Q61847 (MEP1B_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 125.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Meprin A subunit beta EC=3.4.24.63 Alternative name(s): Endopeptidase-2 Meprin B | ||||
| Gene names |
| ||||
| Organism | Mus musculus (Mouse) [Reference proteome] | ||||
| Taxonomic identifier | 10090 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus![]() |
Protein attributes
| Sequence length | 704 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Membrane metallopeptidase that sheds many membrane-bound proteins. Known substrates include: FGF19, VGFA, IL1B, IL18, procollagen I and III, E-cadherin, KLK7, gastrin, ADAM10, tenascin-C. The presence of several pro-inflammatory cytokine among substrates implicate MEP1B in inflammation. It is also involved in tissue remodeling due to its capability to degrade extracellular matrix components By similarity. |
| Catalytic activity | Hydrolysis of proteins, including azocasein, and peptides. Hydrolysis of 5-His-|-Leu-6, 6-Leu-|-Cys-7, 14-Ala-|-Leu-15 and 19-Cys-|-Gly-20 bonds in insulin B chain. Exhibits a strong preference for acidic amino-acids at the P1' position. Ref.5 Ref.7 |
| Cofactor | Binds 1 zinc ion per subunit By similarity. |
| Enzyme regulation | Strongly inhibited by fetuin-A/AHSG By similarity. Inhibited by cysteine and by the metal ion chelators EDTA and 1,10-phenanthroline. Not inhibited by 3,4-dichloroisocourmarin, soybean trypsin inhibitor, or the cysteine proteinase inhibitors iodoacetic acid and E-64. Ref.5 |
| Subunit structure | Homotetramer consisting of disulfide-linked beta subunits, or heterotetramer of two alpha and two beta subunits formed by non-covalent association of two disulfide-linked heterodimers. Interacts with MBL2 through its carbohydrate moiety. This interaction may inhibit its catalytic activity. Ref.6 Ref.8 |
| Subcellular location | |
| Tissue specificity | Isoform 1 is expressed in kidney, intestinal brush borders, and salivary ducts. Isoform 2 has been found in carcinoma cells. |
| Induction | By retinoic acid. Ref.5 |
| Post-translational modification | Proteolytically activated by trypsin in the intestinal lumen and kallikrein-related peptidases in other tissues By similarity. N-glycosylated; contains high mannose and/or complex biantennary structures. Ref.5 |
| Sequence similarities | Belongs to the peptidase M12A family. Contains 1 EGF-like domain. Contains 1 MAM domain. Contains 1 MATH domain. |
| Biophysicochemical properties | Temperature dependence: The half-life at 58 degrees Celsius is less than 3 minutes. Ref.5 |
Ontologies
Alternative products
| This entry describes 2 isoforms produced by alternative promoter usage and alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q61847-1) Also known as: Beta; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q61847-2) Also known as: Beta'; The sequence of this isoform differs from the canonical sequence as follows: 1-27: MDARHQPWFLVFATFLLVSGLPAPEKF → MNSTAGPASRSRHSFKCRMKLLKAPRDGMYMMTFG |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 20 | 20 | Potential | ||||||||
| Propeptide | 21 – 64 | 44 | By similarity | PRO_0000028885 | |||||||
| Chain | 65 – 704 | 640 | Meprin A subunit beta | PRO_0000028886 | |||||||
Regions | |||||||||||
| Topological domain | 21 – 654 | 634 | Extracellular Potential | ||||||||
| Transmembrane | 655 – 678 | 24 | Helical; Potential | ||||||||
| Topological domain | 679 – 704 | 26 | Cytoplasmic Potential | ||||||||
| Domain | 261 – 430 | 170 | MAM | ||||||||
| Domain | 431 – 586 | 156 | MATH | ||||||||
| Domain | 607 – 647 | 41 | EGF-like | ||||||||
| Region | 63 – 260 | 198 | Metalloprotease | ||||||||
Sites | |||||||||||
| Active site | 154 | 1 | By similarity | ||||||||
| Metal binding | 54 | 1 | Zinc; catalytic By similarity | ||||||||
| Metal binding | 153 | 1 | Zinc; catalytic By similarity | ||||||||
| Metal binding | 157 | 1 | Zinc; catalytic By similarity | ||||||||
| Metal binding | 163 | 1 | Zinc; catalytic By similarity | ||||||||
| Site | 239 | 1 | Mediates preference for acidic residues at subsite P1' By similarity | ||||||||
Amino acid modifications | |||||||||||
| Glycosylation | 193 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 219 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 255 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 316 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 422 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 437 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 529 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 548 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 593 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Disulfide bond | 104 ↔ 256 | By similarity | |||||||||
| Disulfide bond | 125 ↔ 145 | By similarity | |||||||||
| Disulfide bond | 266 ↔ 428 | By similarity | |||||||||
| Disulfide bond | 274 | Interchain By similarity | |||||||||
| Disulfide bond | 306 | Interchain By similarity | |||||||||
| Disulfide bond | 493 | Interchain By similarity | |||||||||
| Disulfide bond | 611 ↔ 622 | By similarity | |||||||||
| Disulfide bond | 616 ↔ 631 | By similarity | |||||||||
| Disulfide bond | 633 ↔ 646 | By similarity | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 1 – 27 | 27 | MDARH…APEKF → MNSTAGPASRSRHSFKCRMK LLKAPRDGMYMMTFG in isoform 2. | VSP_005460 | |||||||
Experimental info | |||||||||||
| Sequence conflict | 18 | 1 | V → A in AAA75234. Ref.1 | ||||||||
| Sequence conflict | 26 | 1 | K → G AA sequence Ref.5 | ||||||||
| Sequence conflict | 29 | 1 | K → S AA sequence Ref.5 | ||||||||
| Sequence conflict | 470 | 1 | S → Y in AAA75234. Ref.1 | ||||||||
| Sequence conflict | 470 | 1 | S → Y no nucleotide entry Ref.2 | ||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Cloning, expression, and chromosomal localization of the mouse meprin beta subunit." Gorbea C.M., Marchand P., Jiang W., Copeland N.G., Gilbert D.J., Jenkins N.A., Bond J.S. J. Biol. Chem. 268:21035-21043(1993) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), PROTEIN SEQUENCE OF 65-88; 96-109; 329-345 AND 541-549. Tissue: Kidney. |
| [2] | "A novel meprin beta' mRNA in mouse embryonal and human colon carcinoma cells." Dietrich J.M., Bond J.S., Jiang W. J. Biol. Chem. 271:2271-2278(1996) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2). Tissue: Kidney. |
| [3] | Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C. Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA] (ISOFORM 1). |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). |
| [5] | "Meprin-A and -B. Cell surface endopeptidases of the mouse kidney." Kounnas M.Z., Wolz R.L., Gorbea C.M., Bond J.S. J. Biol. Chem. 266:17350-17357(1991) [PubMed] [Europe PMC] [Abstract] Cited for: PROTEIN SEQUENCE OF 21-30 (ISOFORM 1), CATALYTIC ACTIVITY, ENZYME REGULATION, BIOPHYSICOCHEMICAL PROPERTIES, GLYCOSYLATION. Strain: C3H/He. Tissue: Kidney. |
| [6] | "Homo- and heterotetrameric forms of the membrane-bound metalloendopeptidases meprin A and B." Gorbea C.M., Flannery A.V., Bond J.S. Arch. Biochem. Biophys. 290:549-553(1991) [PubMed] [Europe PMC] [Abstract] Cited for: SUBUNIT. |
| [7] | "Marked differences between metalloproteases meprin A and B in substrate and peptide bond specificity." Bertenshaw G.P., Turk B.E., Hubbard S.J., Matters G.L., Bylander J.E., Crisman J.M., Cantley L.C., Bond J.S. J. Biol. Chem. 276:13248-13255(2001) [PubMed] [Europe PMC] [Abstract] Cited for: CATALYTIC ACTIVITY. |
| [8] | "Mannan-binding protein blocks the activation of metalloproteases meprin alpha and beta." Hirano M., Ma B.Y., Kawasaki N., Okimura K., Baba M., Nakagawa T., Miwa K., Kawasaki N., Oka S., Kawasaki T. J. Immunol. 175:3177-3185(2005) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH MBL2. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | L15193 mRNA. Translation: AAA75234.1. CH466557 Genomic DNA. Translation: EDK96962.1. BC125627 mRNA. Translation: AAI25628.1. BC145979 mRNA. Translation: AAI45980.1. |
| IPI | IPI00126232. IPI00230071. |
| PIR | A48040. |
| RefSeq | NP_032612.2. NM_008586.2. |
| UniGene | Mm.2682. |
3D structure databases | |
| ProteinModelPortal | Q61847. |
| SMR | Q61847. Positions 30-595, 607-649. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q61847. 1 interaction. |
Protein family/group databases | |
| MEROPS | M12.004. |
PTM databases | |
| PhosphoSite | Q61847. |
Proteomic databases | |
| PaxDb | Q61847. |
| PRIDE | Q61847. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENSMUST00000082235; ENSMUSP00000080866; ENSMUSG00000024313. |
| GeneID | 17288. |
| KEGG | mmu:17288. |
| UCSC | uc008eff.1. mouse. |
Organism-specific databases | |
| CTD | 4225. |
| MGI | MGI:96964. Mep1b. |
Phylogenomic databases | |
| eggNOG | NOG322115. |
| GeneTree | ENSGT00550000074269. |
| HOGENOM | HOG000043106. |
| HOVERGEN | HBG052457. |
| KO | K08606. |
| OMA | MDQQSDI. |
| OrthoDB | EOG408N7Q. |
Gene expression databases | |
| Bgee | Q61847. |
| CleanEx | MM_MEP1B. |
| Genevestigator | Q61847. |
| GermOnline | ENSMUSG00000024313. Mus musculus. |
Family and domain databases | |
| Gene3D | 3.40.390.10. 1 hit. |
| InterPro | IPR008985. ConA-like_lec_gl_sf. IPR000742. EG-like_dom. IPR000998. MAM_dom. IPR002083. MATH. IPR024079. MetalloPept_cat_dom. IPR008294. Pept_M12A_Meprin. IPR001506. Peptidase_M12A. IPR006026. Peptidase_Metallo. IPR008974. TRAF-like. [Graphical view] |
| Pfam | PF01400. Astacin. 1 hit. PF00008. EGF. 1 hit. PF00629. MAM. 1 hit. PF00917. MATH. 1 hit. [Graphical view] |
| PIRSF | PIRSF001196. Meprin. 1 hit. |
| PRINTS | PR00480. ASTACIN. PR00020. MAMDOMAIN. |
| SMART | SM00181. EGF. 1 hit. SM00137. MAM. 1 hit. SM00061. MATH. 1 hit. SM00235. ZnMc. 1 hit. [Graphical view] |
| SUPFAM | SSF49899. ConA_like_lec_gl. 1 hit. SSF49599. Traf_like. 1 hit. |
| PROSITE | PS00022. EGF_1. False negative. PS01186. EGF_2. False negative. PS50026. EGF_3. 1 hit. PS00740. MAM_1. 1 hit. PS50060. MAM_2. 1 hit. PS50144. MATH. 1 hit. PS00142. ZINC_PROTEASE. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 291804. |
| SOURCE | Search... |
Entry information
| Entry name | MEP1B_MOUSE | ||||||||
| Accession | Primary (citable) accession number: Q61847 Secondary accession number(s): Q059K0 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| Peptidase families Classification of peptidase families and list of entries |
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
