Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Noelin

Gene

Olfm1

Organism
Rattus norvegicus (Rat)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Contributes to the regulation of axonal growth in the embryonic and adult central nervous system by inhibiting interactions between RTN4R and LINGO1. Inhibits RTN4R-mediated axon growth cone collapse (By similarity). May play an important role in regulating the production of neural crest cells by the neural tube (By similarity). May be required for normal responses to olfactory stimuli (By similarity).By similarity

GO - Biological processi

Keywordsi

Molecular functionDevelopmental protein

Names & Taxonomyi

Protein namesi
Recommended name:
Noelin
Alternative name(s):
1B426B
Neuronal olfactomedin-related ER localized protein
Olfactomedin-11 Publication
Pancortin1 Publication
Gene namesi
Name:Olfm1
Synonyms:D2Sut1e, Noe1, Noel, Noel1
OrganismiRattus norvegicus (Rat)
Taxonomic identifieri10116 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeRattus
Proteomesi
  • UP000002494 Componenti: Chromosome 3

Organism-specific databases

RGDi620320 Olfm1

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell junction, Cell projection, Endoplasmic reticulum, Secreted, Synapse

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 24Sequence analysisAdd BLAST24
ChainiPRO_000002007625 – 485NoelinAdd BLAST461

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi33N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi103N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi187N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi221InterchainBy similarity
Disulfide bondi227 ↔ 409PROSITE-ProRule annotation
Glycosylationi288N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi307N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi394N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi431N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi473N-linked (GlcNAc...) asparagineSequence analysis1

Post-translational modificationi

In isoform 3 and isoform 4, the signal peptide is predicted to end in position 17.

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDbiQ62609
PRIDEiQ62609

PTM databases

UniCarbKBiQ62609

Expressioni

Tissue specificityi

Expressed in the brain (at protein level) (PubMed:7932877, PubMed:22632720). Expressed in the brain, predominantly in the cortex and hippocampus. In the pituitary only the two A-type and in the adrenal glands only the two B-type forms were detected (PubMed:7932877).2 Publications

Gene expression databases

BgeeiENSRNOG00000009862
GenevisibleiQ62609 RN

Interactioni

Subunit structurei

Homotetramer; disulfide-linked. Dimer of dimers, giving rise to a V-shaped homotretramer. Isoform 1 and isoform 3 interact with RTN4R. Identified in a complex with RTN4R and LINGO1 (By similarity). Peripherally associated with AMPAR complex. AMPAR complex consists of an inner core made of 4 pore-forming GluA/GRIA proteins (GRIA1, GRIA2, GRIA3 and GRIA4) and 4 major auxiliary subunits arranged in a twofold symmetry. One of the two pairs of distinct binding sites is occupied either by CNIH2, CNIH3 or CACNG2, CACNG3. The other harbors CACNG2, CACNG3, CACNG4, CACNG8 or GSG1L. This inner core of AMPAR complex is complemented by outer core constituents binding directly to the GluA/GRIA proteins at sites distinct from the interaction sites of the inner core constituents. Outer core constituents include at least PRRT1, PRRT2, CKAMP44/SHISA9, FRRS1L and NRN1. The proteins of the inner and outer core serve as a platform for other, more peripherally associated AMPAR constituents, including OLFM1. Alone or in combination, these auxiliary subunits control the gating and pharmacology of the AMPAR complex and profoundly impact their biogenesis and protein processing (PubMed:22632720). Interacts with OLFM2 (By similarity).By similarity1 Publication

Protein-protein interaction databases

STRINGi10116.ENSRNOP00000013443

Structurei

3D structure databases

ProteinModelPortaliQ62609
SMRiQ62609
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini226 – 478Olfactomedin-likePROSITE-ProRule annotationAdd BLAST253

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili87 – 225Sequence analysisAdd BLAST139

Domaini

The protein contains a globular N-terminal tetramerization domain, a long stalk formed by the coiled coil region and a C-terminal olfactomedin-like domain. Interactions between dimers are mediated by the coiled coil region. The dimers interact mostly via the N-terminal tetramerization domain, giving rise to a V-shaped overall architecture of the tetramer.By similarity

Keywords - Domaini

Coiled coil, Signal

Phylogenomic databases

eggNOGiENOG410INP4 Eukaryota
ENOG41104PB LUCA
GeneTreeiENSGT00760000119005
HOGENOMiHOG000232069
HOVERGENiHBG006513
InParanoidiQ62609
OMAiQILQTWN
OrthoDBiEOG091G05HN
PhylomeDBiQ62609
TreeFamiTF315964

Family and domain databases

InterProiView protein in InterPro
IPR031217 Noelin
IPR022082 Noelin_dom
IPR003112 Olfac-like_dom
IPR011044 Quino_amine_DH_bsu
PANTHERiPTHR23192:SF34 PTHR23192:SF34, 1 hit
PfamiView protein in Pfam
PF12308 Noelin-1, 1 hit
PF02191 OLF, 1 hit
SMARTiView protein in SMART
SM00284 OLF, 1 hit
SUPFAMiSSF50969 SSF50969, 2 hits
PROSITEiView protein in PROSITE
PS00014 ER_TARGET, 1 hit
PS51132 OLF, 1 hit

Sequences (4)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q62609-1) [UniParc]FASTAAdd to basket
Also known as: BMZ

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSVPLLKIGV VLSTMAMITN WMSQTLPSLV GLNTTRLSAA SGGTLDRSTG
60 70 80 90 100
VLPTNPEESW QVYSSAQDSE GRCICTVVAP QQTMCSRDAR TKQLRQLLEK
110 120 130 140 150
VQNMSQSIEV LDRRTQRDLQ YVEKMENQMK GLESKFRQVE ESHKQHLARQ
160 170 180 190 200
FKAIKAKMDE LRPLIPVLEE YKADAKLVLQ FKEEVQNLTS VLNELQEEIG
210 220 230 240 250
AYDYDELQSR VSNLEERLRA CMQKLACGKL TGISDPVTVK TSGSRFGSWM
260 270 280 290 300
TDPLAPEGDN RVWYMDGYHN NRFVREYKSM VDFMNTDNFT SHRLPHPWSG
310 320 330 340 350
TGQVVYNGSI YFNKFQSHII IRFDLKTETI LKTRSLDYAG YNNMYHYAWG
360 370 380 390 400
GHSDIDLMVD ENGLWAVYAT NQNAGNIVIS KLDPVSLQIL QTWNTSYPKR
410 420 430 440 450
SAGEAFIICG TLYVTNGYSG GTKVHYAYQT NASTYEYIDI PFQNKYSHIS
460 470 480
MLDYNPKDRA LYAWNNGHQT LYNVTLFHVI RSDEL
Length:485
Mass (Da):55,442
Last modified:November 1, 1996 - v1
Checksum:i08D0DA6A40B20F29
GO
Isoform 2 (identifier: Q62609-2) [UniParc]FASTAAdd to basket
Also known as: BMY

The sequence of this isoform differs from the canonical sequence as follows:
     153-153: A → G
     154-485: Missing.

Show »
Length:153
Mass (Da):17,246
Checksum:iD6C281ADDCFE09E9
GO
Isoform 3 (identifier: Q62609-3) [UniParc]FASTAAdd to basket
Also known as: AMZ

The sequence of this isoform differs from the canonical sequence as follows:
     1-50: MSVPLLKIGVVLSTMAMITNWMSQTLPSLVGLNTTRLSAASGGTLDRSTG → MQPARKLLSLLVLLVMGTELTQ

Show »
Length:457
Mass (Da):52,718
Checksum:iA6D35E0C6E49497B
GO
Isoform 4 (identifier: Q62609-4) [UniParc]FASTAAdd to basket
Also known as: AMY

The sequence of this isoform differs from the canonical sequence as follows:
     1-50: MSVPLLKIGVVLSTMAMITNWMSQTLPSLVGLNTTRLSAASGGTLDRSTG → MQPARKLLSLLVLLVMGTELTQ
     153-153: A → G
     154-485: Missing.

Show »
Length:125
Mass (Da):14,522
Checksum:i7C50F3876C31DF78
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0037651 – 50MSVPL…DRSTG → MQPARKLLSLLVLLVMGTEL TQ in isoform 3 and isoform 4. 1 PublicationAdd BLAST50
Alternative sequenceiVSP_003766153A → G in isoform 2 and isoform 4. 1 Publication1
Alternative sequenceiVSP_003767154 – 485Missing in isoform 2 and isoform 4. 1 PublicationAdd BLAST332

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U03417 mRNA Translation: AAC04321.1
U03416 mRNA Translation: AAC04320.1
U03415 mRNA Translation: AAC04319.1
U03414 mRNA Translation: AAC04317.1
PIRiI73636
I73637
RefSeqiNP_446025.1, NM_053573.1 [Q62609-1]
XP_006233937.1, XM_006233875.3 [Q62609-3]
XP_006233938.1, XM_006233876.3 [Q62609-2]
XP_006233939.1, XM_006233877.2 [Q62609-4]
UniGeneiRn.11005

Genome annotation databases

EnsembliENSRNOT00000013443; ENSRNOP00000013443; ENSRNOG00000009862 [Q62609-1]
ENSRNOT00000065953; ENSRNOP00000060981; ENSRNOG00000009862 [Q62609-2]
GeneIDi93667
KEGGirno:93667
UCSCiRGD:620320 rat [Q62609-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiNOE1_RAT
AccessioniPrimary (citable) accession number: Q62609
Secondary accession number(s): Q62606, Q62607, Q62608
Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 15, 1998
Last sequence update: November 1, 1996
Last modified: May 23, 2018
This is version 135 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health