SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q62609

- NOE1_RAT

UniProt

Q62609 - NOE1_RAT

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Noelin

Gene
Olfm1, D2Sut1e, Noe1, Noel, Noel1
Organism
Rattus norvegicus (Rat)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

May play an important role in regulating the production of neural crest cells by the neural tube By similarity.

GO - Biological processi

  1. multicellular organismal development Source: UniProtKB-KW
  2. protein oligomerization Source: Ensembl
Complete GO annotation...

Keywords - Molecular functioni

Developmental protein

Names & Taxonomyi

Protein namesi
Recommended name:
Noelin
Alternative name(s):
1B426B
Neuronal olfactomedin-related ER localized protein
Olfactomedin-1
Pancortin
Gene namesi
Name:Olfm1
Synonyms:D2Sut1e, Noe1, Noel, Noel1
OrganismiRattus norvegicus (Rat)
Taxonomic identifieri10116 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeRattus
ProteomesiUP000002494: Chromosome 3

Organism-specific databases

RGDi620320. Olfm1.

Subcellular locationi

Secreted Reviewed prediction. Cell junctionsynapse Inferred 1 Publication

GO - Cellular componenti

  1. alpha-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid selective glutamate receptor complex Source: Ensembl
  2. cell junction Source: UniProtKB-KW
  3. extracellular space Source: Ensembl
  4. synapse Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Cell junction, Secreted, Synapse

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 2424 Reviewed predictionAdd
BLAST
Chaini25 – 485461NoelinPRO_0000020076Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi33 – 331N-linked (GlcNAc...) Reviewed prediction
Glycosylationi103 – 1031N-linked (GlcNAc...) Reviewed prediction
Glycosylationi187 – 1871N-linked (GlcNAc...) Reviewed prediction
Disulfide bondi227 ↔ 409 By similarity
Glycosylationi288 – 2881N-linked (GlcNAc...) Reviewed prediction
Glycosylationi307 – 3071N-linked (GlcNAc...) Reviewed prediction
Glycosylationi394 – 3941N-linked (GlcNAc...) Reviewed prediction
Glycosylationi431 – 4311N-linked (GlcNAc...) Reviewed prediction
Glycosylationi473 – 4731N-linked (GlcNAc...) Reviewed prediction

Post-translational modificationi

In isoform 3 and isoform 4, the signal peptide is predicted to end in position 17.

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDbiQ62609.
PRIDEiQ62609.

Expressioni

Tissue specificityi

Expressed in the brain (at protein level), predominantly in the cortex and hippocampus. In the pituitary only the two A-type and in the adrenal glands only the two B-type forms were detected.1 Publication

Gene expression databases

GenevestigatoriQ62609.

Interactioni

Subunit structurei

Peripherally associated with AMPAR complex. AMPAR complex consists of an inner core made of 4 pore-forming GluA/GRIA proteins (GRIA1, GRIA2, GRIA3 and GRIA4) and 4 major auxiliary subunits arranged in a twofold symmetry. One of the two pairs of distinct binding sites is occupied either by CNIH2, CNIH3 or CACNG2, CACNG3. The other harbors CACNG2, CACNG3, CACNG4, CACNG8 or GSG1L. This inner core of AMPAR complex is complemented by outer core constituents binding directly to the GluA/GRIA proteins at sites distinct from the interaction sites of the inner core constituents. Outer core constituents include at least PRRT1, PRRT2, CKAMP44/SHISA9, FRRS1L and NRN1. The proteins of the inner and outer core serve as a platform for other, more peripherally associated AMPAR constituents, including OLFM1. Alone or in combination, these auxiliary subunits control the gating and pharmacology of the AMPAR complex and profoundly impact their biogenesis and protein processing.1 Publication

Structurei

3D structure databases

ProteinModelPortaliQ62609.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini226 – 478253Olfactomedin-likeAdd
BLAST

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili87 – 225139 Reviewed predictionAdd
BLAST

Sequence similaritiesi

Keywords - Domaini

Coiled coil, Signal

Phylogenomic databases

eggNOGiNOG283888.
GeneTreeiENSGT00750000117256.
HOGENOMiHOG000232069.
HOVERGENiHBG006513.
InParanoidiQ62609.
OMAiQILQTWN.
OrthoDBiEOG75F4CZ.
PhylomeDBiQ62609.
TreeFamiTF315964.

Family and domain databases

InterProiIPR022082. Noelin-1.
IPR003112. Olfac-like.
IPR011044. Quino_amine_DH_bsu.
[Graphical view]
PfamiPF12308. Noelin-1. 1 hit.
PF02191. OLF. 1 hit.
[Graphical view]
SMARTiSM00284. OLF. 1 hit.
[Graphical view]
SUPFAMiSSF50969. SSF50969. 2 hits.
PROSITEiPS00014. ER_TARGET. 1 hit.
PS51132. OLF. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q62609-1) [UniParc]FASTAAdd to Basket

Also known as: BMZ

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MSVPLLKIGV VLSTMAMITN WMSQTLPSLV GLNTTRLSAA SGGTLDRSTG    50
VLPTNPEESW QVYSSAQDSE GRCICTVVAP QQTMCSRDAR TKQLRQLLEK 100
VQNMSQSIEV LDRRTQRDLQ YVEKMENQMK GLESKFRQVE ESHKQHLARQ 150
FKAIKAKMDE LRPLIPVLEE YKADAKLVLQ FKEEVQNLTS VLNELQEEIG 200
AYDYDELQSR VSNLEERLRA CMQKLACGKL TGISDPVTVK TSGSRFGSWM 250
TDPLAPEGDN RVWYMDGYHN NRFVREYKSM VDFMNTDNFT SHRLPHPWSG 300
TGQVVYNGSI YFNKFQSHII IRFDLKTETI LKTRSLDYAG YNNMYHYAWG 350
GHSDIDLMVD ENGLWAVYAT NQNAGNIVIS KLDPVSLQIL QTWNTSYPKR 400
SAGEAFIICG TLYVTNGYSG GTKVHYAYQT NASTYEYIDI PFQNKYSHIS 450
MLDYNPKDRA LYAWNNGHQT LYNVTLFHVI RSDEL 485
Length:485
Mass (Da):55,442
Last modified:November 1, 1996 - v1
Checksum:i08D0DA6A40B20F29
GO
Isoform 2 (identifier: Q62609-2) [UniParc]FASTAAdd to Basket

Also known as: BMY

The sequence of this isoform differs from the canonical sequence as follows:
     153-153: A → G
     154-485: Missing.

Show »
Length:153
Mass (Da):17,246
Checksum:iD6C281ADDCFE09E9
GO
Isoform 3 (identifier: Q62609-3) [UniParc]FASTAAdd to Basket

Also known as: AMZ

The sequence of this isoform differs from the canonical sequence as follows:
     1-50: MSVPLLKIGVVLSTMAMITNWMSQTLPSLVGLNTTRLSAASGGTLDRSTG → MQPARKLLSLLVLLVMGTELTQ

Show »
Length:457
Mass (Da):52,718
Checksum:iA6D35E0C6E49497B
GO
Isoform 4 (identifier: Q62609-4) [UniParc]FASTAAdd to Basket

Also known as: AMY

The sequence of this isoform differs from the canonical sequence as follows:
     1-50: MSVPLLKIGVVLSTMAMITNWMSQTLPSLVGLNTTRLSAASGGTLDRSTG → MQPARKLLSLLVLLVMGTELTQ
     153-153: A → G
     154-485: Missing.

Show »
Length:125
Mass (Da):14,522
Checksum:i7C50F3876C31DF78
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 5050MSVPL…DRSTG → MQPARKLLSLLVLLVMGTEL TQ in isoform 3 and isoform 4. VSP_003765Add
BLAST
Alternative sequencei153 – 1531A → G in isoform 2 and isoform 4. VSP_003766
Alternative sequencei154 – 485332Missing in isoform 2 and isoform 4. VSP_003767Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
U03417 mRNA. Translation: AAC04321.1.
U03416 mRNA. Translation: AAC04320.1.
U03415 mRNA. Translation: AAC04319.1.
U03414 mRNA. Translation: AAC04317.1.
PIRiI73636.
I73637.
RefSeqiNP_446025.1. NM_053573.1. [Q62609-1]
XP_006233937.1. XM_006233875.1. [Q62609-3]
XP_006233938.1. XM_006233876.1. [Q62609-2]
XP_006233939.1. XM_006233877.1. [Q62609-4]
UniGeneiRn.11005.

Genome annotation databases

EnsembliENSRNOT00000013443; ENSRNOP00000013443; ENSRNOG00000009862. [Q62609-1]
ENSRNOT00000044951; ENSRNOP00000051216; ENSRNOG00000009862. [Q62609-3]
ENSRNOT00000065953; ENSRNOP00000060981; ENSRNOG00000009862. [Q62609-2]
GeneIDi93667.
KEGGirno:93667.
UCSCiRGD:620320. rat. [Q62609-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
U03417 mRNA. Translation: AAC04321.1 .
U03416 mRNA. Translation: AAC04320.1 .
U03415 mRNA. Translation: AAC04319.1 .
U03414 mRNA. Translation: AAC04317.1 .
PIRi I73636.
I73637.
RefSeqi NP_446025.1. NM_053573.1. [Q62609-1 ]
XP_006233937.1. XM_006233875.1. [Q62609-3 ]
XP_006233938.1. XM_006233876.1. [Q62609-2 ]
XP_006233939.1. XM_006233877.1. [Q62609-4 ]
UniGenei Rn.11005.

3D structure databases

ProteinModelPortali Q62609.
ModBasei Search...
MobiDBi Search...

Proteomic databases

PaxDbi Q62609.
PRIDEi Q62609.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENSRNOT00000013443 ; ENSRNOP00000013443 ; ENSRNOG00000009862 . [Q62609-1 ]
ENSRNOT00000044951 ; ENSRNOP00000051216 ; ENSRNOG00000009862 . [Q62609-3 ]
ENSRNOT00000065953 ; ENSRNOP00000060981 ; ENSRNOG00000009862 . [Q62609-2 ]
GeneIDi 93667.
KEGGi rno:93667.
UCSCi RGD:620320. rat. [Q62609-1 ]

Organism-specific databases

CTDi 10439.
RGDi 620320. Olfm1.

Phylogenomic databases

eggNOGi NOG283888.
GeneTreei ENSGT00750000117256.
HOGENOMi HOG000232069.
HOVERGENi HBG006513.
InParanoidi Q62609.
OMAi QILQTWN.
OrthoDBi EOG75F4CZ.
PhylomeDBi Q62609.
TreeFami TF315964.

Miscellaneous databases

NextBioi 617790.
PROi Q62609.

Gene expression databases

Genevestigatori Q62609.

Family and domain databases

InterProi IPR022082. Noelin-1.
IPR003112. Olfac-like.
IPR011044. Quino_amine_DH_bsu.
[Graphical view ]
Pfami PF12308. Noelin-1. 1 hit.
PF02191. OLF. 1 hit.
[Graphical view ]
SMARTi SM00284. OLF. 1 hit.
[Graphical view ]
SUPFAMi SSF50969. SSF50969. 2 hits.
PROSITEi PS00014. ER_TARGET. 1 hit.
PS51132. OLF. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

  1. "Four structurally distinct neuron-specific olfactomedin-related glycoproteins produced by differential promoter utilization and alternative mRNA splicing from a single gene."
    Danielson P.E., Forss-Petter S., Battenberg E.L.F., Delecea L., Bloom F.E., Sutcliffe J.G.
    J. Neurosci. Res. 38:468-478(1994) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3 AND 4).
    Strain: Sprague-Dawley.
    Tissue: Brain.
  2. "High-resolution proteomics unravel architecture and molecular diversity of native AMPA receptor complexes."
    Schwenk J., Harmel N., Brechet A., Zolles G., Berkefeld H., Muller C.S., Bildl W., Baehrens D., Huber B., Kulik A., Klocker N., Schulte U., Fakler B.
    Neuron 74:621-633(2012) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION IN AMPAR COMPLEX, SUBCELLULAR LOCATION, TISSUE SPECIFICITY.

Entry informationi

Entry nameiNOE1_RAT
AccessioniPrimary (citable) accession number: Q62609
Secondary accession number(s): Q62606, Q62607, Q62608
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 15, 1998
Last sequence update: November 1, 1996
Last modified: May 14, 2014
This is version 112 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi