Q62108 (DLG4_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 3, 2013.
Version 135.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Disks large homolog 4 Alternative name(s): Postsynaptic density protein 95 Short name=PSD-95 Synapse-associated protein 90 Short name=SAP-90 Short name=SAP90 | ||||
| Gene names |
| ||||
| Organism | Mus musculus (Mouse) [Reference proteome] | ||||
| Taxonomic identifier | 10090 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus![]() |
Protein attributes
| Sequence length | 724 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Interacts with the cytoplasmic tail of NMDA receptor subunits and shaker-type potassium channels. Required for synaptic plasticity associated with NMDA receptor signaling. Overexpression or depletion of DLG4 changes the ratio of excitatory to inhibitory synapses in hippocampal neurons. May reduce the amplitude of ASIC3 acid-evoked currents by retaining the channel intracellularly. May regulate the intracellular trafficking of ADR1B. Ref.4 Ref.7 |
| Subunit structure | Interacts through its PDZ domains with NETO1. Interacts through its first two PDZ domains with GRIN2A, GRIN2B, GRIN2C, GRIN2D, ASIC3, certain splice forms of GRIN1, KCND2, CXADR, SYNGAP1, KCNA1, KCNA2, KCNA3, KCNA4 and ERBB4. Interacts through its first PDZ domain with GRIK2, KCNA4 and CRIPT. Interacts through its second PDZ domain with the PDZ domain of NOS1 or the C-terminus of CAPON. Interacts through its third PDZ domain with NLGN1 and CRIPT, and probably with NLGN2 and NLGN3. Interacts through its guanylate kinase-like domain with DLGAP1/GKAP, DLGAP2, DLGAP3, DLGAP4, MAP1A, BEGAIN and KIF13B. Isoform 2 interacts through an L27 domain with HGS/HRS and the first L27 domain of CASK. Interacts with ANKS1B and PRR7 By similarity. Interacts with ADR1B. May interact with HTR2A. Interacts with ADAM22, KLHL17 and LGI1 By similarity. Interacts with ANO2 through its PDZ domains. Interacts with FRMPD4 (via C-terminus). Interacts (via guanylate kinase-like domain) with SIPA1L1 By similarity. Interacts (via PDZ1 and PDZ2 domains) with LRRC4; LRRC4B and SEMA4C. Interacts with LRFN1, LRFN2 and LRFN4, but not with LRFN3 nor LRFN5. Ref.5 Ref.6 Ref.7 Ref.9 Ref.11 Ref.14 Ref.15 |
| Subcellular location | Cell membrane; Peripheral membrane protein By similarity. Cell junction › synapse › postsynaptic cell membrane › postsynaptic density By similarity. Cell junction › synapse By similarity. Cell junction › synapse › synaptosome By similarity. Note: Membrane-associated. High levels in postsynaptic density of neurons in the forebrain. Also in presynaptic region of inhibitory synapses formed by cerebellar basket cells on axon hillocks of Purkinje cells By similarity. |
| Domain | The PDZ domain 3 mediates interaction with ADR1B. Ref.7 The L27 domain near the N-terminus of isoform 2 is required for HGS/HRS-dependent targeting to postsynaptic density By similarity. Ref.7 |
| Post-translational modification | Palmitoylation of isoform 1 is required for targeting to postsynaptic density By similarity. |
| Miscellaneous | Mice with a stop codon in the third PDZ domain have impaired spatial learning. NMDA-mediated synaptic plasticity is lost even though receptor levels and localization are unchanged. Long-term potentiation of synaptic transmission is enhanced due to minimal long-term depression. |
| Sequence similarities | Belongs to the MAGUK family. Contains 1 guanylate kinase-like domain. Contains 3 PDZ (DHR) domains. Contains 1 SH3 domain. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| Ablim1 | Q8K4G5 | 4 | EBI-300895,EBI-2307994 | |
| Arc | Q9WV31 | 3 | EBI-300895,EBI-397779 | |
| Baiap2 | Q8BKX1 | 3 | EBI-300895,EBI-771498 | |
| Camk2a | P11798 | 3 | EBI-300895,EBI-400384 | |
| Dlg1 | Q811D0 | 3 | EBI-300895,EBI-514290 | |
| Dlg2 | Q91XM9 | 5 | EBI-300895,EBI-400138 | |
| Dlg3 | P70175 | 3 | EBI-300895,EBI-396969 | |
| Gda | Q9R111 | 5 | EBI-300895,EBI-2308876 | |
| Grin1 | P35438 | 8 | EBI-300895,EBI-400084 | |
| Grin2a | P35436 | 6 | EBI-300895,EBI-400115 | |
| Grin2b | Q01097 | 12 | EBI-300895,EBI-400125 | |
| Lrfn2 | Q80TG9 | 2 | EBI-300895,EBI-877092 | |
| Lrp1 | Q91ZX7 | 3 | EBI-300895,EBI-300955 | |
| Lrp2 | A2ARV4 | 2 | EBI-300895,EBI-300875 | |
| Lrp8 | Q924X6 | 3 | EBI-300895,EBI-432319 | |
| Mapk1 | P63085 | 3 | EBI-300895,EBI-397697 | |
| Nsf | P46460 | 4 | EBI-300895,EBI-398006 | |
| Rac1 | P63001 | 2 | EBI-300895,EBI-413646 |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q62108-1) Also known as: PSD95-alpha; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q62108-2) Also known as: PSD95-beta; The sequence of this isoform differs from the canonical sequence as follows: 1-10: MDCLCIVTTK → MSQRPRAPRSALWLLAPPLLRWAPPLLTVLHSDLFQALLDILDYYEACISESQ | ||||||
| Isoform 3 (identifier: Q62108-3) The sequence of this isoform differs from the canonical sequence as follows: 51-53: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 724 | 724 | Disks large homolog 4 | PRO_0000094561 | |||||
Regions | |||||||||
| Domain | 65 – 151 | 87 | PDZ 1 | ||||||
| Domain | 160 – 246 | 87 | PDZ 2 | ||||||
| Domain | 313 – 393 | 81 | PDZ 3 | ||||||
| Domain | 428 – 498 | 71 | SH3 | ||||||
| Domain | 534 – 709 | 176 | Guanylate kinase-like | ||||||
Amino acid modifications | |||||||||
| Modified residue | 142 | 1 | Phosphoserine Ref.10 | ||||||
| Modified residue | 240 | 1 | Phosphotyrosine Ref.10 Ref.12 Ref.13 | ||||||
| Modified residue | 295 | 1 | Phosphoserine Ref.10 | ||||||
| Modified residue | 397 | 1 | Phosphotyrosine Ref.12 | ||||||
| Modified residue | 415 | 1 | Phosphoserine Ref.8 Ref.13 | ||||||
| Modified residue | 418 | 1 | Phosphoserine Ref.8 Ref.13 | ||||||
| Modified residue | 432 | 1 | Phosphotyrosine Ref.8 | ||||||
| Modified residue | 580 | 1 | Phosphotyrosine Ref.12 | ||||||
| Modified residue | 604 | 1 | Phosphotyrosine Ref.12 | ||||||
| Modified residue | 715 | 1 | Phosphotyrosine Ref.12 | ||||||
| Lipidation | 3 | 1 | S-palmitoyl cysteine By similarity | ||||||
| Lipidation | 5 | 1 | S-palmitoyl cysteine By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 10 | 10 | MDCLCIVTTK → MSQRPRAPRSALWLLAPPLL RWAPPLLTVLHSDLFQALLD ILDYYEACISESQ in isoform 2. | VSP_014930 | |||||
| Alternative sequence | 51 – 53 | 3 | Missing in isoform 3. | VSP_014931 | |||||
Experimental info | |||||||||
| Sequence conflict | 203 | 1 | D → E in AAH14807. Ref.3 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Mouse homologue of rat PSD-95/SAP90A." Kohmura N., Yagi T. Submitted (MAY-1995) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Strain: DBA/2. Tissue: Brain. |
| [2] | "Lineage-specific biology revealed by a finished genome assembly of the mouse." Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S., She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W., Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T., Zhou S. Ponting C.P.PLoS Biol. 7:E1000112-E1000112(2009) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. Strain: C57BL/6J. |
| [3] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3). Strain: C57BL/6. Tissue: Retina. |
| [4] | "Enhanced long-term potentiation and impaired learning in mice with mutant postsynaptic density-95 protein." Migaud M., Charlesworth P., Dempster M., Webster L.C., Watabe A.M., Makhinson M., He Y., Ramsay M.F., Morris R.G.M., Morrison J.H., O'Dell T.J., Grant S.G.N. Nature 396:433-439(1998) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, NULL MUTANT. |
| [5] | "Sema4c, a transmembrane semaphorin, interacts with a post-synaptic density protein, PSD-95." Inagaki S., Ohoka Y., Sugimoto H., Fujioka S., Amazaki M., Kurinami H., Miyazaki N., Tohyama M., Furuyama T. J. Biol. Chem. 276:9174-9181(2001) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH SEMA4C. |
| [6] | "The serotonin 5-HT2A and 5-HT2C receptors interact with specific sets of PDZ proteins." Becamel C., Gavarini S., Chanrion B., Alonso G., Galeotti N., Dumuis A., Bockaert J., Marin P. J. Biol. Chem. 279:20257-20266(2004) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH HTR2A. |
| [7] | "Interaction with cystic fibrosis transmembrane conductance regulator-associated ligand (CAL) inhibits beta1-adrenergic receptor surface expression." He J., Bellini M., Xu J., Castleberry A.M., Hall R.A. J. Biol. Chem. 279:50190-50196(2004) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH ADR1B, DOMAIN, FUNCTION. |
| [8] | "Proteomic analysis of in vivo phosphorylated synaptic proteins." Collins M.O., Yu L., Coba M.P., Husi H., Campuzano I., Blackstock W.P., Choudhary J.S., Grant S.G. J. Biol. Chem. 280:5972-5982(2005) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-415; SER-418 AND TYR-432, MASS SPECTROMETRY. Tissue: Forebrain. |
| [9] | "Comparative analysis of structure, expression and PSD95-binding capacity of Lrfn, a novel family of neuronal transmembrane proteins." Morimura N., Inoue T., Katayama K., Aruga J. Gene 380:72-83(2006) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH LRFN1; LRFN2 AND LRFN4. Strain: Swiss Webster. |
| [10] | "Comprehensive identification of phosphorylation sites in postsynaptic density preparations." Trinidad J.C., Specht C.G., Thalhammer A., Schoepfer R., Burlingame A.L. Mol. Cell. Proteomics 5:914-922(2006) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-142; TYR-240 AND SER-295, MASS SPECTROMETRY. Tissue: Brain. |
| [11] | "NGL family PSD-95-interacting adhesion molecules regulate excitatory synapse formation." Kim S., Burette A., Chung H.S., Kwon S.-K., Woo J., Lee H.W., Kim K., Kim H., Weinberg R.J., Kim E. Nat. Neurosci. 9:1294-1301(2006) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH LRRC4B AND LRRC4. |
| [12] | "Large-scale identification and evolution indexing of tyrosine phosphorylation sites from murine brain." Ballif B.A., Carey G.R., Sunyaev S.R., Gygi S.P. J. Proteome Res. 7:311-318(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-240; TYR-397; TYR-580; TYR-604 AND TYR-715, MASS SPECTROMETRY. Tissue: Brain. |
| [13] | "Qualitative and quantitative analyses of protein phosphorylation in naive and stimulated mouse synaptosomal preparations." Munton R.P., Tweedie-Cullen R., Livingstone-Zatchej M., Weinandy F., Waidelich M., Longo D., Gehrig P., Potthast F., Rutishauser D., Gerrits B., Panse C., Schlapbach R., Mansuy I.M. Mol. Cell. Proteomics 6:283-293(2007) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-240; SER-415 AND SER-418, MASS SPECTROMETRY. Tissue: Brain cortex. |
| [14] | "TMEM16B, a novel protein with calcium-dependent chloride channel activity, associates with a presynaptic protein complex in photoreceptor terminals." Stoehr H., Heisig J.B., Benz P.M., Schoeberl S., Milenkovic V.M., Strauss O., Aartsen W.M., Wijnholds J., Weber B.H.F., Schulz H.L. J. Neurosci. 29:6809-6818(2009) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH ANO2. Strain: C57BL/6. Tissue: Retina. |
| [15] | "Neto1 is a novel CUB-domain NMDA receptor-interacting protein required for synaptic plasticity and learning." Ng D., Pitcher G.M., Szilard R.K., Sertie A., Kanisek M., Clapcote S.J., Lipina T., Kalia L.V., Joo D., McKerlie C., Cortez M., Roder J.C., Salter M.W., McInnes R.R. PLoS Biol. 7:E41-E41(2009) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH NETO1. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | D50621 mRNA. Translation: BAA09297.1. AL596185 Genomic DNA. Translation: CAI35168.1. AL596185 Genomic DNA. Translation: CAI35169.1. AL596185 Genomic DNA. Translation: CAI35170.1. BC014807 mRNA. Translation: AAH14807.1. |
| IPI | IPI00122094. IPI00622720. IPI00626797. |
| RefSeq | NP_001103222.1. NM_001109752.1. NP_031890.1. NM_007864.3. |
| UniGene | Mm.27256. |
3D structure databases | |
| ProteinModelPortal | Q62108. |
| SMR | Q62108. Positions 61-724. |
| ModBase | Search... |
Protein-protein interaction databases | |
| DIP | DIP-29888N. |
| IntAct | Q62108. 317 interactions. |
| MINT | MINT-136080. |
PTM databases | |
| PhosphoSite | Q62108. |
Proteomic databases | |
| PaxDb | Q62108. |
| PRIDE | Q62108. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENSMUST00000018700; ENSMUSP00000018700; ENSMUSG00000020886. ENSMUST00000108588; ENSMUSP00000104229; ENSMUSG00000020886. ENSMUST00000108589; ENSMUSP00000104230; ENSMUSG00000020886. |
| GeneID | 13385. |
| KEGG | mmu:13385. |
| UCSC | uc007jtp.2. mouse. uc007jtq.2. mouse. |
Organism-specific databases | |
| CTD | 1742. |
| MGI | MGI:1277959. Dlg4. |
Phylogenomic databases | |
| eggNOG | COG0194. |
| GeneTree | ENSGT00660000095130. |
| HOGENOM | HOG000232102. |
| HOVERGEN | HBG107814. |
| KO | K11828. |
| OMA | WIPTRER. |
Enzyme and pathway databases | |
| Reactome | REACT_127416. Developmental Biology. |
Gene expression databases | |
| ArrayExpress | Q62108. |
| Bgee | Q62108. |
| CleanEx | MM_DLG4. |
| Genevestigator | Q62108. |
| GermOnline | ENSMUSG00000020886. Mus musculus. |
Family and domain databases | |
| InterPro | IPR008144. Guanylate_kin. IPR008145. Guanylate_kin/L-typ_Ca_channel. IPR020590. Guanylate_kinase_CS. IPR016313. M-assoc_guanylate_kinase. IPR019590. MAGUK_PEST_N. IPR001478. PDZ. IPR019583. PDZ_assoc. IPR011511. SH3_2. IPR001452. SH3_domain. [Graphical view] |
| Pfam | PF00625. Guanylate_kin. 1 hit. PF10608. MAGUK_N_PEST. 2 hits. PF00595. PDZ. 3 hits. PF10600. PDZ_assoc. 1 hit. PF07653. SH3_2. 1 hit. [Graphical view] |
| PIRSF | PIRSF001741. MAGUK_DLGH. 1 hit. |
| SMART | SM00072. GuKc. 1 hit. SM00228. PDZ. 3 hits. SM00326. SH3. 1 hit. [Graphical view] |
| SUPFAM | SSF50156. PDZ. 3 hits. SSF50044. SH3. 1 hit. |
| PROSITE | PS00856. GUANYLATE_KINASE_1. 1 hit. PS50052. GUANYLATE_KINASE_2. 1 hit. PS50106. PDZ. 3 hits. PS50002. SH3. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChEMBL | CHEMBL1795134. |
| ChiTaRS | DLG4. mouse. |
| NextBio | 283740. |
| SOURCE | Search... |
Entry information
| Entry name | DLG4_MOUSE | ||||||||
| Accession | Primary (citable) accession number: Q62108 Secondary accession number(s): Q5NCV5 Q91WJ1 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
