Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q61907

- PEMT_MOUSE

UniProt

Q61907 - PEMT_MOUSE

Protein

Phosphatidylethanolamine N-methyltransferase

Gene

Pemt

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 102 (01 Oct 2014)
      Sequence version 4 (16 Oct 2013)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Catalyzes three sequential methylation reactions of phosphatidylethanolamine (PE) by AdoMet, thereby producing phosphatidylcholine (PC).

    Catalytic activityi

    S-adenosyl-L-methionine + phosphatidyl-N-methylethanolamine = S-adenosyl-L-homocysteine + phosphatidyl-N-dimethylethanolamine.PROSITE-ProRule annotation
    S-adenosyl-L-methionine + phosphatidyl-N-dimethylethanolamine = S-adenosyl-L-homocysteine + phosphatidylcholine.PROSITE-ProRule annotation
    S-adenosyl-L-methionine + phosphatidylethanolamine = S-adenosyl-L-homocysteine + phosphatidyl-N-methylethanolamine.PROSITE-ProRule annotation

    Pathwayi

    GO - Molecular functioni

    1. phosphatidylethanolamine N-methyltransferase activity Source: MGI
    2. phosphatidyl-N-dimethylethanolamine N-methyltransferase activity Source: UniProtKB-EC
    3. phosphatidyl-N-methylethanolamine N-methyltransferase activity Source: UniProtKB-EC

    GO - Biological processi

    1. phosphatidylcholine biosynthetic process Source: MGI

    Keywords - Molecular functioni

    Methyltransferase, Transferase

    Keywords - Biological processi

    Lipid biosynthesis, Lipid metabolism, Phospholipid biosynthesis, Phospholipid metabolism

    Keywords - Ligandi

    S-adenosyl-L-methionine

    Enzyme and pathway databases

    ReactomeiREACT_207335. Synthesis of PC.
    UniPathwayiUPA00753.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Phosphatidylethanolamine N-methyltransferase (EC:2.1.1.17, EC:2.1.1.71)
    Short name:
    PEAMT
    Short name:
    PEMT
    Alternative name(s):
    PEMT2
    Gene namesi
    Name:Pemt
    Synonyms:Pempt, Pemt2
    OrganismiMus musculus (Mouse)
    Taxonomic identifieri10090 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
    ProteomesiUP000000589: Chromosome 11

    Organism-specific databases

    MGIiMGI:104535. Pemt.

    Subcellular locationi

    GO - Cellular componenti

    1. endoplasmic reticulum membrane Source: MGI
    2. integral component of membrane Source: UniProtKB-KW
    3. mitochondrial envelope Source: MGI
    4. mitochondrial membrane Source: UniProtKB-SubCell
    5. mitochondrion Source: MGI

    Keywords - Cellular componenti

    Endoplasmic reticulum, Membrane, Mitochondrion

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Initiator methioninei1 – 11RemovedBy similarity
    Chaini2 – 199198Phosphatidylethanolamine N-methyltransferasePRO_0000193921Add
    BLAST

    Proteomic databases

    PaxDbiQ61907.
    PRIDEiQ61907.

    PTM databases

    PhosphoSiteiQ61907.

    Expressioni

    Tissue specificityi

    Liver.

    Gene expression databases

    CleanExiMM_PEMT.
    GenevestigatoriQ61907.

    Interactioni

    Protein-protein interaction databases

    IntActiQ61907. 2 interactions.
    MINTiMINT-8409735.
    STRINGi10090.ENSMUSP00000099754.

    Structurei

    3D structure databases

    ProteinModelPortaliQ61907.
    ModBaseiSearch...
    MobiDBiSearch...

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei13 – 3321HelicalSequence AnalysisAdd
    BLAST
    Transmembranei46 – 6621HelicalSequence AnalysisAdd
    BLAST
    Transmembranei91 – 11121HelicalSequence AnalysisAdd
    BLAST
    Transmembranei158 – 17821HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Sequence similaritiesi

    Belongs to the class VI-like SAM-binding methyltransferase superfamily. PEMT/PEM2 methyltransferase family.PROSITE-ProRule annotation

    Keywords - Domaini

    Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG261676.
    GeneTreeiENSGT00390000007041.
    HOVERGENiHBG000990.
    InParanoidiQ61907.
    KOiK00551.
    OMAiRVTGFPF.
    OrthoDBiEOG7TQV20.
    TreeFamiTF300198.

    Family and domain databases

    InterProiIPR024960. PEMT/MFAP.
    IPR007318. Phopholipid_MeTrfase.
    [Graphical view]
    PANTHERiPTHR15458. PTHR15458. 1 hit.
    PfamiPF04191. PEMT. 1 hit.
    [Graphical view]
    PIRSFiPIRSF005444. PEMT. 1 hit.
    PROSITEiPS51599. SAM_PEMT_PEM2. 1 hit.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q61907-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MSWLLGYMDP TEPSFVAAVI TIVFNPLFWN VVARWEQRTR KLSRAFGSPH    50
    LACYSLGICI LLLNILRSHC FTQAMMSQPK MEGLDNHTTY FLGLAFLGWG 100
    FVFVLSSFYA LGFTGTFLGD YFGILKESRV TTFPFSVLDN PMYWGSTANY 150
    LGWALMHASP TGLLLTVLVA IVYVVALLYE EPFTAEIYRQ KATRLHKRS 199
    Length:199
    Mass (Da):22,579
    Last modified:October 16, 2013 - v4
    Checksum:i0F96C1CC3B483DC6
    GO
    Isoform 2 (identifier: Q61907-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1: M → MEENTSPTTALISSSVAGHDCCGGFGNIDFRQADLFVM

    Show »
    Length:236
    Mass (Da):26,453
    Checksum:i8D321A6CA1C51849
    GO

    Sequence cautioni

    The sequence AAQ01190.1 differs from that shown. Reason: Frameshift at position 195.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti168 – 1681L → V in AAA67686. (PubMed:8978486)Curated
    Sequence conflicti173 – 1731Y → N in AAA67686. (PubMed:8978486)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 11M → MEENTSPTTALISSSVAGHD CCGGFGNIDFRQADLFVM in isoform 2. 1 PublicationVSP_053224

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    U25051
    , U25046, U25047, U25048, U25049, U25050 Genomic DNA. Translation: AAA67686.1.
    AY334571 mRNA. Translation: AAQ01190.1. Frameshift.
    AK133744 mRNA. Translation: BAE21818.1.
    AL603710 Genomic DNA. No translation available.
    AL645526 Genomic DNA. No translation available.
    BC026796 mRNA. Translation: AAH26796.1.
    CCDSiCCDS24782.1. [Q61907-1]
    RefSeqiNP_001276940.1. NM_001290011.1. [Q61907-2]
    NP_001276941.1. NM_001290012.1. [Q61907-1]
    NP_001276942.1. NM_001290013.1. [Q61907-1]
    NP_001276943.1. NM_001290014.1.
    NP_032845.2. NM_008819.3. [Q61907-1]
    UniGeneiMm.2731.
    Mm.452195.

    Genome annotation databases

    EnsembliENSMUST00000000310; ENSMUSP00000000310; ENSMUSG00000000301. [Q61907-1]
    ENSMUST00000102692; ENSMUSP00000099753; ENSMUSG00000000301. [Q61907-1]
    ENSMUST00000102693; ENSMUSP00000099754; ENSMUSG00000000301. [Q61907-2]
    GeneIDi18618.
    KEGGimmu:18618.
    UCSCiuc007jfi.1. mouse.
    uc007jfj.1. mouse.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    U25051
    , U25046 , U25047 , U25048 , U25049 , U25050 Genomic DNA. Translation: AAA67686.1 .
    AY334571 mRNA. Translation: AAQ01190.1 . Frameshift.
    AK133744 mRNA. Translation: BAE21818.1 .
    AL603710 Genomic DNA. No translation available.
    AL645526 Genomic DNA. No translation available.
    BC026796 mRNA. Translation: AAH26796.1 .
    CCDSi CCDS24782.1. [Q61907-1 ]
    RefSeqi NP_001276940.1. NM_001290011.1. [Q61907-2 ]
    NP_001276941.1. NM_001290012.1. [Q61907-1 ]
    NP_001276942.1. NM_001290013.1. [Q61907-1 ]
    NP_001276943.1. NM_001290014.1.
    NP_032845.2. NM_008819.3. [Q61907-1 ]
    UniGenei Mm.2731.
    Mm.452195.

    3D structure databases

    ProteinModelPortali Q61907.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    IntActi Q61907. 2 interactions.
    MINTi MINT-8409735.
    STRINGi 10090.ENSMUSP00000099754.

    PTM databases

    PhosphoSitei Q61907.

    Proteomic databases

    PaxDbi Q61907.
    PRIDEi Q61907.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENSMUST00000000310 ; ENSMUSP00000000310 ; ENSMUSG00000000301 . [Q61907-1 ]
    ENSMUST00000102692 ; ENSMUSP00000099753 ; ENSMUSG00000000301 . [Q61907-1 ]
    ENSMUST00000102693 ; ENSMUSP00000099754 ; ENSMUSG00000000301 . [Q61907-2 ]
    GeneIDi 18618.
    KEGGi mmu:18618.
    UCSCi uc007jfi.1. mouse.
    uc007jfj.1. mouse.

    Organism-specific databases

    CTDi 10400.
    MGIi MGI:104535. Pemt.

    Phylogenomic databases

    eggNOGi NOG261676.
    GeneTreei ENSGT00390000007041.
    HOVERGENi HBG000990.
    InParanoidi Q61907.
    KOi K00551.
    OMAi RVTGFPF.
    OrthoDBi EOG7TQV20.
    TreeFami TF300198.

    Enzyme and pathway databases

    UniPathwayi UPA00753 .
    Reactomei REACT_207335. Synthesis of PC.

    Miscellaneous databases

    NextBioi 294564.
    PROi Q61907.
    SOURCEi Search...

    Gene expression databases

    CleanExi MM_PEMT.
    Genevestigatori Q61907.

    Family and domain databases

    InterProi IPR024960. PEMT/MFAP.
    IPR007318. Phopholipid_MeTrfase.
    [Graphical view ]
    PANTHERi PTHR15458. PTHR15458. 1 hit.
    Pfami PF04191. PEMT. 1 hit.
    [Graphical view ]
    PIRSFi PIRSF005444. PEMT. 1 hit.
    PROSITEi PS51599. SAM_PEMT_PEM2. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Characterization of the murine phosphatidylethanolamine N-methyltransferase-2 gene."
      Walkey C.J., Cui Z., Agellon L.B., Vance D.E.
      J. Lipid Res. 37:2341-2350(1996) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
      Strain: 129/J.
      Tissue: Liver.
    2. "Cloning of Mus musculus phosphatidylethanolamine N-methyltransferase (Pemt)."
      Zhou G., Yu L., Zhao S.
      Submitted (JUL-2003) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
      Strain: C57BL/6J.
      Tissue: Liver.
    3. "The transcriptional landscape of the mammalian genome."
      Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
      , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
      Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Strain: C57BL/6J.
    4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
      Strain: C57BL/6J.
    5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Strain: FVB/N.
      Tissue: Liver.
    6. "Disruption of the murine gene encoding phosphatidylethanolamine N-methyltransferase."
      Walkey C.J., Donohue L.R., Bronson R., Agellon L.B., Vance D.E.
      Proc. Natl. Acad. Sci. U.S.A. 94:12880-12885(1997) [PubMed] [Europe PMC] [Abstract]
      Cited for: CHARACTERIZATION.
    7. "Biochemical and evolutionary significance of phospholipid methylation."
      Walkey C.J., Yu L., Agellon L.B., Vance D.E.
      J. Biol. Chem. 273:27043-27046(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: CHARACTERIZATION.

    Entry informationi

    Entry nameiPEMT_MOUSE
    AccessioniPrimary (citable) accession number: Q61907
    Secondary accession number(s): Q3UZN8, Q7TNW6, Q8R0I1
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: December 1, 2000
    Last sequence update: October 16, 2013
    Last modified: October 1, 2014
    This is version 102 of the entry and version 4 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. MGD cross-references
      Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
    2. PATHWAY comments
      Index of metabolic and biosynthesis pathways
    3. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3