Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q62609 (NOE1_RAT) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 111. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (1) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Noelin
Alternative name(s):
1B426B
Neuronal olfactomedin-related ER localized protein
Olfactomedin-1
Pancortin
Gene names
Name:Olfm1
Synonyms:D2Sut1e, Noe1, Noel, Noel1
OrganismRattus norvegicus (Rat) [Reference proteome]
Taxonomic identifier10116 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeRattus

Protein attributes

Sequence length485 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is further processed into a mature form.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

May play an important role in regulating the production of neural crest cells by the neural tube By similarity.

Subunit structure

Peripherally associated with AMPAR complex. AMPAR complex consists of an inner core made of 4 pore-forming GluA/GRIA proteins (GRIA1, GRIA2, GRIA3 and GRIA4) and 4 major auxiliary subunits arranged in a twofold symmetry. One of the two pairs of distinct binding sites is occupied either by CNIH2, CNIH3 or CACNG2, CACNG3. The other harbors CACNG2, CACNG3, CACNG4, CACNG8 or GSG1L. This inner core of AMPAR complex is complemented by outer core constituents binding directly to the GluA/GRIA proteins at sites distinct from the interaction sites of the inner core constituents. Outer core constituents include at least PRRT1, PRRT2, CKAMP44/SHISA9, FRRS1L and NRN1. The proteins of the inner and outer core serve as a platform for other, more peripherally associated AMPAR constituents, including OLFM1. Alone or in combination, these auxiliary subunits control the gating and pharmacology of the AMPAR complex and profoundly impact their biogenesis and protein processing. Ref.2

Subcellular location

Secreted Potential. Cell junctionsynapse Probable Ref.2.

Tissue specificity

Expressed in the brain (at protein level), predominantly in the cortex and hippocampus. In the pituitary only the two A-type and in the adrenal glands only the two B-type forms were detected. Ref.2

Post-translational modification

In isoform 3 and isoform 4, the signal peptide is predicted to end in position 17.

Sequence similarities

Contains 1 olfactomedin-like domain.

Alternative products

This entry describes 4 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q62609-1)

Also known as: BMZ;

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q62609-2)

Also known as: BMY;

The sequence of this isoform differs from the canonical sequence as follows:
     153-153: A → G
     154-485: Missing.
Isoform 3 (identifier: Q62609-3)

Also known as: AMZ;

The sequence of this isoform differs from the canonical sequence as follows:
     1-50: MSVPLLKIGVVLSTMAMITNWMSQTLPSLVGLNTTRLSAASGGTLDRSTG → MQPARKLLSLLVLLVMGTELTQ
Isoform 4 (identifier: Q62609-4)

Also known as: AMY;

The sequence of this isoform differs from the canonical sequence as follows:
     1-50: MSVPLLKIGVVLSTMAMITNWMSQTLPSLVGLNTTRLSAASGGTLDRSTG → MQPARKLLSLLVLLVMGTELTQ
     153-153: A → G
     154-485: Missing.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Signal peptide1 – 2424 Potential
Chain25 – 485461Noelin
PRO_0000020076

Regions

Domain226 – 478253Olfactomedin-like
Coiled coil87 – 225139 Potential

Amino acid modifications

Glycosylation331N-linked (GlcNAc...) Potential
Glycosylation1031N-linked (GlcNAc...) Potential
Glycosylation1871N-linked (GlcNAc...) Potential
Glycosylation2881N-linked (GlcNAc...) Potential
Glycosylation3071N-linked (GlcNAc...) Potential
Glycosylation3941N-linked (GlcNAc...) Potential
Glycosylation4311N-linked (GlcNAc...) Potential
Glycosylation4731N-linked (GlcNAc...) Potential
Disulfide bond227 ↔ 409 By similarity

Natural variations

Alternative sequence1 – 5050MSVPL…DRSTG → MQPARKLLSLLVLLVMGTEL TQ in isoform 3 and isoform 4.
VSP_003765
Alternative sequence1531A → G in isoform 2 and isoform 4.
VSP_003766
Alternative sequence154 – 485332Missing in isoform 2 and isoform 4.
VSP_003767

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 (BMZ) [UniParc].

Last modified November 1, 1996. Version 1.
Checksum: 08D0DA6A40B20F29

FASTA48555,442
        10         20         30         40         50         60 
MSVPLLKIGV VLSTMAMITN WMSQTLPSLV GLNTTRLSAA SGGTLDRSTG VLPTNPEESW 

        70         80         90        100        110        120 
QVYSSAQDSE GRCICTVVAP QQTMCSRDAR TKQLRQLLEK VQNMSQSIEV LDRRTQRDLQ 

       130        140        150        160        170        180 
YVEKMENQMK GLESKFRQVE ESHKQHLARQ FKAIKAKMDE LRPLIPVLEE YKADAKLVLQ 

       190        200        210        220        230        240 
FKEEVQNLTS VLNELQEEIG AYDYDELQSR VSNLEERLRA CMQKLACGKL TGISDPVTVK 

       250        260        270        280        290        300 
TSGSRFGSWM TDPLAPEGDN RVWYMDGYHN NRFVREYKSM VDFMNTDNFT SHRLPHPWSG 

       310        320        330        340        350        360 
TGQVVYNGSI YFNKFQSHII IRFDLKTETI LKTRSLDYAG YNNMYHYAWG GHSDIDLMVD 

       370        380        390        400        410        420 
ENGLWAVYAT NQNAGNIVIS KLDPVSLQIL QTWNTSYPKR SAGEAFIICG TLYVTNGYSG 

       430        440        450        460        470        480 
GTKVHYAYQT NASTYEYIDI PFQNKYSHIS MLDYNPKDRA LYAWNNGHQT LYNVTLFHVI 


RSDEL 

« Hide

Isoform 2 (BMY) [UniParc].

Checksum: D6C281ADDCFE09E9
Show »

FASTA15317,246
Isoform 3 (AMZ) [UniParc].

Checksum: A6D35E0C6E49497B
Show »

FASTA45752,718
Isoform 4 (AMY) [UniParc].

Checksum: 7C50F3876C31DF78
Show »

FASTA12514,522

References

[1]"Four structurally distinct neuron-specific olfactomedin-related glycoproteins produced by differential promoter utilization and alternative mRNA splicing from a single gene."
Danielson P.E., Forss-Petter S., Battenberg E.L.F., Delecea L., Bloom F.E., Sutcliffe J.G.
J. Neurosci. Res. 38:468-478(1994) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3 AND 4).
Strain: Sprague-Dawley.
Tissue: Brain.
[2]"High-resolution proteomics unravel architecture and molecular diversity of native AMPA receptor complexes."
Schwenk J., Harmel N., Brechet A., Zolles G., Berkefeld H., Muller C.S., Bildl W., Baehrens D., Huber B., Kulik A., Klocker N., Schulte U., Fakler B.
Neuron 74:621-633(2012) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION IN AMPAR COMPLEX, SUBCELLULAR LOCATION, TISSUE SPECIFICITY.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
U03417 mRNA. Translation: AAC04321.1.
U03416 mRNA. Translation: AAC04320.1.
U03415 mRNA. Translation: AAC04319.1.
U03414 mRNA. Translation: AAC04317.1.
PIRI73636.
I73637.
RefSeqNP_446025.1. NM_053573.1.
XP_006233937.1. XM_006233875.1.
XP_006233938.1. XM_006233876.1.
XP_006233939.1. XM_006233877.1.
UniGeneRn.11005.

3D structure databases

ProteinModelPortalQ62609.
ModBaseSearch...
MobiDBSearch...

Proteomic databases

PaxDbQ62609.
PRIDEQ62609.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENSRNOT00000013443; ENSRNOP00000013443; ENSRNOG00000009862. [Q62609-1]
ENSRNOT00000044951; ENSRNOP00000051216; ENSRNOG00000009862. [Q62609-3]
ENSRNOT00000065953; ENSRNOP00000060981; ENSRNOG00000009862. [Q62609-2]
GeneID93667.
KEGGrno:93667.
UCSCRGD:620320. rat. [Q62609-1]

Organism-specific databases

CTD10439.
RGD620320. Olfm1.

Phylogenomic databases

eggNOGNOG283888.
GeneTreeENSGT00750000117256.
HOGENOMHOG000232069.
HOVERGENHBG006513.
InParanoidQ62609.
OMAQILQTWN.
OrthoDBEOG75F4CZ.
PhylomeDBQ62609.
TreeFamTF315964.

Gene expression databases

GenevestigatorQ62609.

Family and domain databases

InterProIPR022082. Noelin-1.
IPR003112. Olfac-like.
IPR011044. Quino_amine_DH_bsu.
[Graphical view]
PfamPF12308. Noelin-1. 1 hit.
PF02191. OLF. 1 hit.
[Graphical view]
SMARTSM00284. OLF. 1 hit.
[Graphical view]
SUPFAMSSF50969. SSF50969. 2 hits.
PROSITEPS00014. ER_TARGET. 1 hit.
PS51132. OLF. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

NextBio617790.
PROQ62609.

Entry information

Entry nameNOE1_RAT
AccessionPrimary (citable) accession number: Q62609
Secondary accession number(s): Q62606, Q62607, Q62608
Entry history
Integrated into UniProtKB/Swiss-Prot: July 15, 1998
Last sequence update: November 1, 1996
Last modified: April 16, 2014
This is version 111 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Relevant documents

SIMILARITY comments

Index of protein domains and families