Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q62470

- ITA3_MOUSE

UniProt

Q62470 - ITA3_MOUSE

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Integrin alpha-3

Gene

Itga3

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Integrin alpha-3/beta-1 is a receptor for fibronectin, laminin, collagen, epiligrin, thrombospondin and CSPG4. Integrin alpha-3/beta-1 provides a docking site for FAP (seprase) at invadopodia plasma membranes in a collagen-dependent manner and hence may participate in the adhesion, formation of invadopodia and matrix degradation processes, promoting cell invasion. Alpha-3/beta-1 may mediate with LGALS3 the stimulation by CSPG4 of endothelial cells migration.By similarity

GO - Molecular functioni

  1. protein heterodimerization activity Source: UniProtKB

GO - Biological processi

  1. cell adhesion Source: UniProtKB-KW
  2. dendritic spine maintenance Source: MGI
  3. exploration behavior Source: MGI
  4. heart development Source: Ensembl
  5. integrin-mediated signaling pathway Source: UniProtKB-KW
  6. maternal process involved in female pregnancy Source: Ensembl
  7. memory Source: MGI
  8. negative regulation of cell projection organization Source: Ensembl
  9. negative regulation of Rho protein signal transduction Source: MGI
  10. neuron migration Source: MGI
  11. positive regulation of cell-substrate adhesion Source: Ensembl
  12. positive regulation of epithelial cell migration Source: Ensembl
  13. positive regulation of establishment of protein localization to plasma membrane Source: UniProtKB
  14. positive regulation of gene expression Source: Ensembl
  15. positive regulation of neuron projection development Source: Ensembl
  16. response to drug Source: Ensembl
  17. response to gonadotropin Source: Ensembl
  18. single-organism behavior Source: MGI
Complete GO annotation...

Keywords - Molecular functioni

Integrin, Receptor

Keywords - Biological processi

Cell adhesion

Enzyme and pathway databases

ReactomeiREACT_202342. Laminin interactions.
REACT_211508. Basigin interactions.
REACT_216309. Integrin cell surface interactions.

Names & Taxonomyi

Protein namesi
Recommended name:
Integrin alpha-3
Alternative name(s):
CD49 antigen-like family member C
Galactoprotein B3
Short name:
GAPB3
VLA-3 subunit alpha
CD_antigen: CD49c
Cleaved into the following 2 chains:
Gene namesi
Name:Itga3
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589: Chromosome 11

Organism-specific databases

MGIiMGI:96602. Itga3.

Subcellular locationi

Cell membrane; Single-pass type I membrane protein. Cell membrane By similarity; Lipid-anchor By similarity. Cell projectioninvadopodium membrane By similarity; Single-pass type I membrane protein Sequence Analysis. Cell projectionfilopodium membrane By similarity; Single-pass type I membrane protein Sequence Analysis
Note: Enriched preferentially at invadopodia, cell membrane protrusions that correspond to sites of cell invasion, in a collagen-dependent manner.By similarity

GO - Cellular componenti

  1. basolateral plasma membrane Source: MGI
  2. excitatory synapse Source: MGI
  3. external side of plasma membrane Source: MGI
  4. extracellular vesicular exosome Source: Ensembl
  5. filopodium membrane Source: UniProtKB
  6. growth cone Source: Ensembl
  7. integrin alpha3-beta1 complex Source: Ensembl
  8. invadopodium membrane Source: UniProtKB
  9. perinuclear region of cytoplasm Source: Ensembl
  10. plasma membrane Source: MGI
  11. receptor complex Source: MGI
  12. synapse Source: MGI
  13. synaptic membrane Source: MGI
Complete GO annotation...

Keywords - Cellular componenti

Cell junction, Cell membrane, Cell projection, Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 3232By similarityAdd
BLAST
Chaini33 – 10531021Integrin alpha-3PRO_0000016241Add
BLAST
Chaini33 – 874842Integrin alpha-3 heavy chainSequence AnalysisPRO_0000016242Add
BLAST
Chaini878 – 1053176Integrin alpha-3 light chainSequence AnalysisPRO_0000016243Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi86 – 861N-linked (GlcNAc...)2 Publications
Disulfide bondi94 ↔ 103By similarity
Disulfide bondi140 ↔ 162By similarity
Disulfide bondi185 ↔ 197By similarity
Disulfide bondi486 ↔ 491By similarity
Disulfide bondi497 ↔ 551By similarity
Glycosylationi501 – 5011N-linked (GlcNAc...)Sequence Analysis
Glycosylationi512 – 5121N-linked (GlcNAc...)1 Publication
Glycosylationi574 – 5741N-linked (GlcNAc...)2 Publications
Glycosylationi599 – 5991N-linked (GlcNAc...); atypical1 Publication
Glycosylationi606 – 6061N-linked (GlcNAc...)1 Publication
Disulfide bondi616 ↔ 622By similarity
Glycosylationi657 – 6571N-linked (GlcNAc...)2 Publications
Disulfide bondi695 ↔ 704By similarity
Glycosylationi699 – 6991N-linked (GlcNAc...)Sequence Analysis
Glycosylationi843 – 8431N-linked (GlcNAc...)Sequence Analysis
Disulfide bondi848 ↔ 906Interchain (between heavy and light chains)By similarity
Glycosylationi859 – 8591N-linked (GlcNAc...)Sequence Analysis
Disulfide bondi913 ↔ 918By similarity
Glycosylationi925 – 9251N-linked (GlcNAc...)Sequence Analysis
Glycosylationi928 – 9281N-linked (GlcNAc...)1 Publication
Glycosylationi937 – 9371N-linked (GlcNAc...)2 Publications
Glycosylationi971 – 9711N-linked (GlcNAc...)1 Publication
Lipidationi1018 – 10181S-palmitoyl cysteineBy similarity

Keywords - PTMi

Cleavage on pair of basic residues, Disulfide bond, Glycoprotein, Lipoprotein, Palmitate

Proteomic databases

MaxQBiQ62470.
PaxDbiQ62470.
PRIDEiQ62470.

PTM databases

PhosphoSiteiQ62470.

Miscellaneous databases

PMAP-CutDBQ62470.

Expressioni

Tissue specificityi

Isoform 1 and isoform 2 are expressed in heart and brain. Only isoform 1 is detected in lung.1 Publication

Gene expression databases

BgeeiQ62470.
CleanExiMM_ITGA3.
ExpressionAtlasiQ62470. baseline and differential.
GenevestigatoriQ62470.

Interactioni

Subunit structurei

Heterodimer of an alpha and a beta subunit. The alpha subunit is composed of a heavy and a light chain linked by a disulfide bond. Alpha-3 associates with beta-1. Interacts with HPS5. Interacts with FAP (seprase); the interaction occurs at the cell surface of invadopodia membrane in a collagen-dependent manner.By similarity

Protein-protein interaction databases

IntActiQ62470. 1 interaction.
MINTiMINT-4098816.

Structurei

3D structure databases

ProteinModelPortaliQ62470.
SMRiQ62470. Positions 33-1026.
ModBaseiSearch...
MobiDBiSearch...

Topological domain

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini33 – 993961ExtracellularSequence AnalysisAdd
BLAST
Topological domaini1022 – 105332CytoplasmicSequence AnalysisAdd
BLAST

Transmembrane

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transmembranei994 – 102128HelicalSequence AnalysisAdd
BLAST

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Repeati38 – 10366FG-GAP 1Add
BLAST
Repeati110 – 17162FG-GAP 2Add
BLAST
Repeati185 – 23652FG-GAP 3Add
BLAST
Repeati237 – 29458FG-GAP 4Add
BLAST
Repeati295 – 35561FG-GAP 5Add
BLAST
Repeati357 – 41256FG-GAP 6Add
BLAST
Repeati416 – 47863FG-GAP 7Add
BLAST

Sequence similaritiesi

Belongs to the integrin alpha chain family.Curated
Contains 7 FG-GAP repeats.Curated

Keywords - Domaini

Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG26407.
GeneTreeiENSGT00760000118782.
HOGENOMiHOG000015786.
HOVERGENiHBG108011.
InParanoidiQ62470.
KOiK06482.
OMAiYNQSAGN.
OrthoDBiEOG7K3TK7.
TreeFamiTF105391.

Family and domain databases

InterProiIPR013517. FG-GAP.
IPR013519. Int_alpha_beta-p.
IPR000413. Integrin_alpha.
IPR013649. Integrin_alpha-2.
IPR018184. Integrin_alpha_C_CS.
[Graphical view]
PfamiPF01839. FG-GAP. 2 hits.
PF08441. Integrin_alpha2. 1 hit.
[Graphical view]
PRINTSiPR01185. INTEGRINA.
SMARTiSM00191. Int_alpha. 5 hits.
[Graphical view]
PROSITEiPS51470. FG_GAP. 7 hits.
PS00242. INTEGRIN_ALPHA. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q62470-1) [UniParc]FASTAAdd to Basket

Also known as: Alpha-3A

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGPGPCRVPR APGWLLRALA LMVAACGRVA FAFNLDTRFL VVKEAVNPGS
60 70 80 90 100
LFGYSVALHR QTERQQRYLL LAGAPRDLAV GDDYTNRTGA VYLCPLTAHK
110 120 130 140 150
DDCERMDISE KSDPDHHIIE DMWLGVTVAS QGPAGRVLVC AHRYTKVLWS
160 170 180 190 200
GLEDQRRMVG KCYVRGNDLQ LDPGDDWQTY HNEMCNSNTD YLQTGMCQLG
210 220 230 240 250
TSGGFTQNTV YFGAPGAYNW KGNSYMIQRK DWDLSEYSYR GSEEQGNLYI
260 270 280 290 300
GYTVQVGNAI LHPTDIITVV TGAPRHQHMG AVFLLKQESG GDLQRKQVLK
310 320 330 340 350
GTQVGAYFGS AIALADLNND GWQDLLVGAP YYFERKEEVG GAVYVFMNQA
360 370 380 390 400
GASFPDQPSL LLHGPSRSAF GISIASIGDI NQDGFQDIAV GAPFEGLGKV
410 420 430 440 450
YIYHSSSGGL LRQPQQIIHG EKLGLPGLAT FGYSLSGKMD VDENLYPDLL
460 470 480 490 500
VGSLSDHIVL LRARPVINIL HRTLVARPAV LDPALCTATS CVQVELCFAY
510 520 530 540 550
NQSAGNPNYR RNITLAYTLE ADRDRRPPRL RFARSQSSVF HGFFSMPETH
560 570 580 590 600
CQTLELLLMD NVRDKLRPIV IAMNYSLPLR MPDRLKLGLR SLDAYPVLNQ
610 620 630 640 650
AQAMENHTEV HFQKECGPDN KCDSNLQMRA AFLSEQLQPL SRLQYSRDTK
660 670 680 690 700
KLFLSINVTN SPSSQRAGED AHEALLTLEV PSALLLSSVR PSGTCQANNE
710 720 730 740 750
TILCELGNPF KRNQRMELLI AFEVIGVTLH TRDLPVLLQL STSSHQDNLQ
760 770 780 790 800
PVLLTLQVDY TLQASLSLMN HRLQSFFGGT VMGEAAMKTA EDVGSPLKYE
810 820 830 840 850
FQVSPVGDGL AALGTLVLGL EWPYEVTNGK WLLYPTEITI HSNGSWPCQP
860 870 880 890 900
SGNLVNPLNL TLSDPGVTPL SPQRRRRQLD PGGDQSSPPV TLAAAKKAKS
910 920 930 940 950
ETVLTCSNGR ARCVWLECPL PDTSNITNVT VKARVWNSTF IEDYKDFDRV
960 970 980 990 1000
RVDGWATLFL RTSIPTINME NKTTWFSVDI DSELVEELPA EIELWLVLVA
1010 1020 1030 1040 1050
VGAGLLLLGL IILLLWKCGF FKRARTRALY EAKRQKAEMK SQPSETERLT

DDY
Length:1,053
Mass (Da):116,745
Last modified:November 1, 1996 - v1
Checksum:i6A5E8FBDBA86D6E5
GO
Isoform 2 (identifier: Q62470-2) [UniParc]FASTAAdd to Basket

Also known as: Alpha-3B

The sequence of this isoform differs from the canonical sequence as follows:
     1019-1053: GFFKRARTRALYEAKRQKAEMKSQPSETERLTDDY → DFFKPTRYYR...TSWQIRDRYY

Show »
Length:1,068
Mass (Da):118,884
Checksum:i59B6FC2CE79A454E
GO
Isoform 3 (identifier: Q62470-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-69: MGPGPCRVPR...RQTERQQRYL → MSYLQTLVWS...RLTHPPSFSS

Note: No experimental confirmation available.

Show »
Length:1,022
Mass (Da):113,428
Checksum:i75C3A44264E59A6D
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti975 – 9751W → C in AAB20356. (PubMed:1946438)Curated
Sequence conflicti975 – 9751W → C in AAB20357. (PubMed:1946438)Curated
Sequence conflicti979 – 9791D → N in AAB20356. (PubMed:1946438)Curated
Sequence conflicti979 – 9791D → N in AAB20357. (PubMed:1946438)Curated
Sequence conflicti1002 – 10021G → S in AAB20356. (PubMed:1946438)Curated
Sequence conflicti1002 – 10021G → S in AAB20357. (PubMed:1946438)Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 6969MGPGP…QQRYL → MSYLQTLVWSPCSESVDLQA DWREACKARLTHPPSFSS in isoform 3. CuratedVSP_041797Add
BLAST
Alternative sequencei1019 – 105335GFFKR…LTDDY → DFFKPTRYYRIMPKYHAVRI REEDRYPPPGSTLPTKKHWV TSWQIRDRYY in isoform 2. CuratedVSP_002722Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
D13867 mRNA. Translation: BAA02980.1.
AL606480 Genomic DNA. Translation: CAI23969.2.
AL606480 Genomic DNA. Translation: CAI23971.1.
AL606480 Genomic DNA. Translation: CAI23972.1.
BC053031 mRNA. Translation: AAH53031.1.
BC062205 mRNA. Translation: AAH62205.1.
S66292 mRNA. Translation: AAB20356.2.
S66294 mRNA. Translation: AAB20357.2.
CCDSiCCDS25271.1. [Q62470-1]
PIRiB41543.
I55534.
RefSeqiNP_038593.1. NM_013565.2. [Q62470-1]
XP_006532373.1. XM_006532310.1. [Q62470-2]
XP_006532374.1. XM_006532311.1. [Q62470-1]
UniGeneiMm.57035.

Genome annotation databases

EnsembliENSMUST00000001548; ENSMUSP00000001548; ENSMUSG00000001507. [Q62470-1]
ENSMUST00000107739; ENSMUSP00000103368; ENSMUSG00000001507. [Q62470-3]
ENSMUST00000120375; ENSMUSP00000113556; ENSMUSG00000001507. [Q62470-2]
GeneIDi16400.
KEGGimmu:16400.
UCSCiuc007kzv.1. mouse. [Q62470-3]
uc007kzw.1. mouse. [Q62470-1]
uc007kzx.1. mouse. [Q62470-2]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
D13867 mRNA. Translation: BAA02980.1 .
AL606480 Genomic DNA. Translation: CAI23969.2 .
AL606480 Genomic DNA. Translation: CAI23971.1 .
AL606480 Genomic DNA. Translation: CAI23972.1 .
BC053031 mRNA. Translation: AAH53031.1 .
BC062205 mRNA. Translation: AAH62205.1 .
S66292 mRNA. Translation: AAB20356.2 .
S66294 mRNA. Translation: AAB20357.2 .
CCDSi CCDS25271.1. [Q62470-1 ]
PIRi B41543.
I55534.
RefSeqi NP_038593.1. NM_013565.2. [Q62470-1 ]
XP_006532373.1. XM_006532310.1. [Q62470-2 ]
XP_006532374.1. XM_006532311.1. [Q62470-1 ]
UniGenei Mm.57035.

3D structure databases

ProteinModelPortali Q62470.
SMRi Q62470. Positions 33-1026.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

IntActi Q62470. 1 interaction.
MINTi MINT-4098816.

PTM databases

PhosphoSitei Q62470.

Proteomic databases

MaxQBi Q62470.
PaxDbi Q62470.
PRIDEi Q62470.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENSMUST00000001548 ; ENSMUSP00000001548 ; ENSMUSG00000001507 . [Q62470-1 ]
ENSMUST00000107739 ; ENSMUSP00000103368 ; ENSMUSG00000001507 . [Q62470-3 ]
ENSMUST00000120375 ; ENSMUSP00000113556 ; ENSMUSG00000001507 . [Q62470-2 ]
GeneIDi 16400.
KEGGi mmu:16400.
UCSCi uc007kzv.1. mouse. [Q62470-3 ]
uc007kzw.1. mouse. [Q62470-1 ]
uc007kzx.1. mouse. [Q62470-2 ]

Organism-specific databases

CTDi 3675.
MGIi MGI:96602. Itga3.

Phylogenomic databases

eggNOGi NOG26407.
GeneTreei ENSGT00760000118782.
HOGENOMi HOG000015786.
HOVERGENi HBG108011.
InParanoidi Q62470.
KOi K06482.
OMAi YNQSAGN.
OrthoDBi EOG7K3TK7.
TreeFami TF105391.

Enzyme and pathway databases

Reactomei REACT_202342. Laminin interactions.
REACT_211508. Basigin interactions.
REACT_216309. Integrin cell surface interactions.

Miscellaneous databases

NextBioi 289553.
PMAP-CutDB Q62470.
PROi Q62470.
SOURCEi Search...

Gene expression databases

Bgeei Q62470.
CleanExi MM_ITGA3.
ExpressionAtlasi Q62470. baseline and differential.
Genevestigatori Q62470.

Family and domain databases

InterProi IPR013517. FG-GAP.
IPR013519. Int_alpha_beta-p.
IPR000413. Integrin_alpha.
IPR013649. Integrin_alpha-2.
IPR018184. Integrin_alpha_C_CS.
[Graphical view ]
Pfami PF01839. FG-GAP. 2 hits.
PF08441. Integrin_alpha2. 1 hit.
[Graphical view ]
PRINTSi PR01185. INTEGRINA.
SMARTi SM00191. Int_alpha. 5 hits.
[Graphical view ]
PROSITEi PS51470. FG_GAP. 7 hits.
PS00242. INTEGRIN_ALPHA. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Strain: BALB/c.
  2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    Strain: C57BL/6J.
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Strain: C57BL/6 and FVB/N.
    Tissue: Embryonic brain and Mammary tumor.
  4. "Cell type-specific integrin variants with alternative alpha chain cytoplasmic domains."
    Tamura R.N., Cooper H.M., Collo G., Quaranta V.
    Proc. Natl. Acad. Sci. U.S.A. 88:10183-10187(1991) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 913-1053 (ISOFORM 1), PARTIAL NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), TISSUE SPECIFICITY.
  5. "NG2 proteoglycan promotes endothelial cell motility and angiogenesis via engagement of galectin-3 and alpha3beta1 integrin."
    Fukushi J., Makagiansar I.T., Stallcup W.B.
    Mol. Biol. Cell 15:3580-3590(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH ITGB1; LGALS3 AND CSPG4.
  6. "The mouse C2C12 myoblast cell surface N-linked glycoproteome: identification, glycosite occupancy, and membrane orientation."
    Gundry R.L., Raginski K., Tarasova Y., Tchernyshyov I., Bausch-Fluck D., Elliott S.T., Boheler K.R., Van Eyk J.E., Wollscheid B.
    Mol. Cell. Proteomics 8:2555-2569(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-86; ASN-574; ASN-599; ASN-606; ASN-657; ASN-928 AND ASN-937.
    Tissue: Myoblast.
  7. "Mass-spectrometric identification and relative quantification of N-linked cell surface glycoproteins."
    Wollscheid B., Bausch-Fluck D., Henderson C., O'Brien R., Bibel M., Schiess R., Aebersold R., Watts J.D.
    Nat. Biotechnol. 27:378-386(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-86; ASN-512; ASN-574; ASN-657; ASN-937 AND ASN-971.

Entry informationi

Entry nameiITA3_MOUSE
AccessioniPrimary (citable) accession number: Q62470
Secondary accession number(s): Q08441
, Q08442, Q5SWA8, Q5SWB9, Q6P6I1
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 15, 1998
Last sequence update: November 1, 1996
Last modified: October 29, 2014
This is version 135 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3