Reviewed,
UniProtKB/Swiss-Prot Q62440 (TLE1_MOUSE)
Last modified
June 16, 2009.
Version 90.
History...
Clusters with 100%,
90%,
50% identity |
Documents (2) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Transducin-like enhancer protein 1 Alternative name(s): Groucho-related protein 1 Short name=Grg-1 | ||||
| Gene names |
| ||||
| Organism | Mus musculus (Mouse) | ||||
| Taxonomic identifier | 10090 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus |
Protein attributes
| Sequence length | 770 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Transcriptional corepressor that binds to a number of transcription factors. Inhibits NF-kappa-B-regulated gene expression. Inhibits the transcriptional activation mediated by FOXA2, and by CTNNB1 and TCF family members in Wnt signaling. The effects of full-length TLE family members may be modulated by association with dominant-negative AES. Unusual function as coactivator for ESRRG By similarity. |
| Subunit structure | Homooligomer and heterooligomer with other family members. Binds RUNX1, RUNX2, FOXA2, KDM6A, UTY, histone H3, HESX1, ESRRG and the NF-kappa-B subunit RELA. Interacts with HES1 (via WRPW motif) By similarity. Binds TCF7, LEF1, TCF7L1 and TCF7L2. |
| Subcellular location | Nucleus. Note: Nuclear and chromatin-associated, depending on isoforms and phosphorylation status. Hyperphosphorylation decreases the affinity for nuclear components. Ref.4 |
| Tissue specificity | Highly expressed in liver and lung. Detected at slightly lower levels in heart, brain, kidney and testis. Detected in fetal and adult stomach and small intestine, in adult ileum, duodenum and colon. In adult small intestine isoform 7 and isoform 8 are most strongly expressed at the base of the crypts of Lieberkuhn. |
| Post-translational modification | Phosphorylated, probably by CDC2. The degree of phosphorylation varies throughout the cell cycle, and is highest at the G2/M transition. Becomes hyperphosphorylated in response to cell differentiation and interaction with HES1 or RUNX1. Ref.4 Ref.6 Ref.7 |
| Sequence similarities | Belongs to the WD repeat Groucho/TLE family. Contains 6 WD repeats. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Transcription Transcription regulation Wnt signaling pathway |
| Cellular component | Cytoplasm Nucleus |
| Coding sequence diversity | Alternative splicing |
| Domain | Repeat WD repeat |
| Molecular function | Repressor |
| PTM | Phosphoprotein |
| Gene Ontology (GO) | |
| Biological process | Wnt receptor signaling pathway Inferred from electronic annotation. Source: UniProtKB-KW negative regulation of transcription from RNA polymerase II promoter Ref.2Inferred from direct assay. Source: MGI transcriptionInferred from electronic annotation. Source: UniProtKB-KW |
| Cellular component | cytoplasm Inferred from electronic annotation. Source: UniProtKB-SubCell transcription factor complexInferred from direct assay. Source: MGI |
| Molecular function | chromatin binding Inferred from direct assay. Source: MGI transcription corepressor activityInferred from direct assay. Source: MGI |
| Complete GO annotation... | |
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| Lbx1 | P52955 | 1 | EBI-604471,EBI-604594 | |
| Lbxcor1 | Q8BX46 | 1 | EBI-604471,EBI-604451 |
Alternative products
| This entry describes 8 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q62440-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q62440-2) The sequence of this isoform differs from the canonical sequence as follows: 125-198: Missing. | ||||||
| Isoform 3 (identifier: Q62440-3) The sequence of this isoform differs from the canonical sequence as follows: 79-198: Missing. | ||||||
| Isoform 4 (identifier: Q62440-4) The sequence of this isoform differs from the canonical sequence as follows: 125-198: Missing. 477-658: Missing. | ||||||
| Isoform 5 (identifier: Q62440-5) The sequence of this isoform differs from the canonical sequence as follows: 1-41: MFPQSRHPTPHQAAGQPFKFTIPESLDRIKEEFQFLQAQYH → MFTLSCLFCFP | ||||||
| Isoform 6 (identifier: Q62440-6) The sequence of this isoform differs from the canonical sequence as follows: 649-653: RQLQQ → NKSYQ 654-770: Missing. | ||||||
| Isoform 7 (identifier: Q62440-7) The sequence of this isoform differs from the canonical sequence as follows: 193-200: DRESGTSN → GERPGKPD 201-770: Missing. | ||||||
| Isoform 8 (identifier: Q62440-8) The sequence of this isoform differs from the canonical sequence as follows: 127-127: Missing. 193-200: DRESGTSN → GERPGKPD 201-770: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 770 | 770 | Transducin-like enhancer protein 1 | PRO_0000051277 | |||||
Regions | |||||||||
| Repeat | 470 – 501 | 32 | WD 1 | ||||||
| Repeat | 528 – 558 | 31 | WD 2 | ||||||
| Repeat | 572 – 602 | 31 | WD 3 | ||||||
| Repeat | 614 – 644 | 31 | WD 4 | ||||||
| Repeat | 696 – 726 | 31 | WD 5 | ||||||
| Repeat | 737 – 767 | 31 | WD 6 | ||||||
| Region | 200 – 268 | 69 | CCN domain | ||||||
| Motif | 225 – 228 | 4 | Nuclear localization signal Potential | ||||||
| Compositional bias | 1 – 131 | 131 | Gln-rich | ||||||
| Compositional bias | 132 – 199 | 68 | Gly/Pro-rich | ||||||
| Compositional bias | 269 – 449 | 181 | Pro/Ser-rich | ||||||
Amino acid modifications | |||||||||
| Modified residue | 237 | 1 | Phosphoserine; by CK2 Potential | ||||||
| Modified residue | 257 | 1 | Phosphoserine; by CDC2 Potential | ||||||
| Modified residue | 261 | 1 | Phosphoserine; by CDC2 Potential | ||||||
| Modified residue | 265 | 1 | Phosphoserine; by CDC2 Potential | ||||||
| Modified residue | 282 | 1 | Phosphoserine Ref.7 | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 41 | 41 | MFPQS…QAQYH → MFTLSCLFCFP in isoform 5. | VSP_006987 | |||||
| Alternative sequence | 79 – 198 | 120 | Missing in isoform 3. | VSP_006988 | |||||
| Alternative sequence | 125 – 198 | 74 | Missing in isoform 2 and isoform 4. | VSP_006989 | |||||
| Alternative sequence | 127 | 1 | Missing in isoform 8. | VSP_006990 | |||||
| Alternative sequence | 193 – 200 | 8 | DRESGTSN → GERPGKPD in isoform 7 and isoform 8. | VSP_006992 | |||||
| Alternative sequence | 201 – 770 | 570 | Missing in isoform 7 and isoform 8. | VSP_006993 | |||||
| Alternative sequence | 477 – 658 | 182 | Missing in isoform 4. | VSP_006991 | |||||
| Alternative sequence | 649 – 653 | 5 | RQLQQ → NKSYQ in isoform 6. | VSP_006994 | |||||
| Alternative sequence | 654 – 770 | 117 | Missing in isoform 6. | VSP_006995 | |||||
Experimental info | |||||||||
| Sequence conflict | 48 | 1 | E → G in AAN77514. Ref.2 | ||||||
| Sequence conflict | 92 | 1 | V → D in AAB49934. Ref.1 | ||||||
| Sequence conflict | 122 | 1 | I → T in AAN77518. Ref.2 | ||||||
| Sequence conflict | 163 | 1 | S → G in AAB49934. Ref.1 | ||||||
| Sequence conflict | 196 | 1 | S → P Ref.1 | ||||||
| Sequence conflict | 196 | 1 | S → P in AAN77514. Ref.2 | ||||||
| Sequence conflict | 196 | 1 | S → P in AAN77518. Ref.2 | ||||||
| Sequence conflict | 196 | 1 | S → P in BAC35221. Ref.3 | ||||||
| Sequence conflict | 210 | 1 | S → G Ref.1 | ||||||
| Sequence conflict | 210 | 1 | S → G in AAN77519. Ref.2 | ||||||
| Sequence conflict | 210 | 1 | S → G in BAC35221. Ref.3 | ||||||
| Sequence conflict | 210 | 1 | S → G in BAC38509. Ref.3 | ||||||
| Sequence conflict | 247 | 1 | V → I in AAN77514. Ref.2 | ||||||
| Sequence conflict | 258 | 1 | P → S in AAN77514. Ref.2 | ||||||
| Sequence conflict | 258 | 1 | P → S in AAN77518. Ref.2 | ||||||
| Sequence conflict | 428 | 1 | R → S in AAN77518. Ref.2 | ||||||
| Sequence conflict | 464 – 465 | 2 | DA → MP in AAB49934. Ref.1 | ||||||
| Sequence conflict | 471 | 1 | I → F in AAB49934. Ref.1 | ||||||
| Sequence conflict | 535 | 1 | S → T in AAB49934. Ref.1 | ||||||
| Sequence conflict | 542 | 1 | G → D in AAB49934. Ref.1 | ||||||
| Sequence conflict | 551 | 1 | A → T in AAN77517. Ref.2 | ||||||
| Sequence conflict | 612 | 1 | F → Y in BAC35221. Ref.3 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Transcripts of Grg4, a murine groucho-related gene, are detected in adjacent tissues to other murine neurogenic gene homologues during embryonic development." Koop K.E., Macdonald L.M., Lobe C.G. Mech. Dev. 59:73-87(1996) [PubMed: 8892234] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [2] | "Characterization of a novel mammalian groucho isoform and its role in transcriptional regulation." Lepourcelet M., Shivdasani R.A. J. Biol. Chem. 277:47732-47740(2002) [PubMed: 12359720] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3; 6 AND 8), PARTIAL NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4). Strain: C57BL/6J and ICR. Tissue: Fetal intestine. |
| [3] | "The transcriptional landscape of the mammalian genome." Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. Hayashizaki Y.Science 309:1559-1563(2005) [PubMed: 16141072] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 5 AND 7). Strain: C57BL/6J. Tissue: Cerebellum. |
| [4] | "Affinity for the nuclear compartment and expression during cell differentiation implicate phosphorylated Groucho/TLE1 forms of higher molecular mass in nuclear functions." Husain J., Lo R., Grbavec D., Stifani S. Biochem. J. 317:523-531(1996) [PubMed: 8713081] [Abstract] Cited for: SUBCELLULAR LOCATION, PHOSPHORYLATION. |
| [5] | "All Tcf HMG box transcription factors interact with Groucho-related co-repressors." Brantjes H., Roose J., van De Wetering M., Clevers H. Nucleic Acids Res. 29:1410-1419(2001) [PubMed: 11266540] [Abstract] Cited for: INTERACTION WITH TCF7; LEF1; TCF7L1 AND TCF7L2. |
| [6] | "Role for Hes1-induced phosphorylation in Groucho-mediated transcriptional repression." Nuthall H.N., Husain J., McLarren K.W., Stifani S. Mol. Cell. Biol. 22:389-399(2002) [PubMed: 11756536] [Abstract] Cited for: PHOSPHORYLATION DURING NEURAL CELL DIFFERENTIATION. |
| [7] | "Large-scale phosphorylation analysis of mouse liver." Villen J., Beausoleil S.A., Gerber S.A., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 104:1488-1493(2007) [PubMed: 17242355] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-282, MASS SPECTROMETRY. Tissue: Liver. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| U61362 mRNA. Translation: AAB49934.1. AY155195 mRNA. Translation: AAN77514.1. AY155196 mRNA. Translation: AAN77515.1. AY155197 mRNA. Translation: AAN77516.1. AY155198 mRNA. Translation: AAN77517.1. AY155199 mRNA. Translation: AAN77518.1. AY155200 mRNA. Translation: AAN77519.1. AK046402 mRNA. Translation: BAC32708.1. AK052961 mRNA. Translation: BAC35221.1. AK076750 mRNA. Translation: BAC36464.1. AK082499 mRNA. Translation: BAC38509.1. | |
| IPI | IPI00230248. IPI00230249. IPI00230250. IPI00230252. IPI00230253. IPI00230254. IPI00321347. IPI00623322. |
| RefSeq | NP_035729.3. |
| UniGene | Mm.278444 Mm.388819 Mm.399716 |
3D structure databases | |
| HSSP | HSSP built from PDB template 1GXR based on UniProtKB Q04724. |
| SMR | Q62440. Positions 438-770. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q62440. 2 interactions. |
PTM databases | |
| PhosphoSite | Q62440. |
Genome annotation databases | |
| Ensembl | ENSMUSG00000008305. Mus musculus. [Contig view] |
| GeneID | 21885. |
| KEGG | mmu:21885. |
Organism-specific databases | |
| MGI | MGI:104636. Tle1. |
Phylogenomic databases | |
| HOVERGEN | Q62440. |
Gene expression databases | |
| ArrayExpress | Q62440. |
| Bgee | Q62440. |
| GermOnline | ENSMUSG00000008305. Mus musculus. |
Family and domain databases | |
| InterPro | IPR009146. Groucho_enhance. IPR005617. TLE_N. IPR015943. WD40/YVTN_repeat-like. IPR001680. WD40_repeat. IPR019782. WD40_repeat_2. IPR019775. WD40_repeat_CS. IPR017986. WD40_repeat_region. IPR019781. WD40_repeat_sg. [Graphical view] |
| Gene3D | G3DSA:2.130.10.10. WD40/YVTN_repeat-like. 1 hit. |
| Pfam | PF03920. TLE_N. 1 hit. PF00400. WD40. 6 hits. [Graphical view] |
| PRINTS | PR01850. GROUCHOFAMLY. |
| ProDom | PD000018. WD40. 1 hit. [Graphical view] [Entries sharing at least one domain] |
| SMART | SM00320. WD40. 7 hits. [Graphical view] |
| PROSITE | PS00678. WD_REPEATS_1. 2 hits. PS50082. WD_REPEATS_2. 2 hits. PS50294. WD_REPEATS_REGION. 2 hits. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| NextBio | 301400. |
| SOURCE | Search... |
Entry information
| Entry name | TLE1_MOUSE | ||||||||
| Accession | Primary (citable) accession number: Q62440 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with


