Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q62108

- DLG4_MOUSE

UniProt

Q62108 - DLG4_MOUSE

Protein

Disks large homolog 4

Gene

Dlg4

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 151 (01 Oct 2014)
      Sequence version 1 (01 Nov 1997)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Interacts with the cytoplasmic tail of NMDA receptor subunits and shaker-type potassium channels. Required for synaptic plasticity associated with NMDA receptor signaling. Overexpression or depletion of DLG4 changes the ratio of excitatory to inhibitory synapses in hippocampal neurons. May reduce the amplitude of ASIC3 acid-evoked currents by retaining the channel intracellularly. May regulate the intracellular trafficking of ADR1B.2 Publications

    GO - Molecular functioni

    1. acetylcholine receptor binding Source: BHF-UCL
    2. beta-1 adrenergic receptor binding Source: BHF-UCL
    3. D1 dopamine receptor binding Source: BHF-UCL
    4. ionotropic glutamate receptor binding Source: BHF-UCL
    5. neurexin family protein binding Source: UniProtKB
    6. P2Y1 nucleotide receptor binding Source: BHF-UCL
    7. PDZ domain binding Source: BHF-UCL
    8. protein binding Source: UniProtKB
    9. protein complex binding Source: BHF-UCL
    10. protein C-terminus binding Source: BHF-UCL
    11. protein phosphatase binding Source: BHF-UCL
    12. scaffold protein binding Source: BHF-UCL
    13. structural molecule activity Source: UniProtKB

    GO - Biological processi

    1. alpha-amino-3-hydroxy-5-methyl-4-isoxazole propionate selective glutamate receptor clustering Source: BHF-UCL
    2. dendritic spine morphogenesis Source: BHF-UCL
    3. establishment of protein localization Source: BHF-UCL
    4. locomotory behavior Source: UniProtKB
    5. locomotory exploration behavior Source: BHF-UCL
    6. negative regulation of receptor internalization Source: BHF-UCL
    7. neuromuscular process controlling balance Source: BHF-UCL
    8. positive regulation of cytosolic calcium ion concentration Source: BHF-UCL
    9. positive regulation of excitatory postsynaptic membrane potential Source: BHF-UCL
    10. positive regulation of synaptic transmission Source: BHF-UCL
    11. protein complex assembly Source: BHF-UCL
    12. protein localization to synapse Source: BHF-UCL
    13. receptor localization to synapse Source: BHF-UCL
    14. regulation of grooming behavior Source: BHF-UCL
    15. regulation of long-term neuronal synaptic plasticity Source: MGI
    16. regulation of neuronal synaptic plasticity Source: UniProtKB
    17. regulation of N-methyl-D-aspartate selective glutamate receptor activity Source: BHF-UCL
    18. response to cocaine Source: UniProtKB
    19. social behavior Source: BHF-UCL
    20. synaptic vesicle maturation Source: MGI
    21. vocalization behavior Source: BHF-UCL

    Enzyme and pathway databases

    ReactomeiREACT_198244. Ras activation uopn Ca2+ infux through NMDA receptor.
    REACT_198248. CREB phosphorylation through the activation of CaMKII.
    REACT_198694. Activation of Ca-permeable Kainate Receptor.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Disks large homolog 4
    Alternative name(s):
    Postsynaptic density protein 95
    Short name:
    PSD-95
    Synapse-associated protein 90
    Short name:
    SAP-90
    Short name:
    SAP90
    Gene namesi
    Name:Dlg4
    Synonyms:Dlgh4, Psd95
    OrganismiMus musculus (Mouse)
    Taxonomic identifieri10090 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
    ProteomesiUP000000589: Chromosome 11

    Organism-specific databases

    MGIiMGI:1277959. Dlg4.

    Subcellular locationi

    Cell membrane By similarity; Peripheral membrane protein By similarity. Cell junctionsynapsepostsynaptic cell membranepostsynaptic density By similarity. Cell junctionsynapse 1 Publication
    Note: Membrane-associated. High levels in postsynaptic density of neurons in the forebrain. Also in presynaptic region of inhibitory synapses formed by cerebellar basket cells on axon hillocks of Purkinje cells By similarity.By similarity

    GO - Cellular componenti

    1. alpha-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid selective glutamate receptor complex Source: MGI
    2. cell junction Source: MGI
    3. cerebellar mossy fiber Source: MGI
    4. cortical cytoskeleton Source: Ensembl
    5. cytoplasm Source: MGI
    6. dendrite Source: MGI
    7. dendrite cytoplasm Source: BHF-UCL
    8. dendritic spine Source: ParkinsonsUK-UCL
    9. endoplasmic reticulum Source: MGI
    10. excitatory synapse Source: BHF-UCL
    11. extrinsic component of cytoplasmic side of plasma membrane Source: MGI
    12. juxtaparanode region of axon Source: MGI
    13. membrane Source: MGI
    14. neuronal postsynaptic density Source: BHF-UCL
    15. neuron projection terminus Source: MGI
    16. neuron spine Source: BHF-UCL
    17. plasma membrane Source: MGI
    18. postsynaptic density Source: UniProtKB
    19. postsynaptic membrane Source: UniProtKB-KW
    20. synapse Source: MGI
    21. synaptic vesicle Source: MGI

    Keywords - Cellular componenti

    Cell junction, Cell membrane, Membrane, Postsynaptic cell membrane, Synapse

    Pathology & Biotechi

    Disruption phenotypei

    Mice with a stop codon in the third PDZ domain have impaired spatial learning. NMDA-mediated synaptic plasticity is lost even though receptor levels and localization are unchanged. Long-term potentiation of synaptic transmission is enhanced due to minimal long-term depression.1 Publication

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 724724Disks large homolog 4PRO_0000094561Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Lipidationi3 – 31S-palmitoyl cysteineBy similarity
    Lipidationi5 – 51S-palmitoyl cysteineBy similarity
    Modified residuei142 – 1421Phosphoserine1 Publication
    Modified residuei240 – 2401Phosphotyrosine1 Publication
    Modified residuei580 – 5801Phosphotyrosine1 Publication
    Modified residuei715 – 7151Phosphotyrosine1 Publication

    Post-translational modificationi

    Palmitoylation of isoform 1 is required for targeting to postsynaptic density.By similarity

    Keywords - PTMi

    Lipoprotein, Palmitate, Phosphoprotein

    Proteomic databases

    MaxQBiQ62108.
    PaxDbiQ62108.
    PRIDEiQ62108.

    PTM databases

    PhosphoSiteiQ62108.

    Expressioni

    Gene expression databases

    ArrayExpressiQ62108.
    BgeeiQ62108.
    CleanExiMM_DLG4.
    GenevestigatoriQ62108.

    Interactioni

    Subunit structurei

    Interacts through its PDZ domains with ANO2 and NETO1. Interacts through its first two PDZ domains with GRIN2A, GRIN2B, GRIN2C, GRIN2D, ASIC3, certain splice forms of GRIN1, KCND2, CXADR, SYNGAP1, KCNA1, KCNA2, KCNA3, KCNA4, ERBB4, LRRC4; LRRC4B and SEMA4C. Interacts through its first PDZ domain with GRIK2, KCNA4 and CRIPT. Interacts through its second PDZ domain with the PDZ domain of NOS1 or the C-terminus of CAPON. Interacts through its third PDZ domain with NLGN1 and CRIPT, and probably with NLGN2 and NLGN3. Interacts through its guanylate kinase-like domain with DLGAP1/GKAP, DLGAP2, DLGAP3, DLGAP4, MAP1A, BEGAIN, SIPA1L1 and KIF13B. Isoform 2 interacts through an L27 domain with HGS/HRS and the first L27 domain of CASK. Interacts with ADR1B, ANKS1B and PRR7. May interact with HTR2A. Interacts with ADAM22, KLHL17 and LGI1. Interacts with FRMPD4 (via C-terminus). Interacts with LRFN1, LRFN2 and LRFN4, but not with LRFN3 nor LRFN5. Interacts (via N-terminal tandem pair of PDZ domains) with GPER1 (via C-terminus tail motif); the interaction is direct and induces the increase of GPER1 protein levels residing at the plasma membrane surface in a estradiol-independent manner. Interacts (via N-terminus tandem pair of PDZ domains) with NOS1 (via N-terminal domain). Interacts with SHANK3. Interacts with KCNJ4.9 Publications

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    Ablim1Q8K4G54EBI-300895,EBI-2307994
    AppP120234EBI-300895,EBI-78814
    ArcQ9WV313EBI-300895,EBI-397779
    Baiap2Q8BKX13EBI-300895,EBI-771498
    Camk2aP117983EBI-300895,EBI-400384
    Dlg1Q811D03EBI-300895,EBI-514290
    Dlg2Q91XM95EBI-300895,EBI-400138
    Dlg3P701753EBI-300895,EBI-396969
    Fzd7Q610904EBI-300895,EBI-8473104
    GdaQ9R1115EBI-300895,EBI-2308876
    Grin1P3543810EBI-300895,EBI-400084
    Grin2aP354367EBI-300895,EBI-400115
    Grin2bQ0109716EBI-300895,EBI-400125
    Gucy1a2Q9WVI43EBI-300895,EBI-7665590From a different organism.
    Lrfn2Q80TG92EBI-300895,EBI-877092
    Lrp1Q91ZX73EBI-300895,EBI-300955
    Lrp2A2ARV42EBI-300895,EBI-300875
    Lrp8Q924X63EBI-300895,EBI-432319
    Mapk1P630853EBI-300895,EBI-397697
    Mdm2P238043EBI-300895,EBI-641788
    NrcamQ810U42EBI-300895,EBI-8321816
    NsfP464604EBI-300895,EBI-398006
    Pcdh10Q80TE24EBI-300895,EBI-6661550
    Rac1P630012EBI-300895,EBI-413646
    Sh3kbp1Q8R5503EBI-300895,EBI-642709
    Sstr1P308733EBI-300895,EBI-7665262
    Sstr4P496603EBI-300895,EBI-7665342

    Protein-protein interaction databases

    BioGridi199230. 299 interactions.
    DIPiDIP-29888N.
    IntActiQ62108. 342 interactions.
    MINTiMINT-136080.

    Structurei

    3D structure databases

    ProteinModelPortaliQ62108.
    SMRiQ62108. Positions 60-724.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini65 – 15187PDZ 1PROSITE-ProRule annotationAdd
    BLAST
    Domaini160 – 24687PDZ 2PROSITE-ProRule annotationAdd
    BLAST
    Domaini313 – 39381PDZ 3PROSITE-ProRule annotationAdd
    BLAST
    Domaini428 – 49871SH3PROSITE-ProRule annotationAdd
    BLAST
    Domaini534 – 709176Guanylate kinase-likePROSITE-ProRule annotationAdd
    BLAST

    Domaini

    The PDZ domain 3 mediates interaction with ADR1B.1 Publication
    The L27 domain near the N-terminus of isoform 2 is required for HGS/HRS-dependent targeting to postsynaptic density.By similarity

    Sequence similaritiesi

    Belongs to the MAGUK family.Curated
    Contains 1 guanylate kinase-like domain.PROSITE-ProRule annotation
    Contains 3 PDZ (DHR) domains.PROSITE-ProRule annotation
    Contains 1 SH3 domain.PROSITE-ProRule annotation

    Keywords - Domaini

    Repeat, SH3 domain

    Phylogenomic databases

    eggNOGiCOG0194.
    GeneTreeiENSGT00660000095130.
    HOGENOMiHOG000232102.
    HOVERGENiHBG107814.
    KOiK11828.
    OMAiWIPTRER.
    OrthoDBiEOG79GT6P.
    PhylomeDBiQ62108.
    TreeFamiTF323171.

    Family and domain databases

    Gene3Di2.30.42.10. 3 hits.
    3.40.50.300. 2 hits.
    InterProiIPR016313. DLG1.
    IPR008145. GK/Ca_channel_bsu.
    IPR008144. Guanylate_kin-like.
    IPR020590. Guanylate_kinase_CS.
    IPR019590. MAGUK_PEST_N.
    IPR027417. P-loop_NTPase.
    IPR001478. PDZ.
    IPR019583. PDZ_assoc.
    IPR011511. SH3_2.
    IPR001452. SH3_domain.
    [Graphical view]
    PANTHERiPTHR23119. PTHR23119. 1 hit.
    PfamiPF00625. Guanylate_kin. 1 hit.
    PF10608. MAGUK_N_PEST. 2 hits.
    PF00595. PDZ. 3 hits.
    PF10600. PDZ_assoc. 1 hit.
    PF07653. SH3_2. 1 hit.
    [Graphical view]
    PIRSFiPIRSF001741. MAGUK_DLGH. 1 hit.
    SMARTiSM00072. GuKc. 1 hit.
    SM00228. PDZ. 3 hits.
    SM00326. SH3. 1 hit.
    [Graphical view]
    SUPFAMiSSF50044. SSF50044. 1 hit.
    SSF50156. SSF50156. 3 hits.
    SSF52540. SSF52540. 1 hit.
    PROSITEiPS00856. GUANYLATE_KINASE_1. 1 hit.
    PS50052. GUANYLATE_KINASE_2. 1 hit.
    PS50106. PDZ. 3 hits.
    PS50002. SH3. 1 hit.
    [Graphical view]

    Sequences (3)i

    Sequence statusi: Complete.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q62108-1) [UniParc]FASTAAdd to Basket

    Also known as: PSD95-alpha

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MDCLCIVTTK KYRYQDEDTP PLEHSPAHLP NQANSPPVIV NTDTLEAPGY    50
    ELQVNGTEGE MEYEEITLER GNSGLGFSIA GGTDNPHIGD DPSIFITKII 100
    PGGAAAQDGR LRVNDSILFV NEVDVREVTH SAAVEALKEA GSIVRLYVMR 150
    RKPPAEKIIE IKLIKGPKGL GFSIAGGVGN QHIPGDNSIY VTKIIEGGAA 200
    HKDGRLQIGD KILAVNSVGL EDVMHEDAVA ALKNTYDVVY LKVAKPSNAY 250
    LSDSYAPPDI TTSYSQHLDN EISHSSYLGT DYPTAMTPTS PRRYSPVAKD 300
    LLGEEDIPRE PRRIVIHRGS TGLGFNIVGG EDGEGIFISF ILAGGPADLS 350
    GELRKGDQIL SVNGVDLRNA SHEQAAIALK NAGQTVTIIA QYKPEEYSRF 400
    EAKIHDLREQ LMNSSLGSGT ASLRSNPKRG FYIRALFDYD KTKDCGFLSQ 450
    ALSFHFGDVL HVIDASDEEW WQARRVHSDS ETDDIGFIPS KRRVERREWS 500
    RLKAKDWGSS SGSQGREDSV LSYETVTQME VHYARPIIIL GPTKDRANDD 550
    LLSEFPDKFG SCVPHTTRPK REYEIDGRDY HFVSSREKME KDIQAHKFIE 600
    AGQYNSHLYG TSVQSVREVA EQGKHCILDV SANAVRRLQA AHLHPIAIFI 650
    RPRSLENVLE INKRITEEQA RKAFDRATKL EQEFTECFSA IVEGDSFEEI 700
    YHKVKRVIED LSGPYIWVPA RERL 724
    Length:724
    Mass (Da):80,472
    Last modified:November 1, 1997 - v1
    Checksum:i7EFFC99E1FFF90BA
    GO
    Isoform 2 (identifier: Q62108-2) [UniParc]FASTAAdd to Basket

    Also known as: PSD95-beta

    The sequence of this isoform differs from the canonical sequence as follows:
         1-10: MDCLCIVTTK → MSQRPRAPRSALWLLAPPLLRWAPPLLTVLHSDLFQALLDILDYYEACISESQ

    Show »
    Length:767
    Mass (Da):85,423
    Checksum:i650F267DF8139740
    GO
    Isoform 3 (identifier: Q62108-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         51-53: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:721
    Mass (Da):80,102
    Checksum:i675C1EBD807CD37C
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti203 – 2031D → E in AAH14807. (PubMed:15489334)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 1010MDCLCIVTTK → MSQRPRAPRSALWLLAPPLL RWAPPLLTVLHSDLFQALLD ILDYYEACISESQ in isoform 2. CuratedVSP_014930
    Alternative sequencei51 – 533Missing in isoform 3. 1 PublicationVSP_014931

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    D50621 mRNA. Translation: BAA09297.1.
    AL596185 Genomic DNA. Translation: CAI35168.1.
    AL596185 Genomic DNA. Translation: CAI35169.1.
    AL596185 Genomic DNA. Translation: CAI35170.1.
    BC014807 mRNA. Translation: AAH14807.1.
    CCDSiCCDS36202.1. [Q62108-1]
    CCDS48829.1. [Q62108-3]
    RefSeqiNP_001103222.1. NM_001109752.1. [Q62108-3]
    NP_031890.1. NM_007864.3. [Q62108-1]
    UniGeneiMm.27256.

    Genome annotation databases

    EnsembliENSMUST00000018700; ENSMUSP00000018700; ENSMUSG00000020886. [Q62108-1]
    ENSMUST00000108588; ENSMUSP00000104229; ENSMUSG00000020886. [Q62108-3]
    ENSMUST00000108589; ENSMUSP00000104230; ENSMUSG00000020886. [Q62108-2]
    GeneIDi13385.
    KEGGimmu:13385.
    UCSCiuc007jtp.2. mouse. [Q62108-1]
    uc007jtq.2. mouse. [Q62108-3]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    D50621 mRNA. Translation: BAA09297.1 .
    AL596185 Genomic DNA. Translation: CAI35168.1 .
    AL596185 Genomic DNA. Translation: CAI35169.1 .
    AL596185 Genomic DNA. Translation: CAI35170.1 .
    BC014807 mRNA. Translation: AAH14807.1 .
    CCDSi CCDS36202.1. [Q62108-1 ]
    CCDS48829.1. [Q62108-3 ]
    RefSeqi NP_001103222.1. NM_001109752.1. [Q62108-3 ]
    NP_031890.1. NM_007864.3. [Q62108-1 ]
    UniGenei Mm.27256.

    3D structure databases

    ProteinModelPortali Q62108.
    SMRi Q62108. Positions 60-724.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 199230. 299 interactions.
    DIPi DIP-29888N.
    IntActi Q62108. 342 interactions.
    MINTi MINT-136080.

    Chemistry

    ChEMBLi CHEMBL1795134.

    PTM databases

    PhosphoSitei Q62108.

    Proteomic databases

    MaxQBi Q62108.
    PaxDbi Q62108.
    PRIDEi Q62108.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENSMUST00000018700 ; ENSMUSP00000018700 ; ENSMUSG00000020886 . [Q62108-1 ]
    ENSMUST00000108588 ; ENSMUSP00000104229 ; ENSMUSG00000020886 . [Q62108-3 ]
    ENSMUST00000108589 ; ENSMUSP00000104230 ; ENSMUSG00000020886 . [Q62108-2 ]
    GeneIDi 13385.
    KEGGi mmu:13385.
    UCSCi uc007jtp.2. mouse. [Q62108-1 ]
    uc007jtq.2. mouse. [Q62108-3 ]

    Organism-specific databases

    CTDi 1742.
    MGIi MGI:1277959. Dlg4.

    Phylogenomic databases

    eggNOGi COG0194.
    GeneTreei ENSGT00660000095130.
    HOGENOMi HOG000232102.
    HOVERGENi HBG107814.
    KOi K11828.
    OMAi WIPTRER.
    OrthoDBi EOG79GT6P.
    PhylomeDBi Q62108.
    TreeFami TF323171.

    Enzyme and pathway databases

    Reactomei REACT_198244. Ras activation uopn Ca2+ infux through NMDA receptor.
    REACT_198248. CREB phosphorylation through the activation of CaMKII.
    REACT_198694. Activation of Ca-permeable Kainate Receptor.

    Miscellaneous databases

    ChiTaRSi DLG4. mouse.
    NextBioi 283740.
    PROi Q62108.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q62108.
    Bgeei Q62108.
    CleanExi MM_DLG4.
    Genevestigatori Q62108.

    Family and domain databases

    Gene3Di 2.30.42.10. 3 hits.
    3.40.50.300. 2 hits.
    InterProi IPR016313. DLG1.
    IPR008145. GK/Ca_channel_bsu.
    IPR008144. Guanylate_kin-like.
    IPR020590. Guanylate_kinase_CS.
    IPR019590. MAGUK_PEST_N.
    IPR027417. P-loop_NTPase.
    IPR001478. PDZ.
    IPR019583. PDZ_assoc.
    IPR011511. SH3_2.
    IPR001452. SH3_domain.
    [Graphical view ]
    PANTHERi PTHR23119. PTHR23119. 1 hit.
    Pfami PF00625. Guanylate_kin. 1 hit.
    PF10608. MAGUK_N_PEST. 2 hits.
    PF00595. PDZ. 3 hits.
    PF10600. PDZ_assoc. 1 hit.
    PF07653. SH3_2. 1 hit.
    [Graphical view ]
    PIRSFi PIRSF001741. MAGUK_DLGH. 1 hit.
    SMARTi SM00072. GuKc. 1 hit.
    SM00228. PDZ. 3 hits.
    SM00326. SH3. 1 hit.
    [Graphical view ]
    SUPFAMi SSF50044. SSF50044. 1 hit.
    SSF50156. SSF50156. 3 hits.
    SSF52540. SSF52540. 1 hit.
    PROSITEi PS00856. GUANYLATE_KINASE_1. 1 hit.
    PS50052. GUANYLATE_KINASE_2. 1 hit.
    PS50106. PDZ. 3 hits.
    PS50002. SH3. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Mouse homologue of rat PSD-95/SAP90A."
      Kohmura N., Yagi T.
      Submitted (MAY-1995) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
      Strain: DBA/2.
      Tissue: Brain.
    2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
      Strain: C57BL/6J.
    3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
      Strain: C57BL/6.
      Tissue: Retina.
    4. "Enhanced long-term potentiation and impaired learning in mice with mutant postsynaptic density-95 protein."
      Migaud M., Charlesworth P., Dempster M., Webster L.C., Watabe A.M., Makhinson M., He Y., Ramsay M.F., Morris R.G.M., Morrison J.H., O'Dell T.J., Grant S.G.N.
      Nature 396:433-439(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, DISRUPTION PHENOTYPE.
    5. "Sema4c, a transmembrane semaphorin, interacts with a post-synaptic density protein, PSD-95."
      Inagaki S., Ohoka Y., Sugimoto H., Fujioka S., Amazaki M., Kurinami H., Miyazaki N., Tohyama M., Furuyama T.
      J. Biol. Chem. 276:9174-9181(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH SEMA4C.
    6. "Inward rectifier K+ channel Kir2.3 is localized at the postsynaptic membrane of excitatory synapses."
      Inanobe A., Fujita A., Ito M., Tomoike H., Inageda K., Kurachi Y.
      Am. J. Physiol. 282:C1396-C1403(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH KCNJ4.
    7. "The serotonin 5-HT2A and 5-HT2C receptors interact with specific sets of PDZ proteins."
      Becamel C., Gavarini S., Chanrion B., Alonso G., Galeotti N., Dumuis A., Bockaert J., Marin P.
      J. Biol. Chem. 279:20257-20266(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH HTR2A.
    8. "Interaction with cystic fibrosis transmembrane conductance regulator-associated ligand (CAL) inhibits beta1-adrenergic receptor surface expression."
      He J., Bellini M., Xu J., Castleberry A.M., Hall R.A.
      J. Biol. Chem. 279:50190-50196(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH ADR1B, DOMAIN, FUNCTION.
    9. "Comparative analysis of structure, expression and PSD95-binding capacity of Lrfn, a novel family of neuronal transmembrane proteins."
      Morimura N., Inoue T., Katayama K., Aruga J.
      Gene 380:72-83(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH LRFN1; LRFN2 AND LRFN4.
      Strain: Swiss Webster.
    10. "Comprehensive identification of phosphorylation sites in postsynaptic density preparations."
      Trinidad J.C., Specht C.G., Thalhammer A., Schoepfer R., Burlingame A.L.
      Mol. Cell. Proteomics 5:914-922(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-142, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Brain.
    11. "NGL family PSD-95-interacting adhesion molecules regulate excitatory synapse formation."
      Kim S., Burette A., Chung H.S., Kwon S.-K., Woo J., Lee H.W., Kim K., Kim H., Weinberg R.J., Kim E.
      Nat. Neurosci. 9:1294-1301(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH LRRC4B AND LRRC4.
    12. "Large-scale identification and evolution indexing of tyrosine phosphorylation sites from murine brain."
      Ballif B.A., Carey G.R., Sunyaev S.R., Gygi S.P.
      J. Proteome Res. 7:311-318(2008) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-240; TYR-580 AND TYR-715, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Brain.
    13. "TMEM16B, a novel protein with calcium-dependent chloride channel activity, associates with a presynaptic protein complex in photoreceptor terminals."
      Stoehr H., Heisig J.B., Benz P.M., Schoeberl S., Milenkovic V.M., Strauss O., Aartsen W.M., Wijnholds J., Weber B.H.F., Schulz H.L.
      J. Neurosci. 29:6809-6818(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH ANO2.
      Strain: C57BL/6.
      Tissue: Retina.
    14. "Neto1 is a novel CUB-domain NMDA receptor-interacting protein required for synaptic plasticity and learning."
      Ng D., Pitcher G.M., Szilard R.K., Sertie A., Kanisek M., Clapcote S.J., Lipina T., Kalia L.V., Joo D., McKerlie C., Cortez M., Roder J.C., Salter M.W., McInnes R.R.
      PLoS Biol. 7:E41-E41(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH NETO1.
    15. "SHANK3 overexpression causes manic-like behaviour with unique pharmacogenetic properties."
      Han K., Holder J.L. Jr., Schaaf C.P., Lu H., Chen H., Kang H., Tang J., Wu Z., Hao S., Cheung S.W., Yu P., Sun H., Breman A.M., Patel A., Lu H.C., Zoghbi H.Y.
      Nature 503:72-77(2013) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH SHANK3, SUBCELLULAR LOCATION, TISSUE SPECIFICITY.

    Entry informationi

    Entry nameiDLG4_MOUSE
    AccessioniPrimary (citable) accession number: Q62108
    Secondary accession number(s): Q5NCV5
    , Q5NCV6, Q5NCV7, Q91WJ1
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: November 1, 1997
    Last sequence update: November 1, 1997
    Last modified: October 1, 2014
    This is version 151 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. MGD cross-references
      Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
    2. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3