Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Integrin alpha-3

Gene

Itga3

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Integrin alpha-3/beta-1 is a receptor for fibronectin, laminin, collagen, epiligrin, thrombospondin and CSPG4. Integrin alpha-3/beta-1 provides a docking site for FAP (seprase) at invadopodia plasma membranes in a collagen-dependent manner and hence may participate in the adhesion, formation of invadopodia and matrix degradation processes, promoting cell invasion. Alpha-3/beta-1 may mediate with LGALS3 the stimulation by CSPG4 of endothelial cells migration.By similarity

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Integrin, Receptor

Keywords - Biological processi

Cell adhesion

Enzyme and pathway databases

ReactomeiR-MMU-210991. Basigin interactions.
R-MMU-216083. Integrin cell surface interactions.
R-MMU-3000157. Laminin interactions.
R-MMU-8874081. MET activates PTK2 signaling.

Names & Taxonomyi

Protein namesi
Recommended name:
Integrin alpha-3
Alternative name(s):
CD49 antigen-like family member C
Galactoprotein B3
Short name:
GAPB3
VLA-3 subunit alpha
CD_antigen: CD49c
Cleaved into the following 2 chains:
Gene namesi
Name:Itga3
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 11

Organism-specific databases

MGIiMGI:96602. Itga3.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini33 – 993ExtracellularSequence analysisAdd BLAST961
Transmembranei994 – 1021HelicalSequence analysisAdd BLAST28
Topological domaini1022 – 1053CytoplasmicSequence analysisAdd BLAST32

GO - Cellular componenti

  • basolateral plasma membrane Source: MGI
  • cell periphery Source: MGI
  • cell surface Source: MGI
  • excitatory synapse Source: MGI
  • external side of plasma membrane Source: MGI
  • extracellular exosome Source: MGI
  • filopodium membrane Source: UniProtKB
  • focal adhesion Source: MGI
  • growth cone Source: Ensembl
  • integrin alpha3-beta1 complex Source: MGI
  • invadopodium membrane Source: UniProtKB
  • perinuclear region of cytoplasm Source: Ensembl
  • plasma membrane Source: MGI
  • receptor complex Source: MGI
  • synapse Source: MGI
  • synaptic membrane Source: MGI
Complete GO annotation...

Keywords - Cellular componenti

Cell junction, Cell membrane, Cell projection, Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 32By similarityAdd BLAST32
ChainiPRO_000001624133 – 1053Integrin alpha-3Add BLAST1021
ChainiPRO_000001624233 – 874Integrin alpha-3 heavy chainSequence analysisAdd BLAST842
ChainiPRO_0000016243878 – 1053Integrin alpha-3 light chainSequence analysisAdd BLAST176

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi86N-linked (GlcNAc...)2 Publications1
Disulfide bondi94 ↔ 103By similarity
Disulfide bondi140 ↔ 162By similarity
Disulfide bondi185 ↔ 197By similarity
Disulfide bondi486 ↔ 491By similarity
Disulfide bondi497 ↔ 551By similarity
Glycosylationi501N-linked (GlcNAc...)Sequence analysis1
Glycosylationi512N-linked (GlcNAc...)1 Publication1
Glycosylationi574N-linked (GlcNAc...)2 Publications1
Glycosylationi599N-linked (GlcNAc...); atypical1 Publication1
Glycosylationi606N-linked (GlcNAc...)1 Publication1
Disulfide bondi616 ↔ 622By similarity
Glycosylationi657N-linked (GlcNAc...)2 Publications1
Disulfide bondi695 ↔ 704By similarity
Glycosylationi699N-linked (GlcNAc...)Sequence analysis1
Glycosylationi843N-linked (GlcNAc...)Sequence analysis1
Disulfide bondi848 ↔ 906Interchain (between heavy and light chains)By similarity
Glycosylationi859N-linked (GlcNAc...)Sequence analysis1
Disulfide bondi913 ↔ 918By similarity
Glycosylationi925N-linked (GlcNAc...)Sequence analysis1
Glycosylationi928N-linked (GlcNAc...)1 Publication1
Glycosylationi937N-linked (GlcNAc...)2 Publications1
Glycosylationi971N-linked (GlcNAc...)1 Publication1
Lipidationi1018S-palmitoyl cysteineBy similarity1

Keywords - PTMi

Cleavage on pair of basic residues, Disulfide bond, Glycoprotein, Lipoprotein, Palmitate

Proteomic databases

PaxDbiQ62470.
PeptideAtlasiQ62470.
PRIDEiQ62470.

PTM databases

iPTMnetiQ62470.
PhosphoSitePlusiQ62470.
SwissPalmiQ62470.

Miscellaneous databases

PMAP-CutDBQ62470.

Expressioni

Tissue specificityi

Isoform 1 and isoform 2 are expressed in heart and brain. Only isoform 1 is detected in lung.1 Publication

Gene expression databases

BgeeiENSMUSG00000001507.
CleanExiMM_ITGA3.
ExpressionAtlasiQ62470. baseline and differential.
GenevisibleiQ62470. MM.

Interactioni

Subunit structurei

Heterodimer of an alpha and a beta subunit. The alpha subunit is composed of a heavy and a light chain linked by a disulfide bond. Alpha-3 associates with beta-1. Interacts with HPS5. Interacts with FAP (seprase); the interaction occurs at the cell surface of invadopodia membrane in a collagen-dependent manner.By similarity

GO - Molecular functioni

Protein-protein interaction databases

BioGridi200816. 2 interactors.
IntActiQ62470. 1 interactor.
MINTiMINT-4098816.
STRINGi10090.ENSMUSP00000001548.

Structurei

3D structure databases

ProteinModelPortaliQ62470.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Repeati38 – 103FG-GAP 1PROSITE-ProRule annotationAdd BLAST66
Repeati110 – 171FG-GAP 2PROSITE-ProRule annotationAdd BLAST62
Repeati185 – 235FG-GAP 3PROSITE-ProRule annotationAdd BLAST51
Repeati236 – 293FG-GAP 4PROSITE-ProRule annotationAdd BLAST58
Repeati294 – 355FG-GAP 5PROSITE-ProRule annotationAdd BLAST62
Repeati357 – 412FG-GAP 6PROSITE-ProRule annotationAdd BLAST56
Repeati416 – 478FG-GAP 7PROSITE-ProRule annotationAdd BLAST63

Sequence similaritiesi

Belongs to the integrin alpha chain family.Curated
Contains 7 FG-GAP repeats.PROSITE-ProRule annotation

Keywords - Domaini

Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410IPB6. Eukaryota.
ENOG410ZZD8. LUCA.
GeneTreeiENSGT00760000118782.
HOGENOMiHOG000015786.
HOVERGENiHBG108011.
InParanoidiQ62470.
KOiK06482.
OMAiYIGYTMQ.
OrthoDBiEOG091G012D.
TreeFamiTF105391.

Family and domain databases

InterProiIPR013517. FG-GAP.
IPR013519. Int_alpha_beta-p.
IPR000413. Integrin_alpha.
IPR013649. Integrin_alpha-2.
IPR018184. Integrin_alpha_C_CS.
IPR032695. Integrin_dom.
[Graphical view]
PfamiPF01839. FG-GAP. 2 hits.
PF08441. Integrin_alpha2. 1 hit.
[Graphical view]
PRINTSiPR01185. INTEGRINA.
SMARTiSM00191. Int_alpha. 5 hits.
[Graphical view]
SUPFAMiSSF69179. SSF69179. 3 hits.
PROSITEiPS51470. FG_GAP. 7 hits.
PS00242. INTEGRIN_ALPHA. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q62470-1) [UniParc]FASTAAdd to basket
Also known as: Alpha-3A

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGPGPCRVPR APGWLLRALA LMVAACGRVA FAFNLDTRFL VVKEAVNPGS
60 70 80 90 100
LFGYSVALHR QTERQQRYLL LAGAPRDLAV GDDYTNRTGA VYLCPLTAHK
110 120 130 140 150
DDCERMDISE KSDPDHHIIE DMWLGVTVAS QGPAGRVLVC AHRYTKVLWS
160 170 180 190 200
GLEDQRRMVG KCYVRGNDLQ LDPGDDWQTY HNEMCNSNTD YLQTGMCQLG
210 220 230 240 250
TSGGFTQNTV YFGAPGAYNW KGNSYMIQRK DWDLSEYSYR GSEEQGNLYI
260 270 280 290 300
GYTVQVGNAI LHPTDIITVV TGAPRHQHMG AVFLLKQESG GDLQRKQVLK
310 320 330 340 350
GTQVGAYFGS AIALADLNND GWQDLLVGAP YYFERKEEVG GAVYVFMNQA
360 370 380 390 400
GASFPDQPSL LLHGPSRSAF GISIASIGDI NQDGFQDIAV GAPFEGLGKV
410 420 430 440 450
YIYHSSSGGL LRQPQQIIHG EKLGLPGLAT FGYSLSGKMD VDENLYPDLL
460 470 480 490 500
VGSLSDHIVL LRARPVINIL HRTLVARPAV LDPALCTATS CVQVELCFAY
510 520 530 540 550
NQSAGNPNYR RNITLAYTLE ADRDRRPPRL RFARSQSSVF HGFFSMPETH
560 570 580 590 600
CQTLELLLMD NVRDKLRPIV IAMNYSLPLR MPDRLKLGLR SLDAYPVLNQ
610 620 630 640 650
AQAMENHTEV HFQKECGPDN KCDSNLQMRA AFLSEQLQPL SRLQYSRDTK
660 670 680 690 700
KLFLSINVTN SPSSQRAGED AHEALLTLEV PSALLLSSVR PSGTCQANNE
710 720 730 740 750
TILCELGNPF KRNQRMELLI AFEVIGVTLH TRDLPVLLQL STSSHQDNLQ
760 770 780 790 800
PVLLTLQVDY TLQASLSLMN HRLQSFFGGT VMGEAAMKTA EDVGSPLKYE
810 820 830 840 850
FQVSPVGDGL AALGTLVLGL EWPYEVTNGK WLLYPTEITI HSNGSWPCQP
860 870 880 890 900
SGNLVNPLNL TLSDPGVTPL SPQRRRRQLD PGGDQSSPPV TLAAAKKAKS
910 920 930 940 950
ETVLTCSNGR ARCVWLECPL PDTSNITNVT VKARVWNSTF IEDYKDFDRV
960 970 980 990 1000
RVDGWATLFL RTSIPTINME NKTTWFSVDI DSELVEELPA EIELWLVLVA
1010 1020 1030 1040 1050
VGAGLLLLGL IILLLWKCGF FKRARTRALY EAKRQKAEMK SQPSETERLT

DDY
Length:1,053
Mass (Da):116,745
Last modified:November 1, 1996 - v1
Checksum:i6A5E8FBDBA86D6E5
GO
Isoform 2 (identifier: Q62470-2) [UniParc]FASTAAdd to basket
Also known as: Alpha-3B

The sequence of this isoform differs from the canonical sequence as follows:
     1019-1053: GFFKRARTRALYEAKRQKAEMKSQPSETERLTDDY → DFFKPTRYYR...TSWQIRDRYY

Show »
Length:1,068
Mass (Da):118,884
Checksum:i59B6FC2CE79A454E
GO
Isoform 3 (identifier: Q62470-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-69: MGPGPCRVPR...RQTERQQRYL → MSYLQTLVWS...RLTHPPSFSS

Note: No experimental confirmation available.
Show »
Length:1,022
Mass (Da):113,428
Checksum:i75C3A44264E59A6D
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti975W → C in AAB20356 (PubMed:1946438).Curated1
Sequence conflicti975W → C in AAB20357 (PubMed:1946438).Curated1
Sequence conflicti979D → N in AAB20356 (PubMed:1946438).Curated1
Sequence conflicti979D → N in AAB20357 (PubMed:1946438).Curated1
Sequence conflicti1002G → S in AAB20356 (PubMed:1946438).Curated1
Sequence conflicti1002G → S in AAB20357 (PubMed:1946438).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0417971 – 69MGPGP…QQRYL → MSYLQTLVWSPCSESVDLQA DWREACKARLTHPPSFSS in isoform 3. CuratedAdd BLAST69
Alternative sequenceiVSP_0027221019 – 1053GFFKR…LTDDY → DFFKPTRYYRIMPKYHAVRI REEDRYPPPGSTLPTKKHWV TSWQIRDRYY in isoform 2. CuratedAdd BLAST35

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D13867 mRNA. Translation: BAA02980.1.
AL606480 Genomic DNA. Translation: CAI23969.2.
AL606480 Genomic DNA. Translation: CAI23971.1.
AL606480 Genomic DNA. Translation: CAI23972.1.
BC053031 mRNA. Translation: AAH53031.1.
BC062205 mRNA. Translation: AAH62205.1.
S66292 mRNA. Translation: AAB20356.2.
S66294 mRNA. Translation: AAB20357.2.
CCDSiCCDS25271.1. [Q62470-1]
PIRiB41543.
I55534.
RefSeqiNP_001293000.1. NM_001306071.1. [Q62470-3]
NP_001293091.1. NM_001306162.1. [Q62470-2]
NP_038593.1. NM_013565.3. [Q62470-1]
XP_006532373.1. XM_006532310.3. [Q62470-2]
XP_006532374.1. XM_006532311.3. [Q62470-1]
UniGeneiMm.57035.

Genome annotation databases

EnsembliENSMUST00000001548; ENSMUSP00000001548; ENSMUSG00000001507. [Q62470-1]
ENSMUST00000107739; ENSMUSP00000103368; ENSMUSG00000001507. [Q62470-3]
ENSMUST00000120375; ENSMUSP00000113556; ENSMUSG00000001507. [Q62470-2]
GeneIDi16400.
KEGGimmu:16400.
UCSCiuc007kzv.1. mouse. [Q62470-3]
uc007kzw.1. mouse. [Q62470-1]
uc007kzx.1. mouse. [Q62470-2]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D13867 mRNA. Translation: BAA02980.1.
AL606480 Genomic DNA. Translation: CAI23969.2.
AL606480 Genomic DNA. Translation: CAI23971.1.
AL606480 Genomic DNA. Translation: CAI23972.1.
BC053031 mRNA. Translation: AAH53031.1.
BC062205 mRNA. Translation: AAH62205.1.
S66292 mRNA. Translation: AAB20356.2.
S66294 mRNA. Translation: AAB20357.2.
CCDSiCCDS25271.1. [Q62470-1]
PIRiB41543.
I55534.
RefSeqiNP_001293000.1. NM_001306071.1. [Q62470-3]
NP_001293091.1. NM_001306162.1. [Q62470-2]
NP_038593.1. NM_013565.3. [Q62470-1]
XP_006532373.1. XM_006532310.3. [Q62470-2]
XP_006532374.1. XM_006532311.3. [Q62470-1]
UniGeneiMm.57035.

3D structure databases

ProteinModelPortaliQ62470.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi200816. 2 interactors.
IntActiQ62470. 1 interactor.
MINTiMINT-4098816.
STRINGi10090.ENSMUSP00000001548.

PTM databases

iPTMnetiQ62470.
PhosphoSitePlusiQ62470.
SwissPalmiQ62470.

Proteomic databases

PaxDbiQ62470.
PeptideAtlasiQ62470.
PRIDEiQ62470.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000001548; ENSMUSP00000001548; ENSMUSG00000001507. [Q62470-1]
ENSMUST00000107739; ENSMUSP00000103368; ENSMUSG00000001507. [Q62470-3]
ENSMUST00000120375; ENSMUSP00000113556; ENSMUSG00000001507. [Q62470-2]
GeneIDi16400.
KEGGimmu:16400.
UCSCiuc007kzv.1. mouse. [Q62470-3]
uc007kzw.1. mouse. [Q62470-1]
uc007kzx.1. mouse. [Q62470-2]

Organism-specific databases

CTDi3675.
MGIiMGI:96602. Itga3.

Phylogenomic databases

eggNOGiENOG410IPB6. Eukaryota.
ENOG410ZZD8. LUCA.
GeneTreeiENSGT00760000118782.
HOGENOMiHOG000015786.
HOVERGENiHBG108011.
InParanoidiQ62470.
KOiK06482.
OMAiYIGYTMQ.
OrthoDBiEOG091G012D.
TreeFamiTF105391.

Enzyme and pathway databases

ReactomeiR-MMU-210991. Basigin interactions.
R-MMU-216083. Integrin cell surface interactions.
R-MMU-3000157. Laminin interactions.
R-MMU-8874081. MET activates PTK2 signaling.

Miscellaneous databases

PMAP-CutDBQ62470.
PROiQ62470.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000001507.
CleanExiMM_ITGA3.
ExpressionAtlasiQ62470. baseline and differential.
GenevisibleiQ62470. MM.

Family and domain databases

InterProiIPR013517. FG-GAP.
IPR013519. Int_alpha_beta-p.
IPR000413. Integrin_alpha.
IPR013649. Integrin_alpha-2.
IPR018184. Integrin_alpha_C_CS.
IPR032695. Integrin_dom.
[Graphical view]
PfamiPF01839. FG-GAP. 2 hits.
PF08441. Integrin_alpha2. 1 hit.
[Graphical view]
PRINTSiPR01185. INTEGRINA.
SMARTiSM00191. Int_alpha. 5 hits.
[Graphical view]
SUPFAMiSSF69179. SSF69179. 3 hits.
PROSITEiPS51470. FG_GAP. 7 hits.
PS00242. INTEGRIN_ALPHA. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiITA3_MOUSE
AccessioniPrimary (citable) accession number: Q62470
Secondary accession number(s): Q08441
, Q08442, Q5SWA8, Q5SWB9, Q6P6I1
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 15, 1998
Last sequence update: November 1, 1996
Last modified: November 30, 2016
This is version 153 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.