Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q62470

- ITA3_MOUSE

UniProt

Q62470 - ITA3_MOUSE

Protein

Integrin alpha-3

Gene

Itga3

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 134 (01 Oct 2014)
      Sequence version 1 (01 Nov 1996)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Integrin alpha-3/beta-1 is a receptor for fibronectin, laminin, collagen, epiligrin, thrombospondin and CSPG4. Alpha-3/beta-1 may mediate with LGALS3 the stimulation by CSPG4 of endothelial cells migration By similarity.By similarity

    GO - Molecular functioni

    1. protein binding Source: MGI

    GO - Biological processi

    1. cell adhesion Source: UniProtKB-KW
    2. heart development Source: Ensembl
    3. integrin-mediated signaling pathway Source: UniProtKB-KW
    4. maternal process involved in female pregnancy Source: Ensembl
    5. memory Source: MGI
    6. negative regulation of cell projection organization Source: Ensembl
    7. neuron migration Source: MGI
    8. positive regulation of cell-substrate adhesion Source: Ensembl
    9. positive regulation of epithelial cell migration Source: Ensembl
    10. positive regulation of gene expression Source: Ensembl
    11. positive regulation of neuron projection development Source: Ensembl
    12. response to drug Source: Ensembl
    13. response to gonadotropin Source: Ensembl

    Keywords - Molecular functioni

    Integrin, Receptor

    Keywords - Biological processi

    Cell adhesion

    Enzyme and pathway databases

    ReactomeiREACT_202342. Laminin interactions.
    REACT_211508. Basigin interactions.
    REACT_216309. Integrin cell surface interactions.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Integrin alpha-3
    Alternative name(s):
    CD49 antigen-like family member C
    Galactoprotein B3
    Short name:
    GAPB3
    VLA-3 subunit alpha
    CD_antigen: CD49c
    Cleaved into the following 2 chains:
    Gene namesi
    Name:Itga3
    OrganismiMus musculus (Mouse)
    Taxonomic identifieri10090 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
    ProteomesiUP000000589: Chromosome 11

    Organism-specific databases

    MGIiMGI:96602. Itga3.

    Subcellular locationi

    GO - Cellular componenti

    1. basolateral plasma membrane Source: MGI
    2. external side of plasma membrane Source: MGI
    3. growth cone Source: Ensembl
    4. integrin alpha3-beta1 complex Source: Ensembl
    5. perinuclear region of cytoplasm Source: Ensembl
    6. plasma membrane Source: MGI
    7. receptor complex Source: MGI
    8. synapse Source: MGI

    Keywords - Cellular componenti

    Cell membrane, Membrane

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Signal peptidei1 – 3232By similarityAdd
    BLAST
    Chaini33 – 10531021Integrin alpha-3PRO_0000016241Add
    BLAST
    Chaini33 – 874842Integrin alpha-3 heavy chainSequence AnalysisPRO_0000016242Add
    BLAST
    Chaini878 – 1053176Integrin alpha-3 light chainSequence AnalysisPRO_0000016243Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Glycosylationi86 – 861N-linked (GlcNAc...)2 Publications
    Disulfide bondi94 ↔ 103By similarity
    Disulfide bondi140 ↔ 162By similarity
    Disulfide bondi185 ↔ 197By similarity
    Disulfide bondi486 ↔ 491By similarity
    Disulfide bondi497 ↔ 551By similarity
    Glycosylationi501 – 5011N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi512 – 5121N-linked (GlcNAc...)1 Publication
    Glycosylationi574 – 5741N-linked (GlcNAc...)2 Publications
    Glycosylationi599 – 5991N-linked (GlcNAc...); atypical1 Publication
    Glycosylationi606 – 6061N-linked (GlcNAc...)1 Publication
    Disulfide bondi616 ↔ 622By similarity
    Glycosylationi657 – 6571N-linked (GlcNAc...)2 Publications
    Disulfide bondi695 ↔ 704By similarity
    Glycosylationi699 – 6991N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi843 – 8431N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi848 ↔ 906Interchain (between heavy and light chains)By similarity
    Glycosylationi859 – 8591N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi913 ↔ 918By similarity
    Glycosylationi925 – 9251N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi928 – 9281N-linked (GlcNAc...)1 Publication
    Glycosylationi937 – 9371N-linked (GlcNAc...)2 Publications
    Glycosylationi971 – 9711N-linked (GlcNAc...)1 Publication
    Lipidationi1018 – 10181S-palmitoyl cysteineBy similarity

    Keywords - PTMi

    Cleavage on pair of basic residues, Disulfide bond, Glycoprotein, Lipoprotein, Palmitate

    Proteomic databases

    MaxQBiQ62470.
    PaxDbiQ62470.
    PRIDEiQ62470.

    PTM databases

    PhosphoSiteiQ62470.

    Miscellaneous databases

    PMAP-CutDBQ62470.

    Expressioni

    Tissue specificityi

    Isoform 1 and isoform 2 are expressed in heart and brain. Only isoform 1 is detected in lung.1 Publication

    Gene expression databases

    ArrayExpressiQ62470.
    BgeeiQ62470.
    CleanExiMM_ITGA3.
    GenevestigatoriQ62470.

    Interactioni

    Subunit structurei

    Heterodimer of an alpha and a beta subunit. The alpha subunit is composed of a heavy and a light chain linked by a disulfide bond. Alpha-3 associates with beta-1. Interacts with HPS5 By similarity.By similarity

    Protein-protein interaction databases

    IntActiQ62470. 1 interaction.
    MINTiMINT-4098816.

    Structurei

    3D structure databases

    ProteinModelPortaliQ62470.
    SMRiQ62470. Positions 33-1026.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini33 – 993961ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini1022 – 105332CytoplasmicSequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei994 – 102128HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Repeati38 – 10366FG-GAP 1Add
    BLAST
    Repeati110 – 17162FG-GAP 2Add
    BLAST
    Repeati185 – 23652FG-GAP 3Add
    BLAST
    Repeati237 – 29458FG-GAP 4Add
    BLAST
    Repeati295 – 35561FG-GAP 5Add
    BLAST
    Repeati357 – 41256FG-GAP 6Add
    BLAST
    Repeati416 – 47863FG-GAP 7Add
    BLAST

    Sequence similaritiesi

    Belongs to the integrin alpha chain family.Curated
    Contains 7 FG-GAP repeats.Curated

    Keywords - Domaini

    Repeat, Signal, Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG26407.
    GeneTreeiENSGT00730000110529.
    HOGENOMiHOG000015786.
    HOVERGENiHBG108011.
    InParanoidiQ5SWA8.
    KOiK06482.
    OMAiYNQSAGN.
    OrthoDBiEOG7K3TK7.
    TreeFamiTF105391.

    Family and domain databases

    InterProiIPR013517. FG-GAP.
    IPR013519. Int_alpha_beta-p.
    IPR000413. Integrin_alpha.
    IPR013649. Integrin_alpha-2.
    IPR018184. Integrin_alpha_C_CS.
    [Graphical view]
    PfamiPF01839. FG-GAP. 2 hits.
    PF08441. Integrin_alpha2. 1 hit.
    [Graphical view]
    PRINTSiPR01185. INTEGRINA.
    SMARTiSM00191. Int_alpha. 5 hits.
    [Graphical view]
    PROSITEiPS51470. FG_GAP. 7 hits.
    PS00242. INTEGRIN_ALPHA. 1 hit.
    [Graphical view]

    Sequences (3)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q62470-1) [UniParc]FASTAAdd to Basket

    Also known as: Alpha-3A

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MGPGPCRVPR APGWLLRALA LMVAACGRVA FAFNLDTRFL VVKEAVNPGS     50
    LFGYSVALHR QTERQQRYLL LAGAPRDLAV GDDYTNRTGA VYLCPLTAHK 100
    DDCERMDISE KSDPDHHIIE DMWLGVTVAS QGPAGRVLVC AHRYTKVLWS 150
    GLEDQRRMVG KCYVRGNDLQ LDPGDDWQTY HNEMCNSNTD YLQTGMCQLG 200
    TSGGFTQNTV YFGAPGAYNW KGNSYMIQRK DWDLSEYSYR GSEEQGNLYI 250
    GYTVQVGNAI LHPTDIITVV TGAPRHQHMG AVFLLKQESG GDLQRKQVLK 300
    GTQVGAYFGS AIALADLNND GWQDLLVGAP YYFERKEEVG GAVYVFMNQA 350
    GASFPDQPSL LLHGPSRSAF GISIASIGDI NQDGFQDIAV GAPFEGLGKV 400
    YIYHSSSGGL LRQPQQIIHG EKLGLPGLAT FGYSLSGKMD VDENLYPDLL 450
    VGSLSDHIVL LRARPVINIL HRTLVARPAV LDPALCTATS CVQVELCFAY 500
    NQSAGNPNYR RNITLAYTLE ADRDRRPPRL RFARSQSSVF HGFFSMPETH 550
    CQTLELLLMD NVRDKLRPIV IAMNYSLPLR MPDRLKLGLR SLDAYPVLNQ 600
    AQAMENHTEV HFQKECGPDN KCDSNLQMRA AFLSEQLQPL SRLQYSRDTK 650
    KLFLSINVTN SPSSQRAGED AHEALLTLEV PSALLLSSVR PSGTCQANNE 700
    TILCELGNPF KRNQRMELLI AFEVIGVTLH TRDLPVLLQL STSSHQDNLQ 750
    PVLLTLQVDY TLQASLSLMN HRLQSFFGGT VMGEAAMKTA EDVGSPLKYE 800
    FQVSPVGDGL AALGTLVLGL EWPYEVTNGK WLLYPTEITI HSNGSWPCQP 850
    SGNLVNPLNL TLSDPGVTPL SPQRRRRQLD PGGDQSSPPV TLAAAKKAKS 900
    ETVLTCSNGR ARCVWLECPL PDTSNITNVT VKARVWNSTF IEDYKDFDRV 950
    RVDGWATLFL RTSIPTINME NKTTWFSVDI DSELVEELPA EIELWLVLVA 1000
    VGAGLLLLGL IILLLWKCGF FKRARTRALY EAKRQKAEMK SQPSETERLT 1050
    DDY 1053
    Length:1,053
    Mass (Da):116,745
    Last modified:November 1, 1996 - v1
    Checksum:i6A5E8FBDBA86D6E5
    GO
    Isoform 2 (identifier: Q62470-2) [UniParc]FASTAAdd to Basket

    Also known as: Alpha-3B

    The sequence of this isoform differs from the canonical sequence as follows:
         1019-1053: GFFKRARTRALYEAKRQKAEMKSQPSETERLTDDY → DFFKPTRYYR...TSWQIRDRYY

    Show »
    Length:1,068
    Mass (Da):118,884
    Checksum:i59B6FC2CE79A454E
    GO
    Isoform 3 (identifier: Q62470-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-69: MGPGPCRVPR...RQTERQQRYL → MSYLQTLVWS...RLTHPPSFSS

    Note: No experimental confirmation available.

    Show »
    Length:1,022
    Mass (Da):113,428
    Checksum:i75C3A44264E59A6D
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti975 – 9751W → C in AAB20356. (PubMed:1946438)Curated
    Sequence conflicti975 – 9751W → C in AAB20357. (PubMed:1946438)Curated
    Sequence conflicti979 – 9791D → N in AAB20356. (PubMed:1946438)Curated
    Sequence conflicti979 – 9791D → N in AAB20357. (PubMed:1946438)Curated
    Sequence conflicti1002 – 10021G → S in AAB20356. (PubMed:1946438)Curated
    Sequence conflicti1002 – 10021G → S in AAB20357. (PubMed:1946438)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 6969MGPGP…QQRYL → MSYLQTLVWSPCSESVDLQA DWREACKARLTHPPSFSS in isoform 3. CuratedVSP_041797Add
    BLAST
    Alternative sequencei1019 – 105335GFFKR…LTDDY → DFFKPTRYYRIMPKYHAVRI REEDRYPPPGSTLPTKKHWV TSWQIRDRYY in isoform 2. CuratedVSP_002722Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    D13867 mRNA. Translation: BAA02980.1.
    AL606480 Genomic DNA. Translation: CAI23969.2.
    AL606480 Genomic DNA. Translation: CAI23971.1.
    AL606480 Genomic DNA. Translation: CAI23972.1.
    BC053031 mRNA. Translation: AAH53031.1.
    BC062205 mRNA. Translation: AAH62205.1.
    S66292 mRNA. Translation: AAB20356.2.
    S66294 mRNA. Translation: AAB20357.2.
    CCDSiCCDS25271.1. [Q62470-1]
    PIRiB41543.
    I55534.
    RefSeqiNP_038593.1. NM_013565.2. [Q62470-1]
    XP_006532373.1. XM_006532310.1. [Q62470-2]
    XP_006532374.1. XM_006532311.1. [Q62470-1]
    UniGeneiMm.57035.

    Genome annotation databases

    EnsembliENSMUST00000001548; ENSMUSP00000001548; ENSMUSG00000001507. [Q62470-1]
    ENSMUST00000107739; ENSMUSP00000103368; ENSMUSG00000001507. [Q62470-3]
    ENSMUST00000120375; ENSMUSP00000113556; ENSMUSG00000001507. [Q62470-2]
    GeneIDi16400.
    KEGGimmu:16400.
    UCSCiuc007kzv.1. mouse. [Q62470-3]
    uc007kzw.1. mouse. [Q62470-1]
    uc007kzx.1. mouse. [Q62470-2]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    D13867 mRNA. Translation: BAA02980.1 .
    AL606480 Genomic DNA. Translation: CAI23969.2 .
    AL606480 Genomic DNA. Translation: CAI23971.1 .
    AL606480 Genomic DNA. Translation: CAI23972.1 .
    BC053031 mRNA. Translation: AAH53031.1 .
    BC062205 mRNA. Translation: AAH62205.1 .
    S66292 mRNA. Translation: AAB20356.2 .
    S66294 mRNA. Translation: AAB20357.2 .
    CCDSi CCDS25271.1. [Q62470-1 ]
    PIRi B41543.
    I55534.
    RefSeqi NP_038593.1. NM_013565.2. [Q62470-1 ]
    XP_006532373.1. XM_006532310.1. [Q62470-2 ]
    XP_006532374.1. XM_006532311.1. [Q62470-1 ]
    UniGenei Mm.57035.

    3D structure databases

    ProteinModelPortali Q62470.
    SMRi Q62470. Positions 33-1026.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    IntActi Q62470. 1 interaction.
    MINTi MINT-4098816.

    PTM databases

    PhosphoSitei Q62470.

    Proteomic databases

    MaxQBi Q62470.
    PaxDbi Q62470.
    PRIDEi Q62470.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENSMUST00000001548 ; ENSMUSP00000001548 ; ENSMUSG00000001507 . [Q62470-1 ]
    ENSMUST00000107739 ; ENSMUSP00000103368 ; ENSMUSG00000001507 . [Q62470-3 ]
    ENSMUST00000120375 ; ENSMUSP00000113556 ; ENSMUSG00000001507 . [Q62470-2 ]
    GeneIDi 16400.
    KEGGi mmu:16400.
    UCSCi uc007kzv.1. mouse. [Q62470-3 ]
    uc007kzw.1. mouse. [Q62470-1 ]
    uc007kzx.1. mouse. [Q62470-2 ]

    Organism-specific databases

    CTDi 3675.
    MGIi MGI:96602. Itga3.

    Phylogenomic databases

    eggNOGi NOG26407.
    GeneTreei ENSGT00730000110529.
    HOGENOMi HOG000015786.
    HOVERGENi HBG108011.
    InParanoidi Q5SWA8.
    KOi K06482.
    OMAi YNQSAGN.
    OrthoDBi EOG7K3TK7.
    TreeFami TF105391.

    Enzyme and pathway databases

    Reactomei REACT_202342. Laminin interactions.
    REACT_211508. Basigin interactions.
    REACT_216309. Integrin cell surface interactions.

    Miscellaneous databases

    NextBioi 289553.
    PMAP-CutDB Q62470.
    PROi Q62470.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q62470.
    Bgeei Q62470.
    CleanExi MM_ITGA3.
    Genevestigatori Q62470.

    Family and domain databases

    InterProi IPR013517. FG-GAP.
    IPR013519. Int_alpha_beta-p.
    IPR000413. Integrin_alpha.
    IPR013649. Integrin_alpha-2.
    IPR018184. Integrin_alpha_C_CS.
    [Graphical view ]
    Pfami PF01839. FG-GAP. 2 hits.
    PF08441. Integrin_alpha2. 1 hit.
    [Graphical view ]
    PRINTSi PR01185. INTEGRINA.
    SMARTi SM00191. Int_alpha. 5 hits.
    [Graphical view ]
    PROSITEi PS51470. FG_GAP. 7 hits.
    PS00242. INTEGRIN_ALPHA. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
      Strain: BALB/c.
    2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
      Strain: C57BL/6J.
    3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Strain: C57BL/6 and FVB/N.
      Tissue: Embryonic brain and Mammary tumor.
    4. "Cell type-specific integrin variants with alternative alpha chain cytoplasmic domains."
      Tamura R.N., Cooper H.M., Collo G., Quaranta V.
      Proc. Natl. Acad. Sci. U.S.A. 88:10183-10187(1991) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 913-1053 (ISOFORM 1), PARTIAL NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), TISSUE SPECIFICITY.
    5. "NG2 proteoglycan promotes endothelial cell motility and angiogenesis via engagement of galectin-3 and alpha3beta1 integrin."
      Fukushi J., Makagiansar I.T., Stallcup W.B.
      Mol. Biol. Cell 15:3580-3590(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH ITGB1; LGALS3 AND CSPG4.
    6. "The mouse C2C12 myoblast cell surface N-linked glycoproteome: identification, glycosite occupancy, and membrane orientation."
      Gundry R.L., Raginski K., Tarasova Y., Tchernyshyov I., Bausch-Fluck D., Elliott S.T., Boheler K.R., Van Eyk J.E., Wollscheid B.
      Mol. Cell. Proteomics 8:2555-2569(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-86; ASN-574; ASN-599; ASN-606; ASN-657; ASN-928 AND ASN-937.
      Tissue: Myoblast.
    7. "Mass-spectrometric identification and relative quantification of N-linked cell surface glycoproteins."
      Wollscheid B., Bausch-Fluck D., Henderson C., O'Brien R., Bibel M., Schiess R., Aebersold R., Watts J.D.
      Nat. Biotechnol. 27:378-386(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-86; ASN-512; ASN-574; ASN-657; ASN-937 AND ASN-971.

    Entry informationi

    Entry nameiITA3_MOUSE
    AccessioniPrimary (citable) accession number: Q62470
    Secondary accession number(s): Q08441
    , Q08442, Q5SWA8, Q5SWB9, Q6P6I1
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: July 15, 1998
    Last sequence update: November 1, 1996
    Last modified: October 1, 2014
    This is version 134 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. MGD cross-references
      Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
    2. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3