Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Phosphatidylethanolamine N-methyltransferase

Gene

Pemt

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Catalyzes the three sequential steps of the methylation pathway of phosphatidylcholine biosynthesis, the SAM-dependent methylation of phosphatidylethanolamine (PE) to phosphatidylmonomethylethanolamine (PMME), PMME to phosphatidyldimethylethanolamine (PDME), and PDME to phosphatidylcholine (PC).UniRule annotation2 Publications

Catalytic activityi

S-adenosyl-L-methionine + phosphatidyl-N-methylethanolamine = S-adenosyl-L-homocysteine + phosphatidyl-N-dimethylethanolamine.UniRule annotation
S-adenosyl-L-methionine + phosphatidyl-N-dimethylethanolamine = S-adenosyl-L-homocysteine + phosphatidylcholine.UniRule annotation
S-adenosyl-L-methionine + phosphatidylethanolamine = S-adenosyl-L-homocysteine + phosphatidyl-N-methylethanolamine.UniRule annotation

Pathwayi: phosphatidylcholine biosynthesis

This protein is involved in the pathway phosphatidylcholine biosynthesis, which is part of Phospholipid metabolism.UniRule annotation
View all proteins of this organism that are known to be involved in the pathway phosphatidylcholine biosynthesis and in Phospholipid metabolism.

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Methyltransferase, Transferase

Keywords - Biological processi

Lipid biosynthesis, Lipid metabolism, Phospholipid biosynthesis, Phospholipid metabolism

Keywords - Ligandi

S-adenosyl-L-methionine

Enzyme and pathway databases

BRENDAi2.1.1.17. 3474.
ReactomeiR-MMU-1483191. Synthesis of PC.
UniPathwayiUPA00753.

Names & Taxonomyi

Protein namesi
Recommended name:
Phosphatidylethanolamine N-methyltransferaseUniRule annotation (EC:2.1.1.17UniRule annotation, EC:2.1.1.71UniRule annotation)
Short name:
PEAMTUniRule annotation
Short name:
PEMTUniRule annotation
Alternative name(s):
Phospholipid methyltransferaseUniRule annotation
Short name:
PLMTUniRule annotation
Gene namesi
Name:PemtUniRule annotation
Synonyms:Pempt, Pemt2
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 11

Organism-specific databases

MGIiMGI:104535. Pemt.

Subcellular locationi

  • Endoplasmic reticulum membrane UniRule annotation; Multi-pass membrane protein UniRule annotation
  • Mitochondrion membrane UniRule annotation; Multi-pass membrane protein UniRule annotation

  • Note: Found in endoplasmic reticulum where most PEMT activity is generated and in mitochondria.UniRule annotation

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini2 – 12LumenalUniRule annotationAdd BLAST11
Intramembranei13 – 33HelicalUniRule annotationAdd BLAST21
Topological domaini34 – 45LumenalUniRule annotationAdd BLAST12
Transmembranei46 – 66HelicalUniRule annotationAdd BLAST21
Topological domaini67 – 93CytoplasmicUniRule annotationAdd BLAST27
Transmembranei94 – 114HelicalUniRule annotationAdd BLAST21
Topological domaini115 – 157LumenalUniRule annotationAdd BLAST43
Transmembranei158 – 178HelicalUniRule annotationAdd BLAST21
Topological domaini179 – 199CytoplasmicUniRule annotationAdd BLAST21

GO - Cellular componenti

  • brush border membrane Source: Ensembl
  • endoplasmic reticulum membrane Source: MGI
  • integral component of membrane Source: UniProtKB-KW
  • mitochondrial envelope Source: MGI
  • mitochondrial membrane Source: UniProtKB-SubCell
  • mitochondrion Source: MGI
  • sarcolemma Source: Ensembl
Complete GO annotation...

Keywords - Cellular componenti

Endoplasmic reticulum, Membrane, Mitochondrion

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemovedBy similarity
ChainiPRO_00001939212 – 199Phosphatidylethanolamine N-methyltransferaseAdd BLAST198

Proteomic databases

PaxDbiQ61907.
PRIDEiQ61907.

Expressioni

Tissue specificityi

Liver.

Gene expression databases

BgeeiENSMUSG00000000301.
CleanExiMM_PEMT.
ExpressionAtlasiQ61907. baseline and differential.
GenevisibleiQ61907. MM.

Interactioni

Protein-protein interaction databases

IntActiQ61907. 2 interactors.
MINTiMINT-8409735.
STRINGi10090.ENSMUSP00000000310.

Structurei

3D structure databases

ProteinModelPortaliQ61907.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni98 – 100S-adenosyl-L-methionine bindingUniRule annotation3
Regioni180 – 181S-adenosyl-L-methionine bindingUniRule annotation2

Sequence similaritiesi

Belongs to the class VI-like SAM-binding methyltransferase superfamily. PEMT/PEM2 methyltransferase family.UniRule annotation

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG4142. Eukaryota.
ENOG4111HY0. LUCA.
GeneTreeiENSGT00390000007041.
HOGENOMiHOG000208789.
HOVERGENiHBG000990.
InParanoidiQ61907.
KOiK00551.
OMAiTSTWALG.
OrthoDBiEOG091G0IQ4.
TreeFamiTF300198.

Family and domain databases

HAMAPiMF_03216. PLMT. 1 hit.
InterProiIPR024960. PEMT/MFAP.
IPR007318. Phopholipid_MeTrfase.
[Graphical view]
PANTHERiPTHR15458. PTHR15458. 1 hit.
PfamiPF04191. PEMT. 1 hit.
[Graphical view]
PIRSFiPIRSF005444. PEMT. 1 hit.
PROSITEiPS51599. SAM_PEMT_PEM2. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q61907-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSWLLGYMDP TEPSFVAAVI TIVFNPLFWN VVARWEQRTR KLSRAFGSPH
60 70 80 90 100
LACYSLGICI LLLNILRSHC FTQAMMSQPK MEGLDNHTTY FLGLAFLGWG
110 120 130 140 150
FVFVLSSFYA LGFTGTFLGD YFGILKESRV TTFPFSVLDN PMYWGSTANY
160 170 180 190
LGWALMHASP TGLLLTVLVA IVYVVALLYE EPFTAEIYRQ KATRLHKRS
Length:199
Mass (Da):22,579
Last modified:October 16, 2013 - v4
Checksum:i0F96C1CC3B483DC6
GO
Isoform 2 (identifier: Q61907-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MEENTSPTTALISSSVAGHDCCGGFGNIDFRQADLFVM

Show »
Length:236
Mass (Da):26,453
Checksum:i8D321A6CA1C51849
GO

Sequence cautioni

The sequence AAQ01190 differs from that shown. Reason: Frameshift at position 195.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti168L → V in AAA67686 (PubMed:8978486).Curated1
Sequence conflicti173Y → N in AAA67686 (PubMed:8978486).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0532241M → MEENTSPTTALISSSVAGHD CCGGFGNIDFRQADLFVM in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U25051
, U25046, U25047, U25048, U25049, U25050 Genomic DNA. Translation: AAA67686.1.
AY334571 mRNA. Translation: AAQ01190.1. Frameshift.
AK133744 mRNA. Translation: BAE21818.1.
AL603710 Genomic DNA. No translation available.
AL645526 Genomic DNA. No translation available.
BC026796 mRNA. Translation: AAH26796.1.
CCDSiCCDS24782.1. [Q61907-1]
CCDS78957.1. [Q61907-2]
RefSeqiNP_001276940.1. NM_001290011.1. [Q61907-2]
NP_001276941.1. NM_001290012.1. [Q61907-1]
NP_001276942.1. NM_001290013.1. [Q61907-1]
NP_001276943.1. NM_001290014.1.
NP_032845.2. NM_008819.3. [Q61907-1]
UniGeneiMm.2731.
Mm.452195.

Genome annotation databases

EnsembliENSMUST00000000310; ENSMUSP00000000310; ENSMUSG00000000301. [Q61907-1]
ENSMUST00000102692; ENSMUSP00000099753; ENSMUSG00000000301. [Q61907-1]
ENSMUST00000102693; ENSMUSP00000099754; ENSMUSG00000000301. [Q61907-2]
GeneIDi18618.
KEGGimmu:18618.
UCSCiuc007jfi.2. mouse. [Q61907-1]
uc007jfj.2. mouse. [Q61907-2]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U25051
, U25046, U25047, U25048, U25049, U25050 Genomic DNA. Translation: AAA67686.1.
AY334571 mRNA. Translation: AAQ01190.1. Frameshift.
AK133744 mRNA. Translation: BAE21818.1.
AL603710 Genomic DNA. No translation available.
AL645526 Genomic DNA. No translation available.
BC026796 mRNA. Translation: AAH26796.1.
CCDSiCCDS24782.1. [Q61907-1]
CCDS78957.1. [Q61907-2]
RefSeqiNP_001276940.1. NM_001290011.1. [Q61907-2]
NP_001276941.1. NM_001290012.1. [Q61907-1]
NP_001276942.1. NM_001290013.1. [Q61907-1]
NP_001276943.1. NM_001290014.1.
NP_032845.2. NM_008819.3. [Q61907-1]
UniGeneiMm.2731.
Mm.452195.

3D structure databases

ProteinModelPortaliQ61907.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

IntActiQ61907. 2 interactors.
MINTiMINT-8409735.
STRINGi10090.ENSMUSP00000000310.

Proteomic databases

PaxDbiQ61907.
PRIDEiQ61907.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000000310; ENSMUSP00000000310; ENSMUSG00000000301. [Q61907-1]
ENSMUST00000102692; ENSMUSP00000099753; ENSMUSG00000000301. [Q61907-1]
ENSMUST00000102693; ENSMUSP00000099754; ENSMUSG00000000301. [Q61907-2]
GeneIDi18618.
KEGGimmu:18618.
UCSCiuc007jfi.2. mouse. [Q61907-1]
uc007jfj.2. mouse. [Q61907-2]

Organism-specific databases

CTDi10400.
MGIiMGI:104535. Pemt.

Phylogenomic databases

eggNOGiKOG4142. Eukaryota.
ENOG4111HY0. LUCA.
GeneTreeiENSGT00390000007041.
HOGENOMiHOG000208789.
HOVERGENiHBG000990.
InParanoidiQ61907.
KOiK00551.
OMAiTSTWALG.
OrthoDBiEOG091G0IQ4.
TreeFamiTF300198.

Enzyme and pathway databases

UniPathwayiUPA00753.
BRENDAi2.1.1.17. 3474.
ReactomeiR-MMU-1483191. Synthesis of PC.

Miscellaneous databases

PROiQ61907.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000000301.
CleanExiMM_PEMT.
ExpressionAtlasiQ61907. baseline and differential.
GenevisibleiQ61907. MM.

Family and domain databases

HAMAPiMF_03216. PLMT. 1 hit.
InterProiIPR024960. PEMT/MFAP.
IPR007318. Phopholipid_MeTrfase.
[Graphical view]
PANTHERiPTHR15458. PTHR15458. 1 hit.
PfamiPF04191. PEMT. 1 hit.
[Graphical view]
PIRSFiPIRSF005444. PEMT. 1 hit.
PROSITEiPS51599. SAM_PEMT_PEM2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiPEMT_MOUSE
AccessioniPrimary (citable) accession number: Q61907
Secondary accession number(s): Q3UZN8, Q7TNW6, Q8R0I1
Entry historyi
Integrated into UniProtKB/Swiss-Prot: December 1, 2000
Last sequence update: October 16, 2013
Last modified: November 30, 2016
This is version 119 of the entry and version 4 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.