Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Transducin-like enhancer protein 1

Gene

Tle1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Transcriptional corepressor that binds to a number of transcription factors. Inhibits NF-kappa-B-regulated gene expression. Inhibits the transcriptional activation mediated by FOXA2, and by CTNNB1 and TCF family members in Wnt signaling. The effects of full-length TLE family members may be modulated by association with dominant-negative AES. Unusual function as coactivator for ESRRG (By similarity).By similarity

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionRepressor
Biological processTranscription, Transcription regulation, Wnt signaling pathway

Enzyme and pathway databases

ReactomeiR-MMU-201722 Formation of the beta-catenin:TCF transactivating complex
R-MMU-3769402 Deactivation of the beta-catenin transactivating complex
R-MMU-4641265 Repression of WNT target genes

Names & Taxonomyi

Protein namesi
Recommended name:
Transducin-like enhancer protein 1
Alternative name(s):
Groucho-related protein 1
Short name:
Grg-1
Gene namesi
Name:Tle1
Synonyms:Grg1
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 4

Organism-specific databases

MGIiMGI:104636 Tle1

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000512771 – 770Transducin-like enhancer protein 1Add BLAST770

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei237Phosphoserine; by CK2Sequence analysisBy similarity1
Modified residuei257Phosphoserine; by CDK1Sequence analysis1
Modified residuei261Phosphoserine; by CDK1Sequence analysis1
Modified residuei265Phosphoserine; by CDK1Sequence analysis1
Modified residuei284PhosphoserineCombined sources1

Post-translational modificationi

Phosphorylated, probably by CDK1. The degree of phosphorylation varies throughout the cell cycle, and is highest at the G2/M transition. Becomes hyperphosphorylated in response to cell differentiation and interaction with HES1 or RUNX1.2 Publications
Ubiquitinated by XIAP/BIRC4.By similarity

Keywords - PTMi

Phosphoprotein, Ubl conjugation

Proteomic databases

PaxDbiQ62440
PeptideAtlasiQ62440
PRIDEiQ62440

PTM databases

iPTMnetiQ62440
PhosphoSitePlusiQ62440

Expressioni

Tissue specificityi

Highly expressed in liver and lung. Detected at slightly lower levels in heart, brain, kidney and testis. Detected in fetal and adult stomach and small intestine, in adult ileum, duodenum and colon. In adult small intestine isoform 7 and isoform 8 are most strongly expressed at the base of the crypts of Lieberkuhn.

Gene expression databases

BgeeiENSMUSG00000008305
ExpressionAtlasiQ62440 baseline and differential
GenevisibleiQ62440 MM

Interactioni

Subunit structurei

Homooligomer and heterooligomer with other family members. Binds RUNX1, RUNX2, FOXA2, KDM6A, UTY, histone H3, HESX1, ESRRG and the NF-kappa-B subunit RELA. Interacts with HES1 (via WRPW motif) (By similarity). Binds TCF7, LEF1, TCF7L1 and TCF7L2. Interacts with SIX3 (By similarity). Interacts with EFNB1.By similarity2 Publications

GO - Molecular functioni

Protein-protein interaction databases

BioGridi204216, 11 interactors
CORUMiQ62440
IntActiQ62440, 6 interactors
MINTiQ62440
STRINGi10090.ENSMUSP00000072481

Structurei

3D structure databases

ProteinModelPortaliQ62440
SMRiQ62440
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Repeati470 – 501WD 1Add BLAST32
Repeati528 – 558WD 2Add BLAST31
Repeati572 – 602WD 3Add BLAST31
Repeati614 – 644WD 4Add BLAST31
Repeati696 – 726WD 5Add BLAST31
Repeati737 – 767WD 6Add BLAST31

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni1 – 131Q domainBy similarityAdd BLAST131
Regioni132 – 199GP domainBy similarityAdd BLAST68
Regioni200 – 266CcN domainBy similarityAdd BLAST67
Regioni267 – 450SP domainBy similarityAdd BLAST184

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi225 – 228Nuclear localization signalSequence analysis4

Domaini

WD repeat Groucho/TLE family members are characterized by 5 regions, a glutamine-rich Q domain, a glycine/proline-rich GP domain, a central CcN domain, containing a nuclear localization signal, and a serine/proline-rich SP domain. The most highly conserved are the N-terminal Q domain and the C-terminal WD-repeat domain.1 Publication

Sequence similaritiesi

Belongs to the WD repeat Groucho/TLE family.Curated

Keywords - Domaini

Repeat, WD repeat

Phylogenomic databases

eggNOGiKOG0639 Eukaryota
ENOG410XPX3 LUCA
GeneTreeiENSGT00550000074465
HOGENOMiHOG000293211
HOVERGENiHBG004689
InParanoidiQ62440

Family and domain databases

Gene3Di2.130.10.10, 1 hit
InterProiView protein in InterPro
IPR005617 Groucho/TLE_N
IPR009146 Groucho_enhance
IPR015943 WD40/YVTN_repeat-like_dom_sf
IPR001680 WD40_repeat
IPR019775 WD40_repeat_CS
IPR017986 WD40_repeat_dom
IPR036322 WD40_repeat_dom_sf
PfamiView protein in Pfam
PF03920 TLE_N, 1 hit
PF00400 WD40, 2 hits
PRINTSiPR01850 GROUCHOFAMLY
SMARTiView protein in SMART
SM00320 WD40, 7 hits
SUPFAMiSSF50978 SSF50978, 1 hit
PROSITEiView protein in PROSITE
PS00678 WD_REPEATS_1, 2 hits
PS50082 WD_REPEATS_2, 2 hits
PS50294 WD_REPEATS_REGION, 2 hits

Sequences (8)i

Sequence statusi: Complete.

This entry describes 8 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q62440-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MFPQSRHPTP HQAAGQPFKF TIPESLDRIK EEFQFLQAQY HSLKLECEKL
60 70 80 90 100
ASEKTEMQRH YVMYYEMSYG LNIEMHKQTE IAKRLNTICA QVIPFLSQEH
110 120 130 140 150
QQQVAQAVER AKQVTMAELN AIIGQQQLQA QHLSHGHGPP VPLTPHPSGL
160 170 180 190 200
QPPGIPPLGG SASLLALSSA LSGQSHLAIK DDKKHHDAER HRDRESGTSN
210 220 230 240 250
SLLVPDSLRS TDKRRNGPEF SSDIKKRKVD DKDNYDSDGD KSDDNLVVDV
260 270 280 290 300
SNEDPSSPHA SPTHSPRENG IDKNRLLKKD ASGSPASTAS SGSSSSLKSK
310 320 330 340 350
EVSLHEKANT PVLKSSTPTP RSDMPTPGTS ATPGLRPGLG KPPAMEPLVN
360 370 380 390 400
QAAAGLRTPL AVPGPYPAPF GMVPHAGMNG ELTSPGAAYA GLHSMSPQMS
410 420 430 440 450
AAAAAAAAAV VAYGRSPMVG FDPPPHMRVP SIPPNLAGIP GGKPAYSFHV
460 470 480 490 500
TADGQMQPVP FPPDALIGPG IPRHARQINT LNHGEVVCAV TISNPTRHVY
510 520 530 540 550
TGGKGCVKVW DISHPGNKSP VSQLDCLNRD NYIRSCKLLP DGCTLIVGGE
560 570 580 590 600
ASTLSIWDLA APTPRIKAEL TSSAPACYAL AISPDSKVCF SCCSDGNIAV
610 620 630 640 650
WDLHNQTLVR QFQGHTDGAS CIDISNDGTK LWTGGLDNTV RSWDLREGRQ
660 670 680 690 700
LQQHDFTSQI FSLGYCPTGE WLAVGMESSN VEVLHVNKPD KYQLHLHESC
710 720 730 740 750
VLSLKFAYCG KWFVSTGKDN LLNAWRTPYG ASIFQSKESS SVLSCDISVD
760 770
DKYIVTGSGD KKATVYEVIY
Length:770
Mass (Da):83,097
Last modified:March 25, 2003 - v2
Checksum:i65803C8F39BB0703
GO
Isoform 2 (identifier: Q62440-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     125-198: Missing.

Show »
Length:696
Mass (Da):75,331
Checksum:i93CA5C16F44EEAA0
GO
Isoform 3 (identifier: Q62440-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     79-198: Missing.

Show »
Length:650
Mass (Da):70,258
Checksum:i5FCC67C8B92929C1
GO
Isoform 4 (identifier: Q62440-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     125-198: Missing.
     477-658: Missing.

Show »
Length:514
Mass (Da):55,619
Checksum:i7C36084BE935D848
GO
Isoform 5 (identifier: Q62440-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-41: MFPQSRHPTPHQAAGQPFKFTIPESLDRIKEEFQFLQAQYH → MFTLSCLFCFP

Show »
Length:740
Mass (Da):79,521
Checksum:iE18B2A843F1F8FE9
GO
Isoform 6 (identifier: Q62440-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     649-653: RQLQQ → NKSYQ
     654-770: Missing.

Show »
Length:653
Mass (Da):70,000
Checksum:i7B72A99D3AFD5716
GO
Isoform 7 (identifier: Q62440-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     193-200: DRESGTSN → GERPGKPD
     201-770: Missing.

Show »
Length:200
Mass (Da):22,439
Checksum:i5DAC9D0AF949D0D7
GO
Isoform 8 (identifier: Q62440-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     127-127: Missing.
     193-200: DRESGTSN → GERPGKPD
     201-770: Missing.

Show »
Length:199
Mass (Da):22,310
Checksum:iE5F799939675DE4C
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti48E → G in AAN77514 (PubMed:12359720).Curated1
Sequence conflicti92V → D in AAB49934 (PubMed:8892234).Curated1
Sequence conflicti122I → T in AAN77518 (PubMed:12359720).Curated1
Sequence conflicti163S → G in AAB49934 (PubMed:8892234).Curated1
Sequence conflicti196S → P (PubMed:8892234).Curated1
Sequence conflicti196S → P in AAN77514 (PubMed:12359720).Curated1
Sequence conflicti196S → P in AAN77518 (PubMed:12359720).Curated1
Sequence conflicti196S → P in BAC35221 (PubMed:16141072).Curated1
Sequence conflicti210S → G (PubMed:8892234).Curated1
Sequence conflicti210S → G in AAN77519 (PubMed:12359720).Curated1
Sequence conflicti210S → G in BAC35221 (PubMed:16141072).Curated1
Sequence conflicti210S → G in BAC38509 (PubMed:16141072).Curated1
Sequence conflicti247V → I in AAN77514 (PubMed:12359720).Curated1
Sequence conflicti258P → S in AAN77514 (PubMed:12359720).Curated1
Sequence conflicti258P → S in AAN77518 (PubMed:12359720).Curated1
Sequence conflicti428R → S in AAN77518 (PubMed:12359720).Curated1
Sequence conflicti464 – 465DA → MP in AAB49934 (PubMed:8892234).Curated2
Sequence conflicti471I → F in AAB49934 (PubMed:8892234).Curated1
Sequence conflicti535S → T in AAB49934 (PubMed:8892234).Curated1
Sequence conflicti542G → D in AAB49934 (PubMed:8892234).Curated1
Sequence conflicti551A → T in AAN77517 (PubMed:12359720).Curated1
Sequence conflicti612F → Y in BAC35221 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0069871 – 41MFPQS…QAQYH → MFTLSCLFCFP in isoform 5. 1 PublicationAdd BLAST41
Alternative sequenceiVSP_00698879 – 198Missing in isoform 3. 1 PublicationAdd BLAST120
Alternative sequenceiVSP_006989125 – 198Missing in isoform 2 and isoform 4. 1 PublicationAdd BLAST74
Alternative sequenceiVSP_006990127Missing in isoform 8. 1 Publication1
Alternative sequenceiVSP_006992193 – 200DRESGTSN → GERPGKPD in isoform 7 and isoform 8. 2 Publications8
Alternative sequenceiVSP_006993201 – 770Missing in isoform 7 and isoform 8. 2 PublicationsAdd BLAST570
Alternative sequenceiVSP_006991477 – 658Missing in isoform 4. CuratedAdd BLAST182
Alternative sequenceiVSP_006994649 – 653RQLQQ → NKSYQ in isoform 6. 1 Publication5
Alternative sequenceiVSP_006995654 – 770Missing in isoform 6. 1 PublicationAdd BLAST117

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U61362 mRNA Translation: AAB49934.1
AY155195 mRNA Translation: AAN77514.1
AY155196 mRNA Translation: AAN77515.1
AY155197 mRNA Translation: AAN77516.1
AY155198 mRNA Translation: AAN77517.1
AY155199 mRNA Translation: AAN77518.1
AY155200 mRNA Translation: AAN77519.1
AK046402 mRNA Translation: BAC32708.1
AK052961 mRNA Translation: BAC35221.1
AK076750 mRNA Translation: BAC36464.1
AK082499 mRNA Translation: BAC38509.1
AL773513 Genomic DNA No translation available.
CCDSiCCDS18274.1 [Q62440-1]
CCDS71407.1 [Q62440-7]
RefSeqiNP_001272459.1, NM_001285530.1
NP_001272460.1, NM_001285531.1 [Q62440-7]
NP_001272461.1, NM_001285532.1 [Q62440-8]
NP_035729.3, NM_011599.5
UniGeneiMm.278444
Mm.388819
Mm.399716

Genome annotation databases

EnsembliENSMUST00000107337; ENSMUSP00000102960; ENSMUSG00000008305 [Q62440-7]
GeneIDi21885
KEGGimmu:21885
UCSCiuc008tic.2 mouse [Q62440-1]
uc008tii.3 mouse [Q62440-2]
uc008tij.3 mouse [Q62440-7]
uc008tik.3 mouse [Q62440-8]
uc012dgd.2 mouse [Q62440-3]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiTLE1_MOUSE
AccessioniPrimary (citable) accession number: Q62440
Secondary accession number(s): Q5SQA8
Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 15, 1998
Last sequence update: March 25, 2003
Last modified: May 23, 2018
This is version 169 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Cookie policy

We would like to use anonymized google analytics cookies to gather statistics on how uniprot.org is used in aggregate. Learn more

UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health