Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q62440 (TLE1_MOUSE) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 135. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (2) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Transducin-like enhancer protein 1
Alternative name(s):
Groucho-related protein 1
Short name=Grg-1
Gene names
Name:Tle1
Synonyms:Grg1
OrganismMus musculus (Mouse) [Reference proteome]
Taxonomic identifier10090 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus

Protein attributes

Sequence length770 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Transcriptional corepressor that binds to a number of transcription factors. Inhibits NF-kappa-B-regulated gene expression. Inhibits the transcriptional activation mediated by FOXA2, and by CTNNB1 and TCF family members in Wnt signaling. The effects of full-length TLE family members may be modulated by association with dominant-negative AES. Unusual function as coactivator for ESRRG By similarity.

Subunit structure

Homooligomer and heterooligomer with other family members. Binds RUNX1, RUNX2, FOXA2, KDM6A, UTY, histone H3, HESX1, ESRRG and the NF-kappa-B subunit RELA. Interacts with HES1 (via WRPW motif) By similarity. Binds TCF7, LEF1, TCF7L1 and TCF7L2. Ref.6

Subcellular location

Nucleus. Note: Nuclear and chromatin-associated, depending on isoforms and phosphorylation status. Hyperphosphorylation decreases the affinity for nuclear components. Ref.5

Isoform 7: Nucleus. Cytoplasm Ref.5.

Isoform 8: Nucleus. Cytoplasm Ref.5.

Tissue specificity

Highly expressed in liver and lung. Detected at slightly lower levels in heart, brain, kidney and testis. Detected in fetal and adult stomach and small intestine, in adult ileum, duodenum and colon. In adult small intestine isoform 7 and isoform 8 are most strongly expressed at the base of the crypts of Lieberkuhn.

Post-translational modification

Phosphorylated, probably by CDK1. The degree of phosphorylation varies throughout the cell cycle, and is highest at the G2/M transition. Becomes hyperphosphorylated in response to cell differentiation and interaction with HES1 or RUNX1. Ref.5 Ref.7

Ubiquitinated by XIAP/BIRC4 By similarity.

Sequence similarities

Belongs to the WD repeat Groucho/TLE family.

Contains 6 WD repeats.

Ontologies

Keywords
   Biological processTranscription
Transcription regulation
Wnt signaling pathway
   Cellular componentCytoplasm
Nucleus
   Coding sequence diversityAlternative splicing
   DomainRepeat
WD repeat
   Molecular functionRepressor
   PTMPhosphoprotein
Ubl conjugation
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Biological_processWnt signaling pathway

Inferred from electronic annotation. Source: UniProtKB-KW

negative regulation of I-kappaB kinase/NF-kappaB signaling

Inferred from sequence or structural similarity. Source: UniProtKB

negative regulation of transcription from RNA polymerase II promoter

Inferred from direct assay Ref.2PubMed 15528197. Source: MGI

regulation of transcription from RNA polymerase II promoter

Inferred from genetic interaction PubMed 15528197. Source: MGI

regulation of transcription, DNA-templated

Inferred from direct assay PubMed 15528197. Source: MGI

transcription, DNA-templated

Inferred from electronic annotation. Source: UniProtKB-KW

   Cellular_componentcytoplasm

Inferred from electronic annotation. Source: UniProtKB-SubCell

nucleus

Inferred from direct assay Ref.2. Source: MGI

transcription factor complex

Inferred from direct assay PubMed 15528197. Source: MGI

   Molecular_functionchromatin binding

Inferred from direct assay PubMed 16002402. Source: MGI

protein binding

Inferred from physical interaction PubMed 21259317. Source: UniProtKB

transcription corepressor activity

Inferred from direct assay PubMed 15528197. Source: MGI

Complete GO annotation...

Alternative products

This entry describes 8 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q62440-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q62440-2)

The sequence of this isoform differs from the canonical sequence as follows:
     125-198: Missing.
Isoform 3 (identifier: Q62440-3)

The sequence of this isoform differs from the canonical sequence as follows:
     79-198: Missing.
Isoform 4 (identifier: Q62440-4)

The sequence of this isoform differs from the canonical sequence as follows:
     125-198: Missing.
     477-658: Missing.
Isoform 5 (identifier: Q62440-5)

The sequence of this isoform differs from the canonical sequence as follows:
     1-41: MFPQSRHPTPHQAAGQPFKFTIPESLDRIKEEFQFLQAQYH → MFTLSCLFCFP
Isoform 6 (identifier: Q62440-6)

The sequence of this isoform differs from the canonical sequence as follows:
     649-653: RQLQQ → NKSYQ
     654-770: Missing.
Isoform 7 (identifier: Q62440-7)

The sequence of this isoform differs from the canonical sequence as follows:
     193-200: DRESGTSN → GERPGKPD
     201-770: Missing.
Isoform 8 (identifier: Q62440-8)

The sequence of this isoform differs from the canonical sequence as follows:
     127-127: Missing.
     193-200: DRESGTSN → GERPGKPD
     201-770: Missing.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 770770Transducin-like enhancer protein 1
PRO_0000051277

Regions

Repeat470 – 50132WD 1
Repeat528 – 55831WD 2
Repeat572 – 60231WD 3
Repeat614 – 64431WD 4
Repeat696 – 72631WD 5
Repeat737 – 76731WD 6
Region200 – 26869CCN domain
Motif225 – 2284Nuclear localization signal Potential
Compositional bias1 – 131131Gln-rich
Compositional bias132 – 19968Gly/Pro-rich
Compositional bias269 – 449181Pro/Ser-rich

Amino acid modifications

Modified residue2371Phosphoserine; by CK2 Potential
Modified residue2571Phosphoserine; by CDK1 Potential
Modified residue2611Phosphoserine; by CDK1 Potential
Modified residue2651Phosphoserine; by CDK1 Potential
Modified residue2841Phosphoserine By similarity

Natural variations

Alternative sequence1 – 4141MFPQS…QAQYH → MFTLSCLFCFP in isoform 5.
VSP_006987
Alternative sequence79 – 198120Missing in isoform 3.
VSP_006988
Alternative sequence125 – 19874Missing in isoform 2 and isoform 4.
VSP_006989
Alternative sequence1271Missing in isoform 8.
VSP_006990
Alternative sequence193 – 2008DRESGTSN → GERPGKPD in isoform 7 and isoform 8.
VSP_006992
Alternative sequence201 – 770570Missing in isoform 7 and isoform 8.
VSP_006993
Alternative sequence477 – 658182Missing in isoform 4.
VSP_006991
Alternative sequence649 – 6535RQLQQ → NKSYQ in isoform 6.
VSP_006994
Alternative sequence654 – 770117Missing in isoform 6.
VSP_006995

Experimental info

Sequence conflict481E → G in AAN77514. Ref.2
Sequence conflict921V → D in AAB49934. Ref.1
Sequence conflict1221I → T in AAN77518. Ref.2
Sequence conflict1631S → G in AAB49934. Ref.1
Sequence conflict1961S → P Ref.1
Sequence conflict1961S → P in AAN77514. Ref.2
Sequence conflict1961S → P in AAN77518. Ref.2
Sequence conflict1961S → P in BAC35221. Ref.3
Sequence conflict2101S → G Ref.1
Sequence conflict2101S → G in AAN77519. Ref.2
Sequence conflict2101S → G in BAC35221. Ref.3
Sequence conflict2101S → G in BAC38509. Ref.3
Sequence conflict2471V → I in AAN77514. Ref.2
Sequence conflict2581P → S in AAN77514. Ref.2
Sequence conflict2581P → S in AAN77518. Ref.2
Sequence conflict4281R → S in AAN77518. Ref.2
Sequence conflict464 – 4652DA → MP in AAB49934. Ref.1
Sequence conflict4711I → F in AAB49934. Ref.1
Sequence conflict5351S → T in AAB49934. Ref.1
Sequence conflict5421G → D in AAB49934. Ref.1
Sequence conflict5511A → T in AAN77517. Ref.2
Sequence conflict6121F → Y in BAC35221. Ref.3

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified March 25, 2003. Version 2.
Checksum: 65803C8F39BB0703

FASTA77083,097
        10         20         30         40         50         60 
MFPQSRHPTP HQAAGQPFKF TIPESLDRIK EEFQFLQAQY HSLKLECEKL ASEKTEMQRH 

        70         80         90        100        110        120 
YVMYYEMSYG LNIEMHKQTE IAKRLNTICA QVIPFLSQEH QQQVAQAVER AKQVTMAELN 

       130        140        150        160        170        180 
AIIGQQQLQA QHLSHGHGPP VPLTPHPSGL QPPGIPPLGG SASLLALSSA LSGQSHLAIK 

       190        200        210        220        230        240 
DDKKHHDAER HRDRESGTSN SLLVPDSLRS TDKRRNGPEF SSDIKKRKVD DKDNYDSDGD 

       250        260        270        280        290        300 
KSDDNLVVDV SNEDPSSPHA SPTHSPRENG IDKNRLLKKD ASGSPASTAS SGSSSSLKSK 

       310        320        330        340        350        360 
EVSLHEKANT PVLKSSTPTP RSDMPTPGTS ATPGLRPGLG KPPAMEPLVN QAAAGLRTPL 

       370        380        390        400        410        420 
AVPGPYPAPF GMVPHAGMNG ELTSPGAAYA GLHSMSPQMS AAAAAAAAAV VAYGRSPMVG 

       430        440        450        460        470        480 
FDPPPHMRVP SIPPNLAGIP GGKPAYSFHV TADGQMQPVP FPPDALIGPG IPRHARQINT 

       490        500        510        520        530        540 
LNHGEVVCAV TISNPTRHVY TGGKGCVKVW DISHPGNKSP VSQLDCLNRD NYIRSCKLLP 

       550        560        570        580        590        600 
DGCTLIVGGE ASTLSIWDLA APTPRIKAEL TSSAPACYAL AISPDSKVCF SCCSDGNIAV 

       610        620        630        640        650        660 
WDLHNQTLVR QFQGHTDGAS CIDISNDGTK LWTGGLDNTV RSWDLREGRQ LQQHDFTSQI 

       670        680        690        700        710        720 
FSLGYCPTGE WLAVGMESSN VEVLHVNKPD KYQLHLHESC VLSLKFAYCG KWFVSTGKDN 

       730        740        750        760        770 
LLNAWRTPYG ASIFQSKESS SVLSCDISVD DKYIVTGSGD KKATVYEVIY 

« Hide

Isoform 2 [UniParc].

Checksum: 93CA5C16F44EEAA0
Show »

FASTA69675,331
Isoform 3 [UniParc].

Checksum: 5FCC67C8B92929C1
Show »

FASTA65070,258
Isoform 4 [UniParc].

Checksum: 7C36084BE935D848
Show »

FASTA51455,619
Isoform 5 [UniParc].

Checksum: E18B2A843F1F8FE9
Show »

FASTA74079,521
Isoform 6 [UniParc].

Checksum: 7B72A99D3AFD5716
Show »

FASTA65370,000
Isoform 7 [UniParc].

Checksum: 5DAC9D0AF949D0D7
Show »

FASTA20022,439
Isoform 8 [UniParc].

Checksum: E5F799939675DE4C
Show »

FASTA19922,310

References

« Hide 'large scale' references
[1]"Transcripts of Grg4, a murine groucho-related gene, are detected in adjacent tissues to other murine neurogenic gene homologues during embryonic development."
Koop K.E., Macdonald L.M., Lobe C.G.
Mech. Dev. 59:73-87(1996) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
[2]"Characterization of a novel mammalian groucho isoform and its role in transcriptional regulation."
Lepourcelet M., Shivdasani R.A.
J. Biol. Chem. 277:47732-47740(2002) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3; 6 AND 8), PARTIAL NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4).
Strain: C57BL/6J and ICR.
Tissue: Fetal intestine.
[3]"The transcriptional landscape of the mammalian genome."
Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. expand/collapse author list , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 5 AND 7).
Strain: C57BL/6J.
Tissue: Cerebellum.
[4]"Lineage-specific biology revealed by a finished genome assembly of the mouse."
Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S., She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W., Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T., Zhou S. expand/collapse author list , Teague B., Potamousis K., Churas C., Place M., Herschleb J., Runnheim R., Forrest D., Amos-Landgraf J., Schwartz D.C., Cheng Z., Lindblad-Toh K., Eichler E.E., Ponting C.P.
PLoS Biol. 7:E1000112-E1000112(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
Strain: C57BL/6J.
[5]"Affinity for the nuclear compartment and expression during cell differentiation implicate phosphorylated Groucho/TLE1 forms of higher molecular mass in nuclear functions."
Husain J., Lo R., Grbavec D., Stifani S.
Biochem. J. 317:523-531(1996) [PubMed] [Europe PMC] [Abstract]
Cited for: SUBCELLULAR LOCATION, PHOSPHORYLATION.
[6]"All Tcf HMG box transcription factors interact with Groucho-related co-repressors."
Brantjes H., Roose J., van De Wetering M., Clevers H.
Nucleic Acids Res. 29:1410-1419(2001) [PubMed] [Europe PMC] [Abstract]
Cited for: INTERACTION WITH TCF7; LEF1; TCF7L1 AND TCF7L2.
[7]"Role for Hes1-induced phosphorylation in Groucho-mediated transcriptional repression."
Nuthall H.N., Husain J., McLarren K.W., Stifani S.
Mol. Cell. Biol. 22:389-399(2002) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION DURING NEURAL CELL DIFFERENTIATION.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
U61362 mRNA. Translation: AAB49934.1.
AY155195 mRNA. Translation: AAN77514.1.
AY155196 mRNA. Translation: AAN77515.1.
AY155197 mRNA. Translation: AAN77516.1.
AY155198 mRNA. Translation: AAN77517.1.
AY155199 mRNA. Translation: AAN77518.1.
AY155200 mRNA. Translation: AAN77519.1.
AK046402 mRNA. Translation: BAC32708.1.
AK052961 mRNA. Translation: BAC35221.1.
AK076750 mRNA. Translation: BAC36464.1.
AK082499 mRNA. Translation: BAC38509.1.
AL773513 Genomic DNA. Translation: CAI26185.1.
CCDSCCDS18274.1. [Q62440-1]
CCDS71407.1. [Q62440-7]
RefSeqNP_001272459.1. NM_001285530.1.
NP_001272460.1. NM_001285531.1. [Q62440-7]
NP_001272461.1. NM_001285532.1. [Q62440-8]
NP_035729.3. NM_011599.5.
UniGeneMm.278444.
Mm.388819.
Mm.399716.

3D structure databases

ProteinModelPortalQ62440.
SMRQ62440. Positions 438-770.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid204216. 11 interactions.
IntActQ62440. 6 interactions.
MINTMINT-225467.

PTM databases

PhosphoSiteQ62440.

Proteomic databases

MaxQBQ62440.
PaxDbQ62440.
PRIDEQ62440.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENSMUST00000107337; ENSMUSP00000102960; ENSMUSG00000008305. [Q62440-7]
GeneID21885.
KEGGmmu:21885.
UCSCuc008tij.2. mouse. [Q62440-7]
uc008tik.2. mouse. [Q62440-8]
uc012dgc.1. mouse. [Q62440-1]

Organism-specific databases

CTD7088.
MGIMGI:104636. Tle1.

Phylogenomic databases

eggNOGCOG2319.
GeneTreeENSGT00550000074465.
HOGENOMHOG000293211.
HOVERGENHBG004689.

Gene expression databases

ArrayExpressQ62440.
BgeeQ62440.
GenevestigatorQ62440.

Family and domain databases

Gene3D2.130.10.10. 1 hit.
InterProIPR005617. Groucho/TLE_N.
IPR009146. Groucho_enhance.
IPR015943. WD40/YVTN_repeat-like_dom.
IPR001680. WD40_repeat.
IPR019775. WD40_repeat_CS.
IPR017986. WD40_repeat_dom.
[Graphical view]
PfamPF03920. TLE_N. 1 hit.
PF00400. WD40. 6 hits.
[Graphical view]
PRINTSPR01850. GROUCHOFAMLY.
SMARTSM00320. WD40. 7 hits.
[Graphical view]
SUPFAMSSF50978. SSF50978. 1 hit.
PROSITEPS00678. WD_REPEATS_1. 2 hits.
PS50082. WD_REPEATS_2. 2 hits.
PS50294. WD_REPEATS_REGION. 2 hits.
[Graphical view]
ProtoNetSearch...

Other

NextBio301400.
PROQ62440.
SOURCESearch...

Entry information

Entry nameTLE1_MOUSE
AccessionPrimary (citable) accession number: Q62440
Secondary accession number(s): Q5SQA8
Entry history
Integrated into UniProtKB/Swiss-Prot: July 15, 1998
Last sequence update: March 25, 2003
Last modified: July 9, 2014
This is version 135 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Relevant documents

SIMILARITY comments

Index of protein domains and families

MGD cross-references

Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot