Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q61907 (PEMT_MOUSE) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 100. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (3) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Phosphatidylethanolamine N-methyltransferase

Short name=PEAMT
Short name=PEMT
EC=2.1.1.17
EC=2.1.1.71
Alternative name(s):
PEMT2
Gene names
Name:Pemt
Synonyms:Pempt, Pemt2
OrganismMus musculus (Mouse) [Reference proteome]
Taxonomic identifier10090 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus

Protein attributes

Sequence length199 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is further processed into a mature form.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Catalyzes three sequential methylation reactions of phosphatidylethanolamine (PE) by AdoMet, thereby producing phosphatidylcholine (PC).

Catalytic activity

S-adenosyl-L-methionine + phosphatidyl-N-methylethanolamine = S-adenosyl-L-homocysteine + phosphatidyl-N-dimethylethanolamine.

S-adenosyl-L-methionine + phosphatidyl-N-dimethylethanolamine = S-adenosyl-L-homocysteine + phosphatidylcholine.

S-adenosyl-L-methionine + phosphatidylethanolamine = S-adenosyl-L-homocysteine + phosphatidyl-N-methylethanolamine.

Pathway

Phospholipid metabolism; phosphatidylcholine biosynthesis.

Subcellular location

Endoplasmic reticulum membrane; Multi-pass membrane protein Potential. Mitochondrion membrane; Multi-pass membrane protein Potential.

Tissue specificity

Liver.

Sequence similarities

Belongs to the class VI-like SAM-binding methyltransferase superfamily. PEMT/PEM2 methyltransferase family.

Sequence caution

The sequence AAQ01190.1 differs from that shown. Reason: Frameshift at position 195.

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q61907-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q61907-2)

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MEENTSPTTALISSSVAGHDCCGGFGNIDFRQADLFVM

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Initiator methionine11Removed By similarity
Chain2 – 199198Phosphatidylethanolamine N-methyltransferase
PRO_0000193921

Regions

Transmembrane13 – 3321Helical; Potential
Transmembrane46 – 6621Helical; Potential
Transmembrane91 – 11121Helical; Potential
Transmembrane158 – 17821Helical; Potential

Natural variations

Alternative sequence11M → MEENTSPTTALISSSVAGHD CCGGFGNIDFRQADLFVM in isoform 2.
VSP_053224

Experimental info

Sequence conflict1681L → V in AAA67686. Ref.1
Sequence conflict1731Y → N in AAA67686. Ref.1

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified October 16, 2013. Version 4.
Checksum: 0F96C1CC3B483DC6

FASTA19922,579
        10         20         30         40         50         60 
MSWLLGYMDP TEPSFVAAVI TIVFNPLFWN VVARWEQRTR KLSRAFGSPH LACYSLGICI 

        70         80         90        100        110        120 
LLLNILRSHC FTQAMMSQPK MEGLDNHTTY FLGLAFLGWG FVFVLSSFYA LGFTGTFLGD 

       130        140        150        160        170        180 
YFGILKESRV TTFPFSVLDN PMYWGSTANY LGWALMHASP TGLLLTVLVA IVYVVALLYE 

       190 
EPFTAEIYRQ KATRLHKRS 

« Hide

Isoform 2 [UniParc].

Checksum: 8D321A6CA1C51849
Show »

FASTA23626,453

References

« Hide 'large scale' references
[1]"Characterization of the murine phosphatidylethanolamine N-methyltransferase-2 gene."
Walkey C.J., Cui Z., Agellon L.B., Vance D.E.
J. Lipid Res. 37:2341-2350(1996) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
Strain: 129/J.
Tissue: Liver.
[2]"Cloning of Mus musculus phosphatidylethanolamine N-methyltransferase (Pemt)."
Zhou G., Yu L., Zhao S.
Submitted (JUL-2003) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
Strain: C57BL/6J.
Tissue: Liver.
[3]"The transcriptional landscape of the mammalian genome."
Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. expand/collapse author list , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
Strain: C57BL/6J.
[4]"Lineage-specific biology revealed by a finished genome assembly of the mouse."
Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S., She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W., Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T., Zhou S. expand/collapse author list , Teague B., Potamousis K., Churas C., Place M., Herschleb J., Runnheim R., Forrest D., Amos-Landgraf J., Schwartz D.C., Cheng Z., Lindblad-Toh K., Eichler E.E., Ponting C.P.
PLoS Biol. 7:E1000112-E1000112(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
Strain: C57BL/6J.
[5]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Strain: FVB/N.
Tissue: Liver.
[6]"Disruption of the murine gene encoding phosphatidylethanolamine N-methyltransferase."
Walkey C.J., Donohue L.R., Bronson R., Agellon L.B., Vance D.E.
Proc. Natl. Acad. Sci. U.S.A. 94:12880-12885(1997) [PubMed] [Europe PMC] [Abstract]
Cited for: CHARACTERIZATION.
[7]"Biochemical and evolutionary significance of phospholipid methylation."
Walkey C.J., Yu L., Agellon L.B., Vance D.E.
J. Biol. Chem. 273:27043-27046(1998) [PubMed] [Europe PMC] [Abstract]
Cited for: CHARACTERIZATION.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
U25051 expand/collapse EMBL AC list , U25046, U25047, U25048, U25049, U25050 Genomic DNA. Translation: AAA67686.1.
AY334571 mRNA. Translation: AAQ01190.1. Frameshift.
AK133744 mRNA. Translation: BAE21818.1.
AL603710 Genomic DNA. No translation available.
AL645526 Genomic DNA. No translation available.
BC026796 mRNA. Translation: AAH26796.1.
CCDSCCDS24782.1. [Q61907-1]
RefSeqNP_001276940.1. NM_001290011.1. [Q61907-2]
NP_001276941.1. NM_001290012.1. [Q61907-1]
NP_001276942.1. NM_001290013.1. [Q61907-1]
NP_001276943.1. NM_001290014.1.
NP_032845.2. NM_008819.3. [Q61907-1]
UniGeneMm.2731.
Mm.452195.

3D structure databases

ProteinModelPortalQ61907.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

IntActQ61907. 2 interactions.
MINTMINT-8409735.
STRING10090.ENSMUSP00000099754.

PTM databases

PhosphoSiteQ61907.

Proteomic databases

PaxDbQ61907.
PRIDEQ61907.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENSMUST00000000310; ENSMUSP00000000310; ENSMUSG00000000301. [Q61907-1]
ENSMUST00000102692; ENSMUSP00000099753; ENSMUSG00000000301. [Q61907-1]
ENSMUST00000102693; ENSMUSP00000099754; ENSMUSG00000000301. [Q61907-2]
GeneID18618.
KEGGmmu:18618.
UCSCuc007jfi.1. mouse.
uc007jfj.1. mouse.

Organism-specific databases

CTD10400.
MGIMGI:104535. Pemt.

Phylogenomic databases

eggNOGNOG261676.
GeneTreeENSGT00390000007041.
HOVERGENHBG000990.
InParanoidQ61907.
KOK00551.
OMARVTGFPF.
OrthoDBEOG7TQV20.
TreeFamTF300198.

Enzyme and pathway databases

UniPathwayUPA00753.

Gene expression databases

CleanExMM_PEMT.
GenevestigatorQ61907.

Family and domain databases

InterProIPR024960. PEMT/MFAP.
IPR007318. Phopholipid_MeTrfase.
[Graphical view]
PANTHERPTHR15458. PTHR15458. 1 hit.
PfamPF04191. PEMT. 1 hit.
[Graphical view]
PIRSFPIRSF005444. PEMT. 1 hit.
PROSITEPS51599. SAM_PEMT_PEM2. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

NextBio294564.
PROQ61907.
SOURCESearch...

Entry information

Entry namePEMT_MOUSE
AccessionPrimary (citable) accession number: Q61907
Secondary accession number(s): Q3UZN8, Q7TNW6, Q8R0I1
Entry history
Integrated into UniProtKB/Swiss-Prot: December 1, 2000
Last sequence update: October 16, 2013
Last modified: July 9, 2014
This is version 100 of the entry and version 4 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Relevant documents

SIMILARITY comments

Index of protein domains and families

PATHWAY comments

Index of metabolic and biosynthesis pathways

MGD cross-references

Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot