SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q62440

- TLE1_MOUSE

UniProt

Q62440 - TLE1_MOUSE

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Transducin-like enhancer protein 1

Gene
Tle1, Grg1
Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Transcriptional corepressor that binds to a number of transcription factors. Inhibits NF-kappa-B-regulated gene expression. Inhibits the transcriptional activation mediated by FOXA2, and by CTNNB1 and TCF family members in Wnt signaling. The effects of full-length TLE family members may be modulated by association with dominant-negative AES. Unusual function as coactivator for ESRRG By similarity.

GO - Molecular functioni

  1. chromatin binding Source: MGI
  2. protein binding Source: UniProtKB
  3. transcription corepressor activity Source: MGI

GO - Biological processi

  1. negative regulation of I-kappaB kinase/NF-kappaB signaling Source: UniProtKB
  2. negative regulation of transcription from RNA polymerase II promoter Source: MGI
  3. regulation of transcription, DNA-templated Source: MGI
  4. regulation of transcription from RNA polymerase II promoter Source: MGI
  5. transcription, DNA-templated Source: UniProtKB-KW
  6. Wnt signaling pathway Source: UniProtKB-KW
Complete GO annotation...

Keywords - Molecular functioni

Repressor

Keywords - Biological processi

Transcription, Transcription regulation, Wnt signaling pathway

Enzyme and pathway databases

ReactomeiREACT_196464. NOTCH1 Intracellular Domain Regulates Transcription.
REACT_216539. formation of the beta-catenin:TCF transactivating complex.
REACT_219771. deactivation of the beta-catenin transactivating complex.

Names & Taxonomyi

Protein namesi
Recommended name:
Transducin-like enhancer protein 1
Alternative name(s):
Groucho-related protein 1
Short name:
Grg-1
Gene namesi
Name:Tle1
Synonyms:Grg1
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589: Chromosome 4

Organism-specific databases

MGIiMGI:104636. Tle1.

Subcellular locationi

Nucleus
Note: Nuclear and chromatin-associated, depending on isoforms and phosphorylation status. Hyperphosphorylation decreases the affinity for nuclear components.1 Publication
Isoform 7 : Nucleus. Cytoplasm 1 Publication
Isoform 8 : Nucleus. Cytoplasm 1 Publication

GO - Cellular componenti

  1. cytoplasm Source: UniProtKB-SubCell
  2. nucleus Source: MGI
  3. transcription factor complex Source: MGI
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 770770Transducin-like enhancer protein 1PRO_0000051277Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei237 – 2371Phosphoserine; by CK2 Reviewed prediction
Modified residuei257 – 2571Phosphoserine; by CDK1 Reviewed prediction
Modified residuei261 – 2611Phosphoserine; by CDK1 Reviewed prediction
Modified residuei265 – 2651Phosphoserine; by CDK1 Reviewed prediction
Modified residuei284 – 2841Phosphoserine By similarity

Post-translational modificationi

Phosphorylated, probably by CDK1. The degree of phosphorylation varies throughout the cell cycle, and is highest at the G2/M transition. Becomes hyperphosphorylated in response to cell differentiation and interaction with HES1 or RUNX1.2 Publications
Ubiquitinated by XIAP/BIRC4 By similarity.

Keywords - PTMi

Phosphoprotein, Ubl conjugation

Proteomic databases

MaxQBiQ62440.
PaxDbiQ62440.
PRIDEiQ62440.

PTM databases

PhosphoSiteiQ62440.

Expressioni

Tissue specificityi

Highly expressed in liver and lung. Detected at slightly lower levels in heart, brain, kidney and testis. Detected in fetal and adult stomach and small intestine, in adult ileum, duodenum and colon. In adult small intestine isoform 7 and isoform 8 are most strongly expressed at the base of the crypts of Lieberkuhn.

Gene expression databases

ArrayExpressiQ62440.
BgeeiQ62440.
GenevestigatoriQ62440.

Interactioni

Subunit structurei

Homooligomer and heterooligomer with other family members. Binds RUNX1, RUNX2, FOXA2, KDM6A, UTY, histone H3, HESX1, ESRRG and the NF-kappa-B subunit RELA. Interacts with HES1 (via WRPW motif) By similarity. Binds TCF7, LEF1, TCF7L1 and TCF7L2.1 Publication

Protein-protein interaction databases

BioGridi204216. 11 interactions.
IntActiQ62440. 6 interactions.
MINTiMINT-225467.

Structurei

3D structure databases

ProteinModelPortaliQ62440.
SMRiQ62440. Positions 438-770.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Repeati470 – 50132WD 1Add
BLAST
Repeati528 – 55831WD 2Add
BLAST
Repeati572 – 60231WD 3Add
BLAST
Repeati614 – 64431WD 4Add
BLAST
Repeati696 – 72631WD 5Add
BLAST
Repeati737 – 76731WD 6Add
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni200 – 26869CCN domainAdd
BLAST

Motif

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Motifi225 – 2284Nuclear localization signal Reviewed prediction

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi1 – 131131Gln-richAdd
BLAST
Compositional biasi132 – 19968Gly/Pro-richAdd
BLAST
Compositional biasi269 – 449181Pro/Ser-richAdd
BLAST

Sequence similaritiesi

Contains 6 WD repeats.

Keywords - Domaini

Repeat, WD repeat

Phylogenomic databases

eggNOGiCOG2319.
GeneTreeiENSGT00550000074465.
HOGENOMiHOG000293211.
HOVERGENiHBG004689.

Family and domain databases

Gene3Di2.130.10.10. 1 hit.
InterProiIPR005617. Groucho/TLE_N.
IPR009146. Groucho_enhance.
IPR015943. WD40/YVTN_repeat-like_dom.
IPR001680. WD40_repeat.
IPR019775. WD40_repeat_CS.
IPR017986. WD40_repeat_dom.
[Graphical view]
PfamiPF03920. TLE_N. 1 hit.
PF00400. WD40. 6 hits.
[Graphical view]
PRINTSiPR01850. GROUCHOFAMLY.
SMARTiSM00320. WD40. 7 hits.
[Graphical view]
SUPFAMiSSF50978. SSF50978. 1 hit.
PROSITEiPS00678. WD_REPEATS_1. 2 hits.
PS50082. WD_REPEATS_2. 2 hits.
PS50294. WD_REPEATS_REGION. 2 hits.
[Graphical view]

Sequences (8)i

Sequence statusi: Complete.

This entry describes 8 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q62440-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MFPQSRHPTP HQAAGQPFKF TIPESLDRIK EEFQFLQAQY HSLKLECEKL    50
ASEKTEMQRH YVMYYEMSYG LNIEMHKQTE IAKRLNTICA QVIPFLSQEH 100
QQQVAQAVER AKQVTMAELN AIIGQQQLQA QHLSHGHGPP VPLTPHPSGL 150
QPPGIPPLGG SASLLALSSA LSGQSHLAIK DDKKHHDAER HRDRESGTSN 200
SLLVPDSLRS TDKRRNGPEF SSDIKKRKVD DKDNYDSDGD KSDDNLVVDV 250
SNEDPSSPHA SPTHSPRENG IDKNRLLKKD ASGSPASTAS SGSSSSLKSK 300
EVSLHEKANT PVLKSSTPTP RSDMPTPGTS ATPGLRPGLG KPPAMEPLVN 350
QAAAGLRTPL AVPGPYPAPF GMVPHAGMNG ELTSPGAAYA GLHSMSPQMS 400
AAAAAAAAAV VAYGRSPMVG FDPPPHMRVP SIPPNLAGIP GGKPAYSFHV 450
TADGQMQPVP FPPDALIGPG IPRHARQINT LNHGEVVCAV TISNPTRHVY 500
TGGKGCVKVW DISHPGNKSP VSQLDCLNRD NYIRSCKLLP DGCTLIVGGE 550
ASTLSIWDLA APTPRIKAEL TSSAPACYAL AISPDSKVCF SCCSDGNIAV 600
WDLHNQTLVR QFQGHTDGAS CIDISNDGTK LWTGGLDNTV RSWDLREGRQ 650
LQQHDFTSQI FSLGYCPTGE WLAVGMESSN VEVLHVNKPD KYQLHLHESC 700
VLSLKFAYCG KWFVSTGKDN LLNAWRTPYG ASIFQSKESS SVLSCDISVD 750
DKYIVTGSGD KKATVYEVIY 770
Length:770
Mass (Da):83,097
Last modified:March 25, 2003 - v2
Checksum:i65803C8F39BB0703
GO
Isoform 2 (identifier: Q62440-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     125-198: Missing.

Show »
Length:696
Mass (Da):75,331
Checksum:i93CA5C16F44EEAA0
GO
Isoform 3 (identifier: Q62440-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     79-198: Missing.

Show »
Length:650
Mass (Da):70,258
Checksum:i5FCC67C8B92929C1
GO
Isoform 4 (identifier: Q62440-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     125-198: Missing.
     477-658: Missing.

Show »
Length:514
Mass (Da):55,619
Checksum:i7C36084BE935D848
GO
Isoform 5 (identifier: Q62440-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-41: MFPQSRHPTPHQAAGQPFKFTIPESLDRIKEEFQFLQAQYH → MFTLSCLFCFP

Show »
Length:740
Mass (Da):79,521
Checksum:iE18B2A843F1F8FE9
GO
Isoform 6 (identifier: Q62440-6) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     649-653: RQLQQ → NKSYQ
     654-770: Missing.

Show »
Length:653
Mass (Da):70,000
Checksum:i7B72A99D3AFD5716
GO
Isoform 7 (identifier: Q62440-7) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     193-200: DRESGTSN → GERPGKPD
     201-770: Missing.

Show »
Length:200
Mass (Da):22,439
Checksum:i5DAC9D0AF949D0D7
GO
Isoform 8 (identifier: Q62440-8) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     127-127: Missing.
     193-200: DRESGTSN → GERPGKPD
     201-770: Missing.

Show »
Length:199
Mass (Da):22,310
Checksum:iE5F799939675DE4C
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 4141MFPQS…QAQYH → MFTLSCLFCFP in isoform 5. VSP_006987Add
BLAST
Alternative sequencei79 – 198120Missing in isoform 3. VSP_006988Add
BLAST
Alternative sequencei125 – 19874Missing in isoform 2 and isoform 4. VSP_006989Add
BLAST
Alternative sequencei127 – 1271Missing in isoform 8. VSP_006990
Alternative sequencei193 – 2008DRESGTSN → GERPGKPD in isoform 7 and isoform 8. VSP_006992
Alternative sequencei201 – 770570Missing in isoform 7 and isoform 8. VSP_006993Add
BLAST
Alternative sequencei477 – 658182Missing in isoform 4. VSP_006991Add
BLAST
Alternative sequencei649 – 6535RQLQQ → NKSYQ in isoform 6. VSP_006994
Alternative sequencei654 – 770117Missing in isoform 6. VSP_006995Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti48 – 481E → G in AAN77514. 1 Publication
Sequence conflicti92 – 921V → D in AAB49934. 1 Publication
Sequence conflicti122 – 1221I → T in AAN77518. 1 Publication
Sequence conflicti163 – 1631S → G in AAB49934. 1 Publication
Sequence conflicti196 – 1961S → P1 Publication
Sequence conflicti196 – 1961S → P in AAN77514. 1 Publication
Sequence conflicti196 – 1961S → P in AAN77518. 1 Publication
Sequence conflicti196 – 1961S → P in BAC35221. 1 Publication
Sequence conflicti210 – 2101S → G1 Publication
Sequence conflicti210 – 2101S → G in AAN77519. 1 Publication
Sequence conflicti210 – 2101S → G in BAC35221. 1 Publication
Sequence conflicti210 – 2101S → G in BAC38509. 1 Publication
Sequence conflicti247 – 2471V → I in AAN77514. 1 Publication
Sequence conflicti258 – 2581P → S in AAN77514. 1 Publication
Sequence conflicti258 – 2581P → S in AAN77518. 1 Publication
Sequence conflicti428 – 4281R → S in AAN77518. 1 Publication
Sequence conflicti464 – 4652DA → MP in AAB49934. 1 Publication
Sequence conflicti471 – 4711I → F in AAB49934. 1 Publication
Sequence conflicti535 – 5351S → T in AAB49934. 1 Publication
Sequence conflicti542 – 5421G → D in AAB49934. 1 Publication
Sequence conflicti551 – 5511A → T in AAN77517. 1 Publication
Sequence conflicti612 – 6121F → Y in BAC35221. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
U61362 mRNA. Translation: AAB49934.1.
AY155195 mRNA. Translation: AAN77514.1.
AY155196 mRNA. Translation: AAN77515.1.
AY155197 mRNA. Translation: AAN77516.1.
AY155198 mRNA. Translation: AAN77517.1.
AY155199 mRNA. Translation: AAN77518.1.
AY155200 mRNA. Translation: AAN77519.1.
AK046402 mRNA. Translation: BAC32708.1.
AK052961 mRNA. Translation: BAC35221.1.
AK076750 mRNA. Translation: BAC36464.1.
AK082499 mRNA. Translation: BAC38509.1.
AL773513 Genomic DNA. Translation: CAI26185.1.
CCDSiCCDS18274.1. [Q62440-1]
CCDS71407.1. [Q62440-7]
RefSeqiNP_001272459.1. NM_001285530.1.
NP_001272460.1. NM_001285531.1. [Q62440-7]
NP_001272461.1. NM_001285532.1. [Q62440-8]
NP_035729.3. NM_011599.5.
UniGeneiMm.278444.
Mm.388819.
Mm.399716.

Genome annotation databases

EnsembliENSMUST00000107337; ENSMUSP00000102960; ENSMUSG00000008305. [Q62440-7]
GeneIDi21885.
KEGGimmu:21885.
UCSCiuc008tij.2. mouse. [Q62440-7]
uc008tik.2. mouse. [Q62440-8]
uc012dgc.1. mouse. [Q62440-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
U61362 mRNA. Translation: AAB49934.1 .
AY155195 mRNA. Translation: AAN77514.1 .
AY155196 mRNA. Translation: AAN77515.1 .
AY155197 mRNA. Translation: AAN77516.1 .
AY155198 mRNA. Translation: AAN77517.1 .
AY155199 mRNA. Translation: AAN77518.1 .
AY155200 mRNA. Translation: AAN77519.1 .
AK046402 mRNA. Translation: BAC32708.1 .
AK052961 mRNA. Translation: BAC35221.1 .
AK076750 mRNA. Translation: BAC36464.1 .
AK082499 mRNA. Translation: BAC38509.1 .
AL773513 Genomic DNA. Translation: CAI26185.1 .
CCDSi CCDS18274.1. [Q62440-1 ]
CCDS71407.1. [Q62440-7 ]
RefSeqi NP_001272459.1. NM_001285530.1.
NP_001272460.1. NM_001285531.1. [Q62440-7 ]
NP_001272461.1. NM_001285532.1. [Q62440-8 ]
NP_035729.3. NM_011599.5.
UniGenei Mm.278444.
Mm.388819.
Mm.399716.

3D structure databases

ProteinModelPortali Q62440.
SMRi Q62440. Positions 438-770.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 204216. 11 interactions.
IntActi Q62440. 6 interactions.
MINTi MINT-225467.

PTM databases

PhosphoSitei Q62440.

Proteomic databases

MaxQBi Q62440.
PaxDbi Q62440.
PRIDEi Q62440.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENSMUST00000107337 ; ENSMUSP00000102960 ; ENSMUSG00000008305 . [Q62440-7 ]
GeneIDi 21885.
KEGGi mmu:21885.
UCSCi uc008tij.2. mouse. [Q62440-7 ]
uc008tik.2. mouse. [Q62440-8 ]
uc012dgc.1. mouse. [Q62440-1 ]

Organism-specific databases

CTDi 7088.
MGIi MGI:104636. Tle1.

Phylogenomic databases

eggNOGi COG2319.
GeneTreei ENSGT00550000074465.
HOGENOMi HOG000293211.
HOVERGENi HBG004689.

Enzyme and pathway databases

Reactomei REACT_196464. NOTCH1 Intracellular Domain Regulates Transcription.
REACT_216539. formation of the beta-catenin:TCF transactivating complex.
REACT_219771. deactivation of the beta-catenin transactivating complex.

Miscellaneous databases

NextBioi 301400.
PROi Q62440.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q62440.
Bgeei Q62440.
Genevestigatori Q62440.

Family and domain databases

Gene3Di 2.130.10.10. 1 hit.
InterProi IPR005617. Groucho/TLE_N.
IPR009146. Groucho_enhance.
IPR015943. WD40/YVTN_repeat-like_dom.
IPR001680. WD40_repeat.
IPR019775. WD40_repeat_CS.
IPR017986. WD40_repeat_dom.
[Graphical view ]
Pfami PF03920. TLE_N. 1 hit.
PF00400. WD40. 6 hits.
[Graphical view ]
PRINTSi PR01850. GROUCHOFAMLY.
SMARTi SM00320. WD40. 7 hits.
[Graphical view ]
SUPFAMi SSF50978. SSF50978. 1 hit.
PROSITEi PS00678. WD_REPEATS_1. 2 hits.
PS50082. WD_REPEATS_2. 2 hits.
PS50294. WD_REPEATS_REGION. 2 hits.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Transcripts of Grg4, a murine groucho-related gene, are detected in adjacent tissues to other murine neurogenic gene homologues during embryonic development."
    Koop K.E., Macdonald L.M., Lobe C.G.
    Mech. Dev. 59:73-87(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  2. "Characterization of a novel mammalian groucho isoform and its role in transcriptional regulation."
    Lepourcelet M., Shivdasani R.A.
    J. Biol. Chem. 277:47732-47740(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3; 6 AND 8), PARTIAL NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4).
    Strain: C57BL/6J and ICR.
    Tissue: Fetal intestine.
  3. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 5 AND 7).
    Strain: C57BL/6J.
    Tissue: Cerebellum.
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    Strain: C57BL/6J.
  5. "Affinity for the nuclear compartment and expression during cell differentiation implicate phosphorylated Groucho/TLE1 forms of higher molecular mass in nuclear functions."
    Husain J., Lo R., Grbavec D., Stifani S.
    Biochem. J. 317:523-531(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: SUBCELLULAR LOCATION, PHOSPHORYLATION.
  6. "All Tcf HMG box transcription factors interact with Groucho-related co-repressors."
    Brantjes H., Roose J., van De Wetering M., Clevers H.
    Nucleic Acids Res. 29:1410-1419(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH TCF7; LEF1; TCF7L1 AND TCF7L2.
  7. "Role for Hes1-induced phosphorylation in Groucho-mediated transcriptional repression."
    Nuthall H.N., Husain J., McLarren K.W., Stifani S.
    Mol. Cell. Biol. 22:389-399(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION DURING NEURAL CELL DIFFERENTIATION.

Entry informationi

Entry nameiTLE1_MOUSE
AccessioniPrimary (citable) accession number: Q62440
Secondary accession number(s): Q5SQA8
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 15, 1998
Last sequence update: March 25, 2003
Last modified: September 3, 2014
This is version 136 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi