Reviewed,
UniProtKB/Swiss-Prot Q62393 (TPD52_MOUSE)
Last modified
November 24, 2009.
Version 68.
History...
Clusters with 100%,
90%,
50% identity |
Documents (2) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Tumor protein D52 Short name=mD52 | ||
| Gene names |
| ||
| Organism | Mus musculus (Mouse) | ||
| Taxonomic identifier | 10090 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus |
Protein attributes
| Sequence length | 224 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Subunit structure | Forms homodimer or heterodimer with other members of the family By similarity. |
| Tissue specificity | Isoform 2 is expressed at higher levels in kidney and brain than in liver, lung, testis and heart. Within the brain, isoform 2 is highly expressed in the granular layer of the cerebellum, the cortex and the hippocampus. In embryos, isoform 2 is expressed in the epithelium of the developing intestine, stomach, olfactory epithelium, neuronal layers of the retina, salivary gland, kidney and dorsal root ganglion. Ref.7 |
| Sequence similarities | Belongs to the TPD52 family. |
Ontologies
| Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing |
| Domain | Coiled coil |
| PTM | Phosphoprotein |
| Technical term | Direct protein sequencing |
| Gene Ontology (GO) | |
| Biological process | B cell differentiation Inferred from sequence or structural similarity. Source: UniProtKB |
| Cellular component | endoplasmic reticulum Inferred from sequence or structural similarity. Source: UniProtKB perinuclear region of cytoplasmInferred from sequence or structural similarity. Source: UniProtKB |
| Molecular function | calcium ion binding Inferred from sequence or structural similarity. Source: UniProtKB protein heterodimerization activityInferred from direct assay. Source: UniProtKB protein homodimerization activityInferred from direct assay. Source: UniProtKB |
| Complete GO annotation... | |
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| itself | 1 | EBI-782591,EBI-782591 | ||
| TPD52 | P55327 | 1 | EBI-782591,EBI-782581 | From a different organism. |
| TPD52L2 | O43399-2 | 1 | EBI-782591,EBI-782616 | From a different organism. |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q62393-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q62393-2) The sequence of this isoform differs from the canonical sequence as follows: 1-45: MECRDMELADDYQSPFDFDSGVNKNYLYLSPSGNTSPPGSPTQNV → MDRGEQ | ||||||
| Isoform 3 (identifier: Q62393-3) The sequence of this isoform differs from the canonical sequence as follows: 1-45: MECRDMELADDYQSPFDFDSGVNKNYLYLSPSGNTSPPGSPTQNV → MDRGEQ 168-168: K → NIRSIQHSISMPAMR | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 224 | 224 | Tumor protein D52 | PRO_0000185739 | |||||
Regions | |||||||||
| Coiled coil | 61 – 113 | 53 | Potential | ||||||
Amino acid modifications | |||||||||
| Modified residue | 170 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 172 | 1 | Phosphothreonine By similarity | ||||||
| Modified residue | 175 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 223 | 1 | Phosphoserine By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 45 | 45 | MECRD…PTQNV → MDRGEQ in isoform 2 and isoform 3. | VSP_037379 | |||||
| Alternative sequence | 168 | 1 | K → NIRSIQHSISMPAMR in isoform 3. | VSP_037380 | |||||
Experimental info | |||||||||
| Sequence conflict | 129 | 1 | V → L in AAH04068. Ref.5 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Definition of the tumor protein D52 (TPD52) gene family through cloning of D52 homologues in human (hD53) and mouse (mD52)." Byrne J.A., Mattei M.-G., Basset P. Genomics 35:523-532(1996) [PubMed: 8812487] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2). Tissue: Mammary gland. |
| [2] | "Cloning and characterization of PC-1 homolog in Mouse (mPC-1)." Zhou J.-G., Huang C.-F. Submitted (JUL-2001) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [3] | "The transcriptional landscape of the mammalian genome." Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. Hayashizaki Y.Science 309:1559-1563(2005) [PubMed: 16141072] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3). Strain: C57BL/6J and NOD. Tissue: Amnion, Bone marrow macrophage, Dendritic cell, Medulla oblongata, Placenta and Thymus. |
| [4] | Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C. Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Strain: Czech II and FVB/N. Tissue: Mammary gland. |
| [6] | Lubec G., Sunyer B., Chen W.-Q. Submitted (JAN-2009) to UniProtKB Cited for: PROTEIN SEQUENCE OF 110-123, MASS SPECTROMETRY. Strain: OF1. Tissue: Hippocampus. |
| [7] | "Isolation and characterization of a novel gene expressed in multiple cancers." Chen S.-L., Maroulakou I.G., Green J.E., Romano-Spica V., Modi W., Lautenberger J., Bhat N.K. Oncogene 12:741-751(1996) [PubMed: 8632896] [Abstract] Cited for: TISSUE SPECIFICITY. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| U44426 mRNA. Translation: AAB40897.1. AY048852 mRNA. Translation: AAL05266.1. AK005456 mRNA. Translation: BAB24048.1. AK032111 mRNA. Translation: BAC27709.1. AK151471 mRNA. Translation: BAE30428.1. AK151744 mRNA. Translation: BAE30655.1. AK152543 mRNA. Translation: BAE31298.1. AK153266 mRNA. Translation: BAE31856.1. AK153292 mRNA. Translation: BAE31875.1. AK161753 mRNA. Translation: BAE36558.1. AK168379 mRNA. Translation: BAE40308.1. AK168817 mRNA. Translation: BAE40644.1. AK169751 mRNA. Translation: BAE41345.1. AK170725 mRNA. Translation: BAE41982.1. AK171050 mRNA. Translation: BAE42212.1. CH466577 Genomic DNA. Translation: EDL05193.1. BC002036 mRNA. Translation: AAH02036.1. BC004068 mRNA. Translation: AAH04068.1. BC094018 mRNA. Translation: AAH94018.1. | |
| IPI | IPI00408626. IPI00473743. IPI00622833. |
| RefSeq | NP_001020432.1. NP_001020433.1. NP_001020434.1. NP_001020435.1. NP_033438.1. |
| UniGene | Mm.371590 |
3D structure databases | |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q62393. 6 interactions. |
| STRING | Q62393. |
PTM databases | |
| PhosphoSite | Q62393. |
Proteomic databases | |
| PRIDE | Q62393. |
Genome annotation databases | |
| Ensembl | ENSMUST00000094381; ENSMUSP00000091943; ENSMUSG00000027506; Mus musculus. [Genome view] |
| GeneID | 21985. |
| KEGG | mmu:21985. |
| UCSC | uc008oov.1. mouse. |
Organism-specific databases | |
| CTD | 21985. |
| MGI | MGI:107749. Tpd52. |
Phylogenomic databases | |
| HOVERGEN | Q62393. |
| OrthoDB | EOG9J13TJ. |
Gene expression databases | |
| ArrayExpress | Q62393. |
| Bgee | Q62393. |
| CleanEx | MM_TPD52. |
| Genevestigator | Q62393. |
| GermOnline | ENSMUSG00000027506. Mus musculus. |
Family and domain databases | |
| InterPro | IPR007327. TPD52. [Graphical view] |
| PANTHER | PTHR19307. TPD52. 1 hit. |
| Pfam | PF04201. TPD52. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| NextBio | 301708. |
| SOURCE | Search... |
Entry information
| Entry name | TPD52_MOUSE | ||||||||
| Accession | Primary (citable) accession number: Q62393 Secondary accession number(s): Q545M5 Q99KP8 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with


