Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q62609

- NOE1_RAT

UniProt

Q62609 - NOE1_RAT

Protein

Noelin

Gene

Olfm1

Organism
Rattus norvegicus (Rat)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 113 (01 Oct 2014)
      Sequence version 1 (01 Nov 1996)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    May play an important role in regulating the production of neural crest cells by the neural tube.By similarity

    GO - Biological processi

    1. multicellular organismal development Source: UniProtKB-KW
    2. protein oligomerization Source: Ensembl

    Keywords - Molecular functioni

    Developmental protein

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Noelin
    Alternative name(s):
    1B426B
    Neuronal olfactomedin-related ER localized protein
    Olfactomedin-1
    Pancortin
    Gene namesi
    Name:Olfm1
    Synonyms:D2Sut1e, Noe1, Noel, Noel1
    OrganismiRattus norvegicus (Rat)
    Taxonomic identifieri10116 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeRattus
    ProteomesiUP000002494: Chromosome 3

    Organism-specific databases

    RGDi620320. Olfm1.

    Subcellular locationi

    Secreted Curated. Cell junctionsynapse 1 Publication

    GO - Cellular componenti

    1. alpha-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid selective glutamate receptor complex Source: Ensembl
    2. cell junction Source: UniProtKB-KW
    3. extracellular space Source: Ensembl
    4. synapse Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Cell junction, Secreted, Synapse

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Signal peptidei1 – 2424Sequence AnalysisAdd
    BLAST
    Chaini25 – 485461NoelinPRO_0000020076Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Glycosylationi33 – 331N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi103 – 1031N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi187 – 1871N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi227 ↔ 409PROSITE-ProRule annotation
    Glycosylationi288 – 2881N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi307 – 3071N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi394 – 3941N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi431 – 4311N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi473 – 4731N-linked (GlcNAc...)Sequence Analysis

    Post-translational modificationi

    In isoform 3 and isoform 4, the signal peptide is predicted to end in position 17.

    Keywords - PTMi

    Disulfide bond, Glycoprotein

    Proteomic databases

    PaxDbiQ62609.
    PRIDEiQ62609.

    Expressioni

    Tissue specificityi

    Expressed in the brain (at protein level), predominantly in the cortex and hippocampus. In the pituitary only the two A-type and in the adrenal glands only the two B-type forms were detected.1 Publication

    Gene expression databases

    GenevestigatoriQ62609.

    Interactioni

    Subunit structurei

    Peripherally associated with AMPAR complex. AMPAR complex consists of an inner core made of 4 pore-forming GluA/GRIA proteins (GRIA1, GRIA2, GRIA3 and GRIA4) and 4 major auxiliary subunits arranged in a twofold symmetry. One of the two pairs of distinct binding sites is occupied either by CNIH2, CNIH3 or CACNG2, CACNG3. The other harbors CACNG2, CACNG3, CACNG4, CACNG8 or GSG1L. This inner core of AMPAR complex is complemented by outer core constituents binding directly to the GluA/GRIA proteins at sites distinct from the interaction sites of the inner core constituents. Outer core constituents include at least PRRT1, PRRT2, CKAMP44/SHISA9, FRRS1L and NRN1. The proteins of the inner and outer core serve as a platform for other, more peripherally associated AMPAR constituents, including OLFM1. Alone or in combination, these auxiliary subunits control the gating and pharmacology of the AMPAR complex and profoundly impact their biogenesis and protein processing.1 Publication

    Structurei

    3D structure databases

    ProteinModelPortaliQ62609.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini226 – 478253Olfactomedin-likePROSITE-ProRule annotationAdd
    BLAST

    Coiled coil

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Coiled coili87 – 225139Sequence AnalysisAdd
    BLAST

    Sequence similaritiesi

    Contains 1 olfactomedin-like domain.PROSITE-ProRule annotation

    Keywords - Domaini

    Coiled coil, Signal

    Phylogenomic databases

    eggNOGiNOG283888.
    GeneTreeiENSGT00750000117256.
    HOGENOMiHOG000232069.
    HOVERGENiHBG006513.
    InParanoidiQ62609.
    OMAiQILQTWN.
    OrthoDBiEOG75F4CZ.
    PhylomeDBiQ62609.
    TreeFamiTF315964.

    Family and domain databases

    InterProiIPR022082. Noelin-1.
    IPR003112. Olfac-like.
    IPR011044. Quino_amine_DH_bsu.
    [Graphical view]
    PfamiPF12308. Noelin-1. 1 hit.
    PF02191. OLF. 1 hit.
    [Graphical view]
    SMARTiSM00284. OLF. 1 hit.
    [Graphical view]
    SUPFAMiSSF50969. SSF50969. 2 hits.
    PROSITEiPS00014. ER_TARGET. 1 hit.
    PS51132. OLF. 1 hit.
    [Graphical view]

    Sequences (4)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 4 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q62609-1) [UniParc]FASTAAdd to Basket

    Also known as: BMZ

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MSVPLLKIGV VLSTMAMITN WMSQTLPSLV GLNTTRLSAA SGGTLDRSTG    50
    VLPTNPEESW QVYSSAQDSE GRCICTVVAP QQTMCSRDAR TKQLRQLLEK 100
    VQNMSQSIEV LDRRTQRDLQ YVEKMENQMK GLESKFRQVE ESHKQHLARQ 150
    FKAIKAKMDE LRPLIPVLEE YKADAKLVLQ FKEEVQNLTS VLNELQEEIG 200
    AYDYDELQSR VSNLEERLRA CMQKLACGKL TGISDPVTVK TSGSRFGSWM 250
    TDPLAPEGDN RVWYMDGYHN NRFVREYKSM VDFMNTDNFT SHRLPHPWSG 300
    TGQVVYNGSI YFNKFQSHII IRFDLKTETI LKTRSLDYAG YNNMYHYAWG 350
    GHSDIDLMVD ENGLWAVYAT NQNAGNIVIS KLDPVSLQIL QTWNTSYPKR 400
    SAGEAFIICG TLYVTNGYSG GTKVHYAYQT NASTYEYIDI PFQNKYSHIS 450
    MLDYNPKDRA LYAWNNGHQT LYNVTLFHVI RSDEL 485
    Length:485
    Mass (Da):55,442
    Last modified:November 1, 1996 - v1
    Checksum:i08D0DA6A40B20F29
    GO
    Isoform 2 (identifier: Q62609-2) [UniParc]FASTAAdd to Basket

    Also known as: BMY

    The sequence of this isoform differs from the canonical sequence as follows:
         153-153: A → G
         154-485: Missing.

    Show »
    Length:153
    Mass (Da):17,246
    Checksum:iD6C281ADDCFE09E9
    GO
    Isoform 3 (identifier: Q62609-3) [UniParc]FASTAAdd to Basket

    Also known as: AMZ

    The sequence of this isoform differs from the canonical sequence as follows:
         1-50: MSVPLLKIGVVLSTMAMITNWMSQTLPSLVGLNTTRLSAASGGTLDRSTG → MQPARKLLSLLVLLVMGTELTQ

    Show »
    Length:457
    Mass (Da):52,718
    Checksum:iA6D35E0C6E49497B
    GO
    Isoform 4 (identifier: Q62609-4) [UniParc]FASTAAdd to Basket

    Also known as: AMY

    The sequence of this isoform differs from the canonical sequence as follows:
         1-50: MSVPLLKIGVVLSTMAMITNWMSQTLPSLVGLNTTRLSAASGGTLDRSTG → MQPARKLLSLLVLLVMGTELTQ
         153-153: A → G
         154-485: Missing.

    Show »
    Length:125
    Mass (Da):14,522
    Checksum:i7C50F3876C31DF78
    GO

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 5050MSVPL…DRSTG → MQPARKLLSLLVLLVMGTEL TQ in isoform 3 and isoform 4. 1 PublicationVSP_003765Add
    BLAST
    Alternative sequencei153 – 1531A → G in isoform 2 and isoform 4. 1 PublicationVSP_003766
    Alternative sequencei154 – 485332Missing in isoform 2 and isoform 4. 1 PublicationVSP_003767Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    U03417 mRNA. Translation: AAC04321.1.
    U03416 mRNA. Translation: AAC04320.1.
    U03415 mRNA. Translation: AAC04319.1.
    U03414 mRNA. Translation: AAC04317.1.
    PIRiI73636.
    I73637.
    RefSeqiNP_446025.1. NM_053573.1. [Q62609-1]
    XP_006233937.1. XM_006233875.1. [Q62609-3]
    XP_006233938.1. XM_006233876.1. [Q62609-2]
    XP_006233939.1. XM_006233877.1. [Q62609-4]
    UniGeneiRn.11005.

    Genome annotation databases

    EnsembliENSRNOT00000013443; ENSRNOP00000013443; ENSRNOG00000009862. [Q62609-1]
    ENSRNOT00000044951; ENSRNOP00000051216; ENSRNOG00000009862. [Q62609-3]
    ENSRNOT00000065953; ENSRNOP00000060981; ENSRNOG00000009862. [Q62609-2]
    GeneIDi93667.
    KEGGirno:93667.
    UCSCiRGD:620320. rat. [Q62609-1]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    U03417 mRNA. Translation: AAC04321.1 .
    U03416 mRNA. Translation: AAC04320.1 .
    U03415 mRNA. Translation: AAC04319.1 .
    U03414 mRNA. Translation: AAC04317.1 .
    PIRi I73636.
    I73637.
    RefSeqi NP_446025.1. NM_053573.1. [Q62609-1 ]
    XP_006233937.1. XM_006233875.1. [Q62609-3 ]
    XP_006233938.1. XM_006233876.1. [Q62609-2 ]
    XP_006233939.1. XM_006233877.1. [Q62609-4 ]
    UniGenei Rn.11005.

    3D structure databases

    ProteinModelPortali Q62609.
    ModBasei Search...
    MobiDBi Search...

    Proteomic databases

    PaxDbi Q62609.
    PRIDEi Q62609.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENSRNOT00000013443 ; ENSRNOP00000013443 ; ENSRNOG00000009862 . [Q62609-1 ]
    ENSRNOT00000044951 ; ENSRNOP00000051216 ; ENSRNOG00000009862 . [Q62609-3 ]
    ENSRNOT00000065953 ; ENSRNOP00000060981 ; ENSRNOG00000009862 . [Q62609-2 ]
    GeneIDi 93667.
    KEGGi rno:93667.
    UCSCi RGD:620320. rat. [Q62609-1 ]

    Organism-specific databases

    CTDi 10439.
    RGDi 620320. Olfm1.

    Phylogenomic databases

    eggNOGi NOG283888.
    GeneTreei ENSGT00750000117256.
    HOGENOMi HOG000232069.
    HOVERGENi HBG006513.
    InParanoidi Q62609.
    OMAi QILQTWN.
    OrthoDBi EOG75F4CZ.
    PhylomeDBi Q62609.
    TreeFami TF315964.

    Miscellaneous databases

    NextBioi 617790.
    PROi Q62609.

    Gene expression databases

    Genevestigatori Q62609.

    Family and domain databases

    InterProi IPR022082. Noelin-1.
    IPR003112. Olfac-like.
    IPR011044. Quino_amine_DH_bsu.
    [Graphical view ]
    Pfami PF12308. Noelin-1. 1 hit.
    PF02191. OLF. 1 hit.
    [Graphical view ]
    SMARTi SM00284. OLF. 1 hit.
    [Graphical view ]
    SUPFAMi SSF50969. SSF50969. 2 hits.
    PROSITEi PS00014. ER_TARGET. 1 hit.
    PS51132. OLF. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Four structurally distinct neuron-specific olfactomedin-related glycoproteins produced by differential promoter utilization and alternative mRNA splicing from a single gene."
      Danielson P.E., Forss-Petter S., Battenberg E.L.F., Delecea L., Bloom F.E., Sutcliffe J.G.
      J. Neurosci. Res. 38:468-478(1994) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3 AND 4).
      Strain: Sprague-Dawley.
      Tissue: Brain.
    2. "High-resolution proteomics unravel architecture and molecular diversity of native AMPA receptor complexes."
      Schwenk J., Harmel N., Brechet A., Zolles G., Berkefeld H., Muller C.S., Bildl W., Baehrens D., Huber B., Kulik A., Klocker N., Schulte U., Fakler B.
      Neuron 74:621-633(2012) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION IN AMPAR COMPLEX, SUBCELLULAR LOCATION, TISSUE SPECIFICITY.

    Entry informationi

    Entry nameiNOE1_RAT
    AccessioniPrimary (citable) accession number: Q62609
    Secondary accession number(s): Q62606, Q62607, Q62608
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: July 15, 1998
    Last sequence update: November 1, 1996
    Last modified: October 1, 2014
    This is version 113 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3