711. baseline and differential.
Genevestigatori Q62711.

Family and domain databases

Gene3Di 1.10.238.10. 2 hits.
2.30.29.30. 1 hit.
2.60.40.150. 1 hit.
3.20.20.190. 2 hits.
InterProi IPR000008. C2_dom.
IPR011992. EF-hand-dom_pair.
IPR018247. EF_Hand_1_Ca_BS.
IPR002048. EF_hand_dom.
IPR001849. PH_domain.
IPR011993. PH_like_dom.
IPR001192. PI-PLC_fam.
IPR028387. PLC-delta4.
IPR017946. PLC-like_Pdiesterase_TIM-brl.
IPR015359. PLipase_C_EF-hand-like.
IPR000909. PLipase_C_PInositol-sp_X_dom.
IPR001711. PLipase_C_Pinositol-sp_Y.
[Graphical view ]
PANTHERi PTHR10336. PTHR10336. 1 hit.
PTHR10336:SF31. PTHR10336:SF31. 1 hit.
Pfami PF00168. C2. 1 hit.
PF09279. EF-hand_like. 1 hit.
PF00388. PI-PLC-X. 1 hit.
PF00387. PI-PLC-Y. 1 hit.
[Graphical view ]
PRINTSi PR00390. PHPHLIPASEC.
SMARTi SM00239. C2. 1 hit.
SM00054. EFh. 3 hits.
SM00233. PH. 1 hit.
SM00148. PLCXc. 1 hit.
SM00149. PLCYc. 1 hit.
[Graphical view ]
SUPFAMi SSF49562. SSF49562. 1 hit.
SSF51695. SSF51695. 1 hit.
PROSITEi PS50004. C2. 1 hit.
PS00018. EF_HAND_1. 1 hit.
PS50222. EF_HAND_2. 3 hits.
PS50003. PH_DOMAIN. 1 hit.
PS50007. PIPLC_X_DOMAIN. 1 hit.
PS50008. PIPLC_Y_DOMAIN. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

  1. "Molecular cloning, splice variants, expression, and purification of phospholipase C-delta 4."
    Lee S.B., Rhee S.-G.
    J. Biol. Chem. 271:25-31(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2 AND 3), FUNCTION, ENZYME ACTIVITY, COFACTOR, TISSUE SPECIFICITY.
    Strain: Sprague-Dawley.
    Tissue: Brain.
  2. "A new phospholipase C delta 4 is induced at S-phase of the cell cycle and appears in the nucleus."
    Liu N., Fukami K., Yu H., Takenawa T.
    J. Biol. Chem. 271:355-360(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), ENZYME ACTIVITY, SUBCELLULAR LOCATION, TISSUE SPECIFICITY, DEVELOPMENTAL STAGE, INDUCTION.
    Strain: Donryu.
  3. "A novel phospholipase C delta4 (PLCdelta4) splice variant as a negative regulator of PLC."
    Nagano K., Fukami K., Minagawa T., Watanabe Y., Ozaki C., Takenawa T.
    J. Biol. Chem. 274:2872-2879(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: ALTERNATIVE SPLICING (ISOFORM 4), FUNCTION (ISOFORM 4), MUTAGENESIS OF ARG-36.
  4. "Membrane targeting of C2 domains of phospholipase C-delta isoforms."
    Ananthanarayanan B., Das S., Rhee S.-G., Murray D., Cho W.
    J. Biol. Chem. 277:3568-3575(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: DOMAIN C2, MUTAGENESIS OF LYS-714; SER-717 AND ARG-718.
  5. "The pleckstrin homology domain of phosphoinositide-specific phospholipase Cdelta4 is not a critical determinant of the membrane localization of the enzyme."
    Lee S.B., Varnai P., Balla A., Jalink K., Rhee S.G., Balla T.
    J. Biol. Chem. 279:24362-24371(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: DOMAIN PH, SUBCELLULAR LOCATION.
  6. "Expression of phosphoinositide-specific phospholipase C isoenzymes in cultured astrocytes."
    Lo Vasco V.R., Fabrizi C., Artico M., Cocco L., Billi A.M., Fumagalli L., Manzoli F.A.
    J. Cell. Biochem. 100:952-959(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: SUBCELLULAR LOCATION.

Entry informationi

Entry nameiPLCD4_RAT
AccessioniPrimary (citable) accession number: Q62711
Secondary accession number(s): Q63693
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 2, 2007
Last sequence update: November 1, 1996
Last modified: October 29, 2014
This is version 110 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3