Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Tumor protein D52

Gene

Tpd52

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

GO - Molecular functioni

  • calcium ion binding Source: UniProtKB
  • protein heterodimerization activity Source: UniProtKB
  • protein homodimerization activity Source: UniProtKB

GO - Biological processi

  • B cell differentiation Source: UniProtKB
  • positive regulation of cell proliferation Source: MGI
Complete GO annotation...

Enzyme and pathway databases

ReactomeiR-MMU-432722. Golgi Associated Vesicle Biogenesis.

Names & Taxonomyi

Protein namesi
Recommended name:
Tumor protein D52
Short name:
mD52
Gene namesi
Name:Tpd52
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 3

Organism-specific databases

MGIiMGI:107749. Tpd52.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 224224Tumor protein D52PRO_0000185739Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei35 – 351PhosphothreonineCombined sources
Modified residuei36 – 361PhosphoserineCombined sources
Modified residuei40 – 401PhosphoserineCombined sources
Modified residuei175 – 1751PhosphoserineCombined sources
Modified residuei223 – 2231PhosphoserineBy similarity
Isoform 3 (identifier: Q62393-3)
Modified residuei138 – 1381PhosphoserineCombined sources

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ62393.
MaxQBiQ62393.
PeptideAtlasiQ62393.
PRIDEiQ62393.

PTM databases

iPTMnetiQ62393.
PhosphoSiteiQ62393.

Expressioni

Tissue specificityi

Isoform 2 is expressed at higher levels in kidney and brain than in liver, lung, testis and heart. Within the brain, isoform 2 is highly expressed in the granular layer of the cerebellum, the cortex and the hippocampus. In embryos, isoform 2 is expressed in the epithelium of the developing intestine, stomach, olfactory epithelium, neuronal layers of the retina, salivary gland, kidney and dorsal root ganglion.1 Publication

Gene expression databases

BgeeiQ62393.
CleanExiMM_TPD52.
ExpressionAtlasiQ62393. baseline and differential.
GenevisibleiQ62393. MM.

Interactioni

Subunit structurei

Forms a homodimer or heterodimer with other members of the family.By similarity

Binary interactionsi

WithEntry#Exp.IntActNotes
TPD52P553272EBI-782591,EBI-782581From a different organism.
TPD52L1Q168903EBI-782591,EBI-717470From a different organism.
TPD52L2O43399-22EBI-782591,EBI-782616From a different organism.

GO - Molecular functioni

  • protein heterodimerization activity Source: UniProtKB
  • protein homodimerization activity Source: UniProtKB

Protein-protein interaction databases

BioGridi204287. 4 interactions.
IntActiQ62393. 4 interactions.

Structurei

3D structure databases

ProteinModelPortaliQ62393.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili61 – 11353Sequence analysisAdd
BLAST

Sequence similaritiesi

Belongs to the TPD52 family.Curated

Keywords - Domaini

Coiled coil

Phylogenomic databases

GeneTreeiENSGT00390000015988.
HOGENOMiHOG000231968.
HOVERGENiHBG058643.
InParanoidiQ62393.
OrthoDBiEOG744TBQ.
PhylomeDBiQ62393.

Family and domain databases

InterProiIPR007327. TPD52.
[Graphical view]
PANTHERiPTHR19307. PTHR19307. 1 hit.
PfamiPF04201. TPD52. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q62393-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MECRDMELAD DYQSPFDFDS GVNKNYLYLS PSGNTSPPGS PTQNVGLLKT
60 70 80 90 100
EPVAEEGEDA VTMLSAPEAL TEEEQEELRR ELTKVEEEIQ TLSQVLAAKE
110 120 130 140 150
KHLAELKRKL GISSLQEFKQ NIAKGWQDVT ATNAYKKTSE TLSQAGQKAS
160 170 180 190 200
AAFSSVGSVI TKKLEDVKNS PTFKSFEEKV ENLKSKVGGA KPAGGDFGEV
210 220
LNSTANATST MTTEPPPEQM TESP
Length:224
Mass (Da):24,313
Last modified:May 26, 2009 - v2
Checksum:iC80D8AB9038B0D73
GO
Isoform 2 (identifier: Q62393-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-45: MECRDMELADDYQSPFDFDSGVNKNYLYLSPSGNTSPPGSPTQNV → MDRGEQ

Show »
Length:185
Mass (Da):20,059
Checksum:i345B487842135D33
GO
Isoform 3 (identifier: Q62393-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-45: MECRDMELADDYQSPFDFDSGVNKNYLYLSPSGNTSPPGSPTQNV → MDRGEQ
     168-168: K → NIRSIQHSISMPAMR

Note: No experimental confirmation available.Combined sources
Show »
Length:199
Mass (Da):21,654
Checksum:i7E81DF05305EEB51
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti129 – 1291V → L in AAH04068 (PubMed:15489334).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 4545MECRD…PTQNV → MDRGEQ in isoform 2 and isoform 3. 3 PublicationsVSP_037379Add
BLAST
Alternative sequencei168 – 1681K → NIRSIQHSISMPAMR in isoform 3. 1 PublicationVSP_037380

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U44426 mRNA. Translation: AAB40897.1.
AY048852 mRNA. Translation: AAL05266.1.
AK005456 mRNA. Translation: BAB24048.1.
AK032111 mRNA. Translation: BAC27709.1.
AK151471 mRNA. Translation: BAE30428.1.
AK151744 mRNA. Translation: BAE30655.1.
AK152543 mRNA. Translation: BAE31298.1.
AK153266 mRNA. Translation: BAE31856.1.
AK153292 mRNA. Translation: BAE31875.1.
AK161753 mRNA. Translation: BAE36558.1.
AK168379 mRNA. Translation: BAE40308.1.
AK168817 mRNA. Translation: BAE40644.1.
AK169751 mRNA. Translation: BAE41345.1.
AK170725 mRNA. Translation: BAE41982.1.
AK171050 mRNA. Translation: BAE42212.1.
CH466577 Genomic DNA. Translation: EDL05193.1.
BC002036 mRNA. Translation: AAH02036.1.
BC004068 mRNA. Translation: AAH04068.1.
BC094018 mRNA. Translation: AAH94018.1.
CCDSiCCDS38384.1. [Q62393-3]
CCDS38386.1. [Q62393-1]
CCDS50860.1. [Q62393-2]
RefSeqiNP_001020432.1. NM_001025261.1.
NP_001020433.1. NM_001025262.1. [Q62393-1]
NP_001020434.1. NM_001025263.1. [Q62393-3]
NP_001020435.1. NM_001025264.1.
NP_033438.1. NM_009412.2. [Q62393-2]
UniGeneiMm.371590.

Genome annotation databases

EnsembliENSMUST00000091354; ENSMUSP00000088913; ENSMUSG00000027506. [Q62393-1]
ENSMUST00000091355; ENSMUSP00000088914; ENSMUSG00000027506. [Q62393-3]
ENSMUST00000120143; ENSMUSP00000112830; ENSMUSG00000027506. [Q62393-2]
GeneIDi21985.
KEGGimmu:21985.
UCSCiuc008oos.1. mouse. [Q62393-1]
uc008oot.1. mouse. [Q62393-3]
uc008oov.1. mouse. [Q62393-2]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U44426 mRNA. Translation: AAB40897.1.
AY048852 mRNA. Translation: AAL05266.1.
AK005456 mRNA. Translation: BAB24048.1.
AK032111 mRNA. Translation: BAC27709.1.
AK151471 mRNA. Translation: BAE30428.1.
AK151744 mRNA. Translation: BAE30655.1.
AK152543 mRNA. Translation: BAE31298.1.
AK153266 mRNA. Translation: BAE31856.1.
AK153292 mRNA. Translation: BAE31875.1.
AK161753 mRNA. Translation: BAE36558.1.
AK168379 mRNA. Translation: BAE40308.1.
AK168817 mRNA. Translation: BAE40644.1.
AK169751 mRNA. Translation: BAE41345.1.
AK170725 mRNA. Translation: BAE41982.1.
AK171050 mRNA. Translation: BAE42212.1.
CH466577 Genomic DNA. Translation: EDL05193.1.
BC002036 mRNA. Translation: AAH02036.1.
BC004068 mRNA. Translation: AAH04068.1.
BC094018 mRNA. Translation: AAH94018.1.
CCDSiCCDS38384.1. [Q62393-3]
CCDS38386.1. [Q62393-1]
CCDS50860.1. [Q62393-2]
RefSeqiNP_001020432.1. NM_001025261.1.
NP_001020433.1. NM_001025262.1. [Q62393-1]
NP_001020434.1. NM_001025263.1. [Q62393-3]
NP_001020435.1. NM_001025264.1.
NP_033438.1. NM_009412.2. [Q62393-2]
UniGeneiMm.371590.

3D structure databases

ProteinModelPortaliQ62393.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi204287. 4 interactions.
IntActiQ62393. 4 interactions.

PTM databases

iPTMnetiQ62393.
PhosphoSiteiQ62393.

Proteomic databases

EPDiQ62393.
MaxQBiQ62393.
PeptideAtlasiQ62393.
PRIDEiQ62393.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000091354; ENSMUSP00000088913; ENSMUSG00000027506. [Q62393-1]
ENSMUST00000091355; ENSMUSP00000088914; ENSMUSG00000027506. [Q62393-3]
ENSMUST00000120143; ENSMUSP00000112830; ENSMUSG00000027506. [Q62393-2]
GeneIDi21985.
KEGGimmu:21985.
UCSCiuc008oos.1. mouse. [Q62393-1]
uc008oot.1. mouse. [Q62393-3]
uc008oov.1. mouse. [Q62393-2]

Organism-specific databases

CTDi7163.
MGIiMGI:107749. Tpd52.

Phylogenomic databases

GeneTreeiENSGT00390000015988.
HOGENOMiHOG000231968.
HOVERGENiHBG058643.
InParanoidiQ62393.
OrthoDBiEOG744TBQ.
PhylomeDBiQ62393.

Enzyme and pathway databases

ReactomeiR-MMU-432722. Golgi Associated Vesicle Biogenesis.

Miscellaneous databases

PROiQ62393.
SOURCEiSearch...

Gene expression databases

BgeeiQ62393.
CleanExiMM_TPD52.
ExpressionAtlasiQ62393. baseline and differential.
GenevisibleiQ62393. MM.

Family and domain databases

InterProiIPR007327. TPD52.
[Graphical view]
PANTHERiPTHR19307. PTHR19307. 1 hit.
PfamiPF04201. TPD52. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Definition of the tumor protein D52 (TPD52) gene family through cloning of D52 homologues in human (hD53) and mouse (mD52)."
    Byrne J.A., Mattei M.-G., Basset P.
    Genomics 35:523-532(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
    Tissue: Mammary gland.
  2. "Cloning and characterization of PC-1 homolog in Mouse (mPC-1)."
    Zhou J.-G., Huang C.-F.
    Submitted (JUL-2001) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  3. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3).
    Strain: C57BL/6J and NOD.
    Tissue: Amnion, Bone marrow macrophage, Dendritic cell, Medulla oblongata, Placenta and Thymus.
  4. Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.
    Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Strain: Czech II and FVB/N.
    Tissue: Mammary gland.
  6. Lubec G., Sunyer B., Chen W.-Q.
    Submitted (JAN-2009) to UniProtKB
    Cited for: PROTEIN SEQUENCE OF 110-123, IDENTIFICATION BY MASS SPECTROMETRY.
    Strain: OF1.
    Tissue: Hippocampus.
  7. "Isolation and characterization of a novel gene expressed in multiple cancers."
    Chen S.-L., Maroulakou I.G., Green J.E., Romano-Spica V., Modi W., Lautenberger J., Bhat N.K.
    Oncogene 12:741-751(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: TISSUE SPECIFICITY.
  8. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-35; SER-36; SER-40 AND SER-175, PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-138 (ISOFORM 3), IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Brain, Brown adipose tissue, Heart, Kidney, Liver, Lung, Pancreas, Spleen and Testis.

Entry informationi

Entry nameiTPD52_MOUSE
AccessioniPrimary (citable) accession number: Q62393
Secondary accession number(s): Q545M5
, Q8CCU1, Q8K564, Q99KP8
Entry historyi
Integrated into UniProtKB/Swiss-Prot: January 24, 2001
Last sequence update: May 26, 2009
Last modified: July 6, 2016
This is version 115 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.