Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q62470 (ITA3_MOUSE) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 129. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (2) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Integrin alpha-3
Alternative name(s):
CD49 antigen-like family member C
Galactoprotein B3
Short name=GAPB3
VLA-3 subunit alpha
CD_antigen=CD49c
Gene names
Name:Itga3
OrganismMus musculus (Mouse) [Reference proteome]
Taxonomic identifier10090 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus

Protein attributes

Sequence length1053 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is further processed into a mature form.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Integrin alpha-3/beta-1 is a receptor for fibronectin, laminin, collagen, epiligrin, thrombospondin and CSPG4. Alpha-3/beta-1 may mediate with LGALS3 the stimulation by CSPG4 of endothelial cells migration By similarity.

Subunit structure

Heterodimer of an alpha and a beta subunit. The alpha subunit is composed of a heavy and a light chain linked by a disulfide bond. Alpha-3 associates with beta-1. Interacts with HPS5 By similarity. Ref.5

Subcellular location

Membrane; Single-pass type I membrane protein.

Tissue specificity

Isoform 1 and isoform 2 are expressed in heart and brain. Only isoform 1 is detected in lung. Ref.4

Sequence similarities

Belongs to the integrin alpha chain family.

Contains 7 FG-GAP repeats.

Ontologies

Keywords
   Biological processCell adhesion
   Cellular componentMembrane
   Coding sequence diversityAlternative splicing
   DomainRepeat
Signal
Transmembrane
Transmembrane helix
   Molecular functionIntegrin
Receptor
   PTMCleavage on pair of basic residues
Disulfide bond
Glycoprotein
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Biological_processcell adhesion

Inferred from electronic annotation. Source: UniProtKB-KW

heart development

Inferred from electronic annotation. Source: Ensembl

integrin-mediated signaling pathway

Inferred from electronic annotation. Source: UniProtKB-KW

maternal process involved in female pregnancy

Inferred from electronic annotation. Source: Ensembl

memory

Inferred from mutant phenotype PubMed 12904471. Source: MGI

negative regulation of cell projection organization

Inferred from electronic annotation. Source: Ensembl

neuron migration

Inferred from mutant phenotype PubMed 15091337. Source: MGI

positive regulation of cell-substrate adhesion

Inferred from electronic annotation. Source: Ensembl

positive regulation of epithelial cell migration

Inferred from electronic annotation. Source: Ensembl

positive regulation of gene expression

Inferred from electronic annotation. Source: Ensembl

positive regulation of neuron projection development

Inferred from electronic annotation. Source: Ensembl

response to drug

Inferred from electronic annotation. Source: Ensembl

response to gonadotropin

Inferred from electronic annotation. Source: Ensembl

   Cellular_componentalpha3-beta1 integrin complex

Inferred from electronic annotation. Source: Ensembl

basolateral plasma membrane

Inferred from direct assay PubMed 11891657PubMed 7534781. Source: MGI

external side of plasma membrane

Inferred from direct assay PubMed 9553049. Source: MGI

growth cone

Inferred from electronic annotation. Source: Ensembl

perinuclear region of cytoplasm

Inferred from electronic annotation. Source: Ensembl

plasma membrane

Inferred from direct assay PubMed 14566019. Source: MGI

receptor complex

Inferred from sequence orthology PubMed 23382219. Source: MGI

synapse

Inferred from direct assay PubMed 12904471. Source: MGI

Complete GO annotation...

Alternative products

This entry describes 3 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q62470-1)

Also known as: Alpha-3A;

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q62470-2)

Also known as: Alpha-3B;

The sequence of this isoform differs from the canonical sequence as follows:
     1019-1053: GFFKRARTRALYEAKRQKAEMKSQPSETERLTDDY → DFFKPTRYYR...TSWQIRDRYY
Isoform 3 (identifier: Q62470-3)

The sequence of this isoform differs from the canonical sequence as follows:
     1-69: MGPGPCRVPR...RQTERQQRYL → MSYLQTLVWS...RLTHPPSFSS
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Signal peptide1 – 3232 By similarity
Chain33 – 10531021Integrin alpha-3
PRO_0000016241
Chain33 – 874842Integrin alpha-3 heavy chain Potential
PRO_0000016242
Chain878 – 1053176Integrin alpha-3 light chain Potential
PRO_0000016243

Regions

Topological domain33 – 993961Extracellular Potential
Transmembrane994 – 102128Helical; Potential
Topological domain1022 – 105332Cytoplasmic Potential
Repeat38 – 10366FG-GAP 1
Repeat110 – 17162FG-GAP 2
Repeat185 – 23652FG-GAP 3
Repeat237 – 29458FG-GAP 4
Repeat295 – 35561FG-GAP 5
Repeat357 – 41256FG-GAP 6
Repeat416 – 47863FG-GAP 7

Amino acid modifications

Glycosylation861N-linked (GlcNAc...) Ref.6 Ref.7
Glycosylation5011N-linked (GlcNAc...) Potential
Glycosylation5121N-linked (GlcNAc...) Ref.7
Glycosylation5741N-linked (GlcNAc...) Ref.6 Ref.7
Glycosylation5991N-linked (GlcNAc...); atypical Ref.6
Glycosylation6061N-linked (GlcNAc...) Ref.6
Glycosylation6571N-linked (GlcNAc...) Ref.6 Ref.7
Glycosylation6991N-linked (GlcNAc...) Potential
Glycosylation8431N-linked (GlcNAc...) Potential
Glycosylation8591N-linked (GlcNAc...) Potential
Glycosylation9251N-linked (GlcNAc...) Potential
Glycosylation9281N-linked (GlcNAc...) Ref.6
Glycosylation9371N-linked (GlcNAc...) Ref.6 Ref.7
Glycosylation9711N-linked (GlcNAc...) Ref.7
Disulfide bond94 ↔ 103 By similarity
Disulfide bond140 ↔ 162 By similarity
Disulfide bond185 ↔ 197 By similarity
Disulfide bond486 ↔ 491 By similarity
Disulfide bond497 ↔ 551 By similarity
Disulfide bond616 ↔ 622 By similarity
Disulfide bond695 ↔ 704 By similarity
Disulfide bond848 ↔ 906Interchain (between heavy and light chains) By similarity
Disulfide bond913 ↔ 918 By similarity

Natural variations

Alternative sequence1 – 6969MGPGP…QQRYL → MSYLQTLVWSPCSESVDLQA DWREACKARLTHPPSFSS in isoform 3.
VSP_041797
Alternative sequence1019 – 105335GFFKR…LTDDY → DFFKPTRYYRIMPKYHAVRI REEDRYPPPGSTLPTKKHWV TSWQIRDRYY in isoform 2.
VSP_002722

Experimental info

Sequence conflict9751W → C in AAB20356. Ref.4
Sequence conflict9751W → C in AAB20357. Ref.4
Sequence conflict9791D → N in AAB20356. Ref.4
Sequence conflict9791D → N in AAB20357. Ref.4
Sequence conflict10021G → S in AAB20356. Ref.4
Sequence conflict10021G → S in AAB20357. Ref.4

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 (Alpha-3A) [UniParc].

Last modified November 1, 1996. Version 1.
Checksum: 6A5E8FBDBA86D6E5

FASTA1,053116,745
        10         20         30         40         50         60 
MGPGPCRVPR APGWLLRALA LMVAACGRVA FAFNLDTRFL VVKEAVNPGS LFGYSVALHR 

        70         80         90        100        110        120 
QTERQQRYLL LAGAPRDLAV GDDYTNRTGA VYLCPLTAHK DDCERMDISE KSDPDHHIIE 

       130        140        150        160        170        180 
DMWLGVTVAS QGPAGRVLVC AHRYTKVLWS GLEDQRRMVG KCYVRGNDLQ LDPGDDWQTY 

       190        200        210        220        230        240 
HNEMCNSNTD YLQTGMCQLG TSGGFTQNTV YFGAPGAYNW KGNSYMIQRK DWDLSEYSYR 

       250        260        270        280        290        300 
GSEEQGNLYI GYTVQVGNAI LHPTDIITVV TGAPRHQHMG AVFLLKQESG GDLQRKQVLK 

       310        320        330        340        350        360 
GTQVGAYFGS AIALADLNND GWQDLLVGAP YYFERKEEVG GAVYVFMNQA GASFPDQPSL 

       370        380        390        400        410        420 
LLHGPSRSAF GISIASIGDI NQDGFQDIAV GAPFEGLGKV YIYHSSSGGL LRQPQQIIHG 

       430        440        450        460        470        480 
EKLGLPGLAT FGYSLSGKMD VDENLYPDLL VGSLSDHIVL LRARPVINIL HRTLVARPAV 

       490        500        510        520        530        540 
LDPALCTATS CVQVELCFAY NQSAGNPNYR RNITLAYTLE ADRDRRPPRL RFARSQSSVF 

       550        560        570        580        590        600 
HGFFSMPETH CQTLELLLMD NVRDKLRPIV IAMNYSLPLR MPDRLKLGLR SLDAYPVLNQ 

       610        620        630        640        650        660 
AQAMENHTEV HFQKECGPDN KCDSNLQMRA AFLSEQLQPL SRLQYSRDTK KLFLSINVTN 

       670        680        690        700        710        720 
SPSSQRAGED AHEALLTLEV PSALLLSSVR PSGTCQANNE TILCELGNPF KRNQRMELLI 

       730        740        750        760        770        780 
AFEVIGVTLH TRDLPVLLQL STSSHQDNLQ PVLLTLQVDY TLQASLSLMN HRLQSFFGGT 

       790        800        810        820        830        840 
VMGEAAMKTA EDVGSPLKYE FQVSPVGDGL AALGTLVLGL EWPYEVTNGK WLLYPTEITI 

       850        860        870        880        890        900 
HSNGSWPCQP SGNLVNPLNL TLSDPGVTPL SPQRRRRQLD PGGDQSSPPV TLAAAKKAKS 

       910        920        930        940        950        960 
ETVLTCSNGR ARCVWLECPL PDTSNITNVT VKARVWNSTF IEDYKDFDRV RVDGWATLFL 

       970        980        990       1000       1010       1020 
RTSIPTINME NKTTWFSVDI DSELVEELPA EIELWLVLVA VGAGLLLLGL IILLLWKCGF 

      1030       1040       1050 
FKRARTRALY EAKRQKAEMK SQPSETERLT DDY 

« Hide

Isoform 2 (Alpha-3B) [UniParc].

Checksum: 59B6FC2CE79A454E
Show »

FASTA1,068118,884
Isoform 3 [UniParc].

Checksum: 75C3A44264E59A6D
Show »

FASTA1,022113,428

References

« Hide 'large scale' references
[1]"cDNA cloning of mouse VLA-3 alpha subunit."
Takeuchi K., Hirano K., Tuji T., Osawa T., Irimura T.
J. Cell. Biochem. 57:371-377(1995) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
Strain: BALB/c.
[2]"Lineage-specific biology revealed by a finished genome assembly of the mouse."
Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S., She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W., Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T., Zhou S. expand/collapse author list , Teague B., Potamousis K., Churas C., Place M., Herschleb J., Runnheim R., Forrest D., Amos-Landgraf J., Schwartz D.C., Cheng Z., Lindblad-Toh K., Eichler E.E., Ponting C.P.
PLoS Biol. 7:E1000112-E1000112(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
Strain: C57BL/6J.
[3]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Strain: C57BL/6 and FVB/N.
Tissue: Embryonic brain and Mammary tumor.
[4]"Cell type-specific integrin variants with alternative alpha chain cytoplasmic domains."
Tamura R.N., Cooper H.M., Collo G., Quaranta V.
Proc. Natl. Acad. Sci. U.S.A. 88:10183-10187(1991) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 913-1053 (ISOFORM 1), PARTIAL NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), TISSUE SPECIFICITY.
[5]"NG2 proteoglycan promotes endothelial cell motility and angiogenesis via engagement of galectin-3 and alpha3beta1 integrin."
Fukushi J., Makagiansar I.T., Stallcup W.B.
Mol. Biol. Cell 15:3580-3590(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: INTERACTION WITH ITGB1; LGALS3 AND CSPG4.
[6]"The mouse C2C12 myoblast cell surface N-linked glycoproteome: identification, glycosite occupancy, and membrane orientation."
Gundry R.L., Raginski K., Tarasova Y., Tchernyshyov I., Bausch-Fluck D., Elliott S.T., Boheler K.R., Van Eyk J.E., Wollscheid B.
Mol. Cell. Proteomics 8:2555-2569(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-86; ASN-574; ASN-599; ASN-606; ASN-657; ASN-928 AND ASN-937.
Tissue: Myoblast.
[7]"Mass-spectrometric identification and relative quantification of N-linked cell surface glycoproteins."
Wollscheid B., Bausch-Fluck D., Henderson C., O'Brien R., Bibel M., Schiess R., Aebersold R., Watts J.D.
Nat. Biotechnol. 27:378-386(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-86; ASN-512; ASN-574; ASN-657; ASN-937 AND ASN-971.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
D13867 mRNA. Translation: BAA02980.1.
AL606480 Genomic DNA. Translation: CAI23969.2.
AL606480 Genomic DNA. Translation: CAI23971.1.
AL606480 Genomic DNA. Translation: CAI23972.1.
BC053031 mRNA. Translation: AAH53031.1.
BC062205 mRNA. Translation: AAH62205.1.
S66292 mRNA. Translation: AAB20356.2.
S66294 mRNA. Translation: AAB20357.2.
PIRB41543.
I55534.
RefSeqNP_038593.1. NM_013565.2.
XP_006532373.1. XM_006532310.1.
XP_006532374.1. XM_006532311.1.
UniGeneMm.57035.

3D structure databases

ProteinModelPortalQ62470.
SMRQ62470. Positions 33-1026.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

IntActQ62470. 1 interaction.
MINTMINT-4098816.

PTM databases

PhosphoSiteQ62470.

Proteomic databases

PaxDbQ62470.
PRIDEQ62470.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENSMUST00000001548; ENSMUSP00000001548; ENSMUSG00000001507. [Q62470-1]
ENSMUST00000107739; ENSMUSP00000103368; ENSMUSG00000001507. [Q62470-3]
ENSMUST00000120375; ENSMUSP00000113556; ENSMUSG00000001507. [Q62470-2]
GeneID16400.
KEGGmmu:16400.
UCSCuc007kzv.1. mouse. [Q62470-3]
uc007kzw.1. mouse. [Q62470-1]
uc007kzx.1. mouse. [Q62470-2]

Organism-specific databases

CTD3675.
MGIMGI:96602. Itga3.

Phylogenomic databases

eggNOGNOG26407.
GeneTreeENSGT00730000110529.
HOGENOMHOG000015786.
HOVERGENHBG108011.
InParanoidQ5SWA8.
KOK06482.
OMAYNQSAGN.
OrthoDBEOG7K3TK7.
TreeFamTF105391.

Gene expression databases

ArrayExpressQ62470.
BgeeQ62470.
CleanExMM_ITGA3.
GenevestigatorQ62470.

Family and domain databases

InterProIPR013517. FG-GAP.
IPR013519. Int_alpha_beta-p.
IPR000413. Integrin_alpha.
IPR013649. Integrin_alpha-2.
IPR018184. Integrin_alpha_C_CS.
[Graphical view]
PfamPF01839. FG-GAP. 2 hits.
PF08441. Integrin_alpha2. 1 hit.
[Graphical view]
PRINTSPR01185. INTEGRINA.
SMARTSM00191. Int_alpha. 5 hits.
[Graphical view]
PROSITEPS51470. FG_GAP. 7 hits.
PS00242. INTEGRIN_ALPHA. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

NextBio289553.
PMAP-CutDBQ62470.
PROQ62470.
SOURCESearch...

Entry information

Entry nameITA3_MOUSE
AccessionPrimary (citable) accession number: Q62470
Secondary accession number(s): Q08441 expand/collapse secondary AC list , Q08442, Q5SWA8, Q5SWB9, Q6P6I1
Entry history
Integrated into UniProtKB/Swiss-Prot: July 15, 1998
Last sequence update: November 1, 1996
Last modified: April 16, 2014
This is version 129 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Relevant documents

SIMILARITY comments

Index of protein domains and families

MGD cross-references

Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot