Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q62440

- TLE1_MOUSE

UniProt

Q62440 - TLE1_MOUSE

Protein

Transducin-like enhancer protein 1

Gene

Tle1

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 137 (01 Oct 2014)
      Sequence version 2 (25 Mar 2003)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Transcriptional corepressor that binds to a number of transcription factors. Inhibits NF-kappa-B-regulated gene expression. Inhibits the transcriptional activation mediated by FOXA2, and by CTNNB1 and TCF family members in Wnt signaling. The effects of full-length TLE family members may be modulated by association with dominant-negative AES. Unusual function as coactivator for ESRRG By similarity.By similarity

    GO - Molecular functioni

    1. chromatin binding Source: MGI
    2. protein binding Source: UniProtKB
    3. transcription corepressor activity Source: MGI

    GO - Biological processi

    1. negative regulation of I-kappaB kinase/NF-kappaB signaling Source: UniProtKB
    2. negative regulation of transcription from RNA polymerase II promoter Source: MGI
    3. regulation of transcription, DNA-templated Source: MGI
    4. regulation of transcription from RNA polymerase II promoter Source: MGI
    5. transcription, DNA-templated Source: UniProtKB-KW
    6. Wnt signaling pathway Source: UniProtKB-KW

    Keywords - Molecular functioni

    Repressor

    Keywords - Biological processi

    Transcription, Transcription regulation, Wnt signaling pathway

    Enzyme and pathway databases

    ReactomeiREACT_196464. NOTCH1 Intracellular Domain Regulates Transcription.
    REACT_216539. formation of the beta-catenin:TCF transactivating complex.
    REACT_219771. deactivation of the beta-catenin transactivating complex.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Transducin-like enhancer protein 1
    Alternative name(s):
    Groucho-related protein 1
    Short name:
    Grg-1
    Gene namesi
    Name:Tle1
    Synonyms:Grg1
    OrganismiMus musculus (Mouse)
    Taxonomic identifieri10090 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
    ProteomesiUP000000589: Chromosome 4

    Organism-specific databases

    MGIiMGI:104636. Tle1.

    Subcellular locationi

    Nucleus 1 Publication
    Note: Nuclear and chromatin-associated, depending on isoforms and phosphorylation status. Hyperphosphorylation decreases the affinity for nuclear components.

    GO - Cellular componenti

    1. cytoplasm Source: UniProtKB-SubCell
    2. nucleus Source: MGI
    3. transcription factor complex Source: MGI

    Keywords - Cellular componenti

    Cytoplasm, Nucleus

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 770770Transducin-like enhancer protein 1PRO_0000051277Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei237 – 2371Phosphoserine; by CK2Sequence Analysis
    Modified residuei257 – 2571Phosphoserine; by CDK1Sequence Analysis
    Modified residuei261 – 2611Phosphoserine; by CDK1Sequence Analysis
    Modified residuei265 – 2651Phosphoserine; by CDK1Sequence Analysis
    Modified residuei284 – 2841PhosphoserineBy similarity

    Post-translational modificationi

    Phosphorylated, probably by CDK1. The degree of phosphorylation varies throughout the cell cycle, and is highest at the G2/M transition. Becomes hyperphosphorylated in response to cell differentiation and interaction with HES1 or RUNX1.2 Publications
    Ubiquitinated by XIAP/BIRC4.By similarity

    Keywords - PTMi

    Phosphoprotein, Ubl conjugation

    Proteomic databases

    MaxQBiQ62440.
    PaxDbiQ62440.
    PRIDEiQ62440.

    PTM databases

    PhosphoSiteiQ62440.

    Expressioni

    Tissue specificityi

    Highly expressed in liver and lung. Detected at slightly lower levels in heart, brain, kidney and testis. Detected in fetal and adult stomach and small intestine, in adult ileum, duodenum and colon. In adult small intestine isoform 7 and isoform 8 are most strongly expressed at the base of the crypts of Lieberkuhn.

    Gene expression databases

    ArrayExpressiQ62440.
    BgeeiQ62440.
    GenevestigatoriQ62440.

    Interactioni

    Subunit structurei

    Homooligomer and heterooligomer with other family members. Binds RUNX1, RUNX2, FOXA2, KDM6A, UTY, histone H3, HESX1, ESRRG and the NF-kappa-B subunit RELA. Interacts with HES1 (via WRPW motif) By similarity. Binds TCF7, LEF1, TCF7L1 and TCF7L2.By similarity1 Publication

    Protein-protein interaction databases

    BioGridi204216. 11 interactions.
    IntActiQ62440. 6 interactions.
    MINTiMINT-225467.

    Structurei

    3D structure databases

    ProteinModelPortaliQ62440.
    SMRiQ62440. Positions 438-770.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Repeati470 – 50132WD 1Add
    BLAST
    Repeati528 – 55831WD 2Add
    BLAST
    Repeati572 – 60231WD 3Add
    BLAST
    Repeati614 – 64431WD 4Add
    BLAST
    Repeati696 – 72631WD 5Add
    BLAST
    Repeati737 – 76731WD 6Add
    BLAST

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni200 – 26869CCN domainAdd
    BLAST

    Motif

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Motifi225 – 2284Nuclear localization signalSequence Analysis

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi1 – 131131Gln-richAdd
    BLAST
    Compositional biasi132 – 19968Gly/Pro-richAdd
    BLAST
    Compositional biasi269 – 449181Pro/Ser-richAdd
    BLAST

    Sequence similaritiesi

    Belongs to the WD repeat Groucho/TLE family.Curated
    Contains 6 WD repeats.PROSITE-ProRule annotation

    Keywords - Domaini

    Repeat, WD repeat

    Phylogenomic databases

    eggNOGiCOG2319.
    GeneTreeiENSGT00550000074465.
    HOGENOMiHOG000293211.
    HOVERGENiHBG004689.

    Family and domain databases

    Gene3Di2.130.10.10. 1 hit.
    InterProiIPR005617. Groucho/TLE_N.
    IPR009146. Groucho_enhance.
    IPR015943. WD40/YVTN_repeat-like_dom.
    IPR001680. WD40_repeat.
    IPR019775. WD40_repeat_CS.
    IPR017986. WD40_repeat_dom.
    [Graphical view]
    PfamiPF03920. TLE_N. 1 hit.
    PF00400. WD40. 6 hits.
    [Graphical view]
    PRINTSiPR01850. GROUCHOFAMLY.
    SMARTiSM00320. WD40. 7 hits.
    [Graphical view]
    SUPFAMiSSF50978. SSF50978. 1 hit.
    PROSITEiPS00678. WD_REPEATS_1. 2 hits.
    PS50082. WD_REPEATS_2. 2 hits.
    PS50294. WD_REPEATS_REGION. 2 hits.
    [Graphical view]

    Sequences (8)i

    Sequence statusi: Complete.

    This entry describes 8 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q62440-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MFPQSRHPTP HQAAGQPFKF TIPESLDRIK EEFQFLQAQY HSLKLECEKL    50
    ASEKTEMQRH YVMYYEMSYG LNIEMHKQTE IAKRLNTICA QVIPFLSQEH 100
    QQQVAQAVER AKQVTMAELN AIIGQQQLQA QHLSHGHGPP VPLTPHPSGL 150
    QPPGIPPLGG SASLLALSSA LSGQSHLAIK DDKKHHDAER HRDRESGTSN 200
    SLLVPDSLRS TDKRRNGPEF SSDIKKRKVD DKDNYDSDGD KSDDNLVVDV 250
    SNEDPSSPHA SPTHSPRENG IDKNRLLKKD ASGSPASTAS SGSSSSLKSK 300
    EVSLHEKANT PVLKSSTPTP RSDMPTPGTS ATPGLRPGLG KPPAMEPLVN 350
    QAAAGLRTPL AVPGPYPAPF GMVPHAGMNG ELTSPGAAYA GLHSMSPQMS 400
    AAAAAAAAAV VAYGRSPMVG FDPPPHMRVP SIPPNLAGIP GGKPAYSFHV 450
    TADGQMQPVP FPPDALIGPG IPRHARQINT LNHGEVVCAV TISNPTRHVY 500
    TGGKGCVKVW DISHPGNKSP VSQLDCLNRD NYIRSCKLLP DGCTLIVGGE 550
    ASTLSIWDLA APTPRIKAEL TSSAPACYAL AISPDSKVCF SCCSDGNIAV 600
    WDLHNQTLVR QFQGHTDGAS CIDISNDGTK LWTGGLDNTV RSWDLREGRQ 650
    LQQHDFTSQI FSLGYCPTGE WLAVGMESSN VEVLHVNKPD KYQLHLHESC 700
    VLSLKFAYCG KWFVSTGKDN LLNAWRTPYG ASIFQSKESS SVLSCDISVD 750
    DKYIVTGSGD KKATVYEVIY 770
    Length:770
    Mass (Da):83,097
    Last modified:March 25, 2003 - v2
    Checksum:i65803C8F39BB0703
    GO
    Isoform 2 (identifier: Q62440-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         125-198: Missing.

    Show »
    Length:696
    Mass (Da):75,331
    Checksum:i93CA5C16F44EEAA0
    GO
    Isoform 3 (identifier: Q62440-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         79-198: Missing.

    Show »
    Length:650
    Mass (Da):70,258
    Checksum:i5FCC67C8B92929C1
    GO
    Isoform 4 (identifier: Q62440-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         125-198: Missing.
         477-658: Missing.

    Show »
    Length:514
    Mass (Da):55,619
    Checksum:i7C36084BE935D848
    GO
    Isoform 5 (identifier: Q62440-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-41: MFPQSRHPTPHQAAGQPFKFTIPESLDRIKEEFQFLQAQYH → MFTLSCLFCFP

    Show »
    Length:740
    Mass (Da):79,521
    Checksum:iE18B2A843F1F8FE9
    GO
    Isoform 6 (identifier: Q62440-6) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         649-653: RQLQQ → NKSYQ
         654-770: Missing.

    Show »
    Length:653
    Mass (Da):70,000
    Checksum:i7B72A99D3AFD5716
    GO
    Isoform 7 (identifier: Q62440-7) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         193-200: DRESGTSN → GERPGKPD
         201-770: Missing.

    Show »
    Length:200
    Mass (Da):22,439
    Checksum:i5DAC9D0AF949D0D7
    GO
    Isoform 8 (identifier: Q62440-8) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         127-127: Missing.
         193-200: DRESGTSN → GERPGKPD
         201-770: Missing.

    Show »
    Length:199
    Mass (Da):22,310
    Checksum:iE5F799939675DE4C
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti48 – 481E → G in AAN77514. (PubMed:12359720)Curated
    Sequence conflicti92 – 921V → D in AAB49934. (PubMed:8892234)Curated
    Sequence conflicti122 – 1221I → T in AAN77518. (PubMed:12359720)Curated
    Sequence conflicti163 – 1631S → G in AAB49934. (PubMed:8892234)Curated
    Sequence conflicti196 – 1961S → P(PubMed:8892234)Curated
    Sequence conflicti196 – 1961S → P in AAN77514. (PubMed:12359720)Curated
    Sequence conflicti196 – 1961S → P in AAN77518. (PubMed:12359720)Curated
    Sequence conflicti196 – 1961S → P in BAC35221. (PubMed:16141072)Curated
    Sequence conflicti210 – 2101S → G(PubMed:8892234)Curated
    Sequence conflicti210 – 2101S → G in AAN77519. (PubMed:12359720)Curated
    Sequence conflicti210 – 2101S → G in BAC35221. (PubMed:16141072)Curated
    Sequence conflicti210 – 2101S → G in BAC38509. (PubMed:16141072)Curated
    Sequence conflicti247 – 2471V → I in AAN77514. (PubMed:12359720)Curated
    Sequence conflicti258 – 2581P → S in AAN77514. (PubMed:12359720)Curated
    Sequence conflicti258 – 2581P → S in AAN77518. (PubMed:12359720)Curated
    Sequence conflicti428 – 4281R → S in AAN77518. (PubMed:12359720)Curated
    Sequence conflicti464 – 4652DA → MP in AAB49934. (PubMed:8892234)Curated
    Sequence conflicti471 – 4711I → F in AAB49934. (PubMed:8892234)Curated
    Sequence conflicti535 – 5351S → T in AAB49934. (PubMed:8892234)Curated
    Sequence conflicti542 – 5421G → D in AAB49934. (PubMed:8892234)Curated
    Sequence conflicti551 – 5511A → T in AAN77517. (PubMed:12359720)Curated
    Sequence conflicti612 – 6121F → Y in BAC35221. (PubMed:16141072)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 4141MFPQS…QAQYH → MFTLSCLFCFP in isoform 5. 1 PublicationVSP_006987Add
    BLAST
    Alternative sequencei79 – 198120Missing in isoform 3. 1 PublicationVSP_006988Add
    BLAST
    Alternative sequencei125 – 19874Missing in isoform 2 and isoform 4. 1 PublicationVSP_006989Add
    BLAST
    Alternative sequencei127 – 1271Missing in isoform 8. 1 PublicationVSP_006990
    Alternative sequencei193 – 2008DRESGTSN → GERPGKPD in isoform 7 and isoform 8. 2 PublicationsVSP_006992
    Alternative sequencei201 – 770570Missing in isoform 7 and isoform 8. 2 PublicationsVSP_006993Add
    BLAST
    Alternative sequencei477 – 658182Missing in isoform 4. CuratedVSP_006991Add
    BLAST
    Alternative sequencei649 – 6535RQLQQ → NKSYQ in isoform 6. 1 PublicationVSP_006994
    Alternative sequencei654 – 770117Missing in isoform 6. 1 PublicationVSP_006995Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    U61362 mRNA. Translation: AAB49934.1.
    AY155195 mRNA. Translation: AAN77514.1.
    AY155196 mRNA. Translation: AAN77515.1.
    AY155197 mRNA. Translation: AAN77516.1.
    AY155198 mRNA. Translation: AAN77517.1.
    AY155199 mRNA. Translation: AAN77518.1.
    AY155200 mRNA. Translation: AAN77519.1.
    AK046402 mRNA. Translation: BAC32708.1.
    AK052961 mRNA. Translation: BAC35221.1.
    AK076750 mRNA. Translation: BAC36464.1.
    AK082499 mRNA. Translation: BAC38509.1.
    AL773513 Genomic DNA. Translation: CAI26185.1.
    CCDSiCCDS18274.1. [Q62440-1]
    CCDS71407.1. [Q62440-7]
    RefSeqiNP_001272459.1. NM_001285530.1.
    NP_001272460.1. NM_001285531.1. [Q62440-7]
    NP_001272461.1. NM_001285532.1. [Q62440-8]
    NP_035729.3. NM_011599.5.
    UniGeneiMm.278444.
    Mm.388819.
    Mm.399716.

    Genome annotation databases

    EnsembliENSMUST00000107337; ENSMUSP00000102960; ENSMUSG00000008305. [Q62440-7]
    GeneIDi21885.
    KEGGimmu:21885.
    UCSCiuc008tij.2. mouse. [Q62440-7]
    uc008tik.2. mouse. [Q62440-8]
    uc012dgc.1. mouse. [Q62440-1]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    U61362 mRNA. Translation: AAB49934.1 .
    AY155195 mRNA. Translation: AAN77514.1 .
    AY155196 mRNA. Translation: AAN77515.1 .
    AY155197 mRNA. Translation: AAN77516.1 .
    AY155198 mRNA. Translation: AAN77517.1 .
    AY155199 mRNA. Translation: AAN77518.1 .
    AY155200 mRNA. Translation: AAN77519.1 .
    AK046402 mRNA. Translation: BAC32708.1 .
    AK052961 mRNA. Translation: BAC35221.1 .
    AK076750 mRNA. Translation: BAC36464.1 .
    AK082499 mRNA. Translation: BAC38509.1 .
    AL773513 Genomic DNA. Translation: CAI26185.1 .
    CCDSi CCDS18274.1. [Q62440-1 ]
    CCDS71407.1. [Q62440-7 ]
    RefSeqi NP_001272459.1. NM_001285530.1.
    NP_001272460.1. NM_001285531.1. [Q62440-7 ]
    NP_001272461.1. NM_001285532.1. [Q62440-8 ]
    NP_035729.3. NM_011599.5.
    UniGenei Mm.278444.
    Mm.388819.
    Mm.399716.

    3D structure databases

    ProteinModelPortali Q62440.
    SMRi Q62440. Positions 438-770.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 204216. 11 interactions.
    IntActi Q62440. 6 interactions.
    MINTi MINT-225467.

    PTM databases

    PhosphoSitei Q62440.

    Proteomic databases

    MaxQBi Q62440.
    PaxDbi Q62440.
    PRIDEi Q62440.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENSMUST00000107337 ; ENSMUSP00000102960 ; ENSMUSG00000008305 . [Q62440-7 ]
    GeneIDi 21885.
    KEGGi mmu:21885.
    UCSCi uc008tij.2. mouse. [Q62440-7 ]
    uc008tik.2. mouse. [Q62440-8 ]
    uc012dgc.1. mouse. [Q62440-1 ]

    Organism-specific databases

    CTDi 7088.
    MGIi MGI:104636. Tle1.

    Phylogenomic databases

    eggNOGi COG2319.
    GeneTreei ENSGT00550000074465.
    HOGENOMi HOG000293211.
    HOVERGENi HBG004689.

    Enzyme and pathway databases

    Reactomei REACT_196464. NOTCH1 Intracellular Domain Regulates Transcription.
    REACT_216539. formation of the beta-catenin:TCF transactivating complex.
    REACT_219771. deactivation of the beta-catenin transactivating complex.

    Miscellaneous databases

    NextBioi 301400.
    PROi Q62440.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q62440.
    Bgeei Q62440.
    Genevestigatori Q62440.

    Family and domain databases

    Gene3Di 2.130.10.10. 1 hit.
    InterProi IPR005617. Groucho/TLE_N.
    IPR009146. Groucho_enhance.
    IPR015943. WD40/YVTN_repeat-like_dom.
    IPR001680. WD40_repeat.
    IPR019775. WD40_repeat_CS.
    IPR017986. WD40_repeat_dom.
    [Graphical view ]
    Pfami PF03920. TLE_N. 1 hit.
    PF00400. WD40. 6 hits.
    [Graphical view ]
    PRINTSi PR01850. GROUCHOFAMLY.
    SMARTi SM00320. WD40. 7 hits.
    [Graphical view ]
    SUPFAMi SSF50978. SSF50978. 1 hit.
    PROSITEi PS00678. WD_REPEATS_1. 2 hits.
    PS50082. WD_REPEATS_2. 2 hits.
    PS50294. WD_REPEATS_REGION. 2 hits.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Transcripts of Grg4, a murine groucho-related gene, are detected in adjacent tissues to other murine neurogenic gene homologues during embryonic development."
      Koop K.E., Macdonald L.M., Lobe C.G.
      Mech. Dev. 59:73-87(1996) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    2. "Characterization of a novel mammalian groucho isoform and its role in transcriptional regulation."
      Lepourcelet M., Shivdasani R.A.
      J. Biol. Chem. 277:47732-47740(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3; 6 AND 8), PARTIAL NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4).
      Strain: C57BL/6J and ICR.
      Tissue: Fetal intestine.
    3. "The transcriptional landscape of the mammalian genome."
      Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
      , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
      Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 5 AND 7).
      Strain: C57BL/6J.
      Tissue: Cerebellum.
    4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
      Strain: C57BL/6J.
    5. "Affinity for the nuclear compartment and expression during cell differentiation implicate phosphorylated Groucho/TLE1 forms of higher molecular mass in nuclear functions."
      Husain J., Lo R., Grbavec D., Stifani S.
      Biochem. J. 317:523-531(1996) [PubMed] [Europe PMC] [Abstract]
      Cited for: SUBCELLULAR LOCATION, PHOSPHORYLATION.
    6. "All Tcf HMG box transcription factors interact with Groucho-related co-repressors."
      Brantjes H., Roose J., van De Wetering M., Clevers H.
      Nucleic Acids Res. 29:1410-1419(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH TCF7; LEF1; TCF7L1 AND TCF7L2.
    7. "Role for Hes1-induced phosphorylation in Groucho-mediated transcriptional repression."
      Nuthall H.N., Husain J., McLarren K.W., Stifani S.
      Mol. Cell. Biol. 22:389-399(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION DURING NEURAL CELL DIFFERENTIATION.

    Entry informationi

    Entry nameiTLE1_MOUSE
    AccessioniPrimary (citable) accession number: Q62440
    Secondary accession number(s): Q5SQA8
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: July 15, 1998
    Last sequence update: March 25, 2003
    Last modified: October 1, 2014
    This is version 137 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. MGD cross-references
      Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
    2. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3