Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q61749

- EI2BD_MOUSE

UniProt

Q61749 - EI2BD_MOUSE

Protein

Translation initiation factor eIF-2B subunit delta

Gene

Eif2b4

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 102 (01 Oct 2014)
      Sequence version 2 (27 Jul 2011)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Catalyzes the exchange of eukaryotic initiation factor 2-bound GDP for GTP.

    GO - Molecular functioni

    1. guanyl-nucleotide exchange factor activity Source: RefGenome
    2. translation initiation factor activity Source: UniProtKB-KW

    GO - Biological processi

    1. cellular response to stimulus Source: UniProtKB
    2. myelination Source: UniProtKB
    3. negative regulation of translational initiation Source: RefGenome
    4. oligodendrocyte development Source: UniProtKB
    5. ovarian follicle development Source: UniProtKB
    6. positive regulation of GTPase activity Source: GOC
    7. regulation of translational initiation Source: RefGenome
    8. translational initiation Source: UniProtKB

    Keywords - Molecular functioni

    Initiation factor

    Keywords - Biological processi

    Protein biosynthesis

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Translation initiation factor eIF-2B subunit delta
    Alternative name(s):
    eIF-2B GDP-GTP exchange factor subunit delta
    Gene namesi
    Name:Eif2b4
    Synonyms:Eif2b, Eif2bd, Jgr1a
    OrganismiMus musculus (Mouse)
    Taxonomic identifieri10090 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
    ProteomesiUP000000589: Chromosome 5

    Organism-specific databases

    MGIiMGI:95300. Eif2b4.

    Subcellular locationi

    GO - Cellular componenti

    1. cytoplasm Source: UniProtKB
    2. eukaryotic translation initiation factor 2B complex Source: UniProtKB

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Initiator methioninei1 – 11RemovedBy similarity
    Chaini2 – 524523Translation initiation factor eIF-2B subunit deltaPRO_0000156068Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei2 – 21N-acetylalanineBy similarity
    Modified residuei86 – 861PhosphothreonineBy similarity

    Keywords - PTMi

    Acetylation, Phosphoprotein

    Proteomic databases

    MaxQBiQ61749.
    PaxDbiQ61749.
    PRIDEiQ61749.

    PTM databases

    PhosphoSiteiQ61749.

    Expressioni

    Gene expression databases

    ArrayExpressiQ61749.
    BgeeiQ61749.
    GenevestigatoriQ61749.

    Interactioni

    Subunit structurei

    Complex of five different subunits; alpha, beta, gamma, delta and epsilon.

    Structurei

    3D structure databases

    ProteinModelPortaliQ61749.
    SMRiQ61749. Positions 220-518.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Sequence similaritiesi

    Phylogenomic databases

    eggNOGiCOG1184.
    GeneTreeiENSGT00550000075009.
    HOGENOMiHOG000176924.
    HOVERGENiHBG051459.
    KOiK03680.
    TreeFamiTF101508.

    Family and domain databases

    InterProiIPR000649. IF-2B-related.
    [Graphical view]
    PfamiPF01008. IF-2B. 1 hit.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q61749-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MAAVAVAVRE ESRSEMKTEL SPRPGAAGRE LTQEEKLQLR KEKKQQKKKR    50
    KEEKGADQEI GSAVSAAQRQ DPIRELPGPG SQLGGTAGEK LPAGRSKAEL 100
    RAERRAKQEA ERALKQARKG EQGGVPPQAC PSTAGETTSG VKRVPEHTPA 150
    DDPTLLRRLL RKPDRQQVPT RKDYGSKVSL FSHLPQYSRQ SSLTQYMSIP 200
    SSVIHPAMVR LGLQYSQGLI SGSNARCIAL LHALQQVIQD YTTPPSEELS 250
    RDLVNKLKPY ISFLTQCRPM SASMCNAIKF LTKEVTGMSS SKREEEAKSE 300
    LREALDRYVQ EKIVLAAQAI SRFASTKISD GDVILVYGCS SLVSRILQEA 350
    RVEGRRFRVV VVDSRPRLEG RHMLHSLVRA GVPTSYLLIP AASYVLPEVS 400
    KVLLGAHALL ANGSVMSRVG TAQLALVARA HNVPVLVCCE TYKFCERVQT 450
    DAFVSNELDD PDDLQCKRGD QVALANWQSH PSLRLLNLVY DVTPPELVDL 500
    VITELGMIPC SSVPVVLRVK SSDQ 524
    Length:524
    Mass (Da):57,624
    Last modified:July 27, 2011 - v2
    Checksum:i86CDB70C63285A02
    GO
    Isoform 2 (identifier: Q61749-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         2-10: AAVAVAVRE → MPTQQPAAPTSLPKSSRSLSGSLCALFSDA

    Show »
    Length:545
    Mass (Da):59,789
    Checksum:iC5E177EC6EFB6C42
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti302 – 3021R → K in AAA68046. (PubMed:7982969)Curated
    Sequence conflicti302 – 3021R → K in AAA68047. (PubMed:7982969)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei2 – 109AAVAVAVRE → MPTQQPAAPTSLPKSSRSLS GSLCALFSDA in isoform 2. 1 PublicationVSP_001434

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    M98036 mRNA. Translation: AAA68047.1.
    M98035 mRNA. Translation: AAA68046.1.
    AK158282 mRNA. Translation: BAE34444.1.
    CH466524 Genomic DNA. Translation: EDL37345.1.
    BC021884 mRNA. Translation: AAH21884.1.
    CCDSiCCDS19176.1. [Q61749-1]
    PIRiA55146.
    RefSeqiNP_001120827.1. NM_001127355.1.
    NP_001120828.1. NM_001127356.1.
    NP_034252.2. NM_010122.2. [Q61749-1]
    UniGeneiMm.29394.

    Genome annotation databases

    EnsembliENSMUST00000077693; ENSMUSP00000076875; ENSMUSG00000029145. [Q61749-1]
    GeneIDi13667.
    KEGGimmu:13667.
    UCSCiuc008wxk.2. mouse. [Q61749-2]
    uc008wxl.2. mouse. [Q61749-1]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    M98036 mRNA. Translation: AAA68047.1 .
    M98035 mRNA. Translation: AAA68046.1 .
    AK158282 mRNA. Translation: BAE34444.1 .
    CH466524 Genomic DNA. Translation: EDL37345.1 .
    BC021884 mRNA. Translation: AAH21884.1 .
    CCDSi CCDS19176.1. [Q61749-1 ]
    PIRi A55146.
    RefSeqi NP_001120827.1. NM_001127355.1.
    NP_001120828.1. NM_001127356.1.
    NP_034252.2. NM_010122.2. [Q61749-1 ]
    UniGenei Mm.29394.

    3D structure databases

    ProteinModelPortali Q61749.
    SMRi Q61749. Positions 220-518.
    ModBasei Search...
    MobiDBi Search...

    PTM databases

    PhosphoSitei Q61749.

    Proteomic databases

    MaxQBi Q61749.
    PaxDbi Q61749.
    PRIDEi Q61749.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENSMUST00000077693 ; ENSMUSP00000076875 ; ENSMUSG00000029145 . [Q61749-1 ]
    GeneIDi 13667.
    KEGGi mmu:13667.
    UCSCi uc008wxk.2. mouse. [Q61749-2 ]
    uc008wxl.2. mouse. [Q61749-1 ]

    Organism-specific databases

    CTDi 8890.
    MGIi MGI:95300. Eif2b4.

    Phylogenomic databases

    eggNOGi COG1184.
    GeneTreei ENSGT00550000075009.
    HOGENOMi HOG000176924.
    HOVERGENi HBG051459.
    KOi K03680.
    TreeFami TF101508.

    Miscellaneous databases

    ChiTaRSi EIF2B4. mouse.
    NextBioi 284424.
    PROi Q61749.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q61749.
    Bgeei Q61749.
    Genevestigatori Q61749.

    Family and domain databases

    InterProi IPR000649. IF-2B-related.
    [Graphical view ]
    Pfami PF01008. IF-2B. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "The delta-subunit of murine guanine nucleotide exchange factor eIF-2B. Characterization of cDNAs predicts isoforms differing at the amino-terminal end."
      Henderson R.A., Krissansen G.W., Yong R.Y., Leung E., Watson J.D., Dholakia J.N.
      J. Biol. Chem. 269:30517-30523(1994) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2).
      Strain: CBA/J.
      Tissue: Spleen.
    2. "The transcriptional landscape of the mammalian genome."
      Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
      , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
      Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA].
      Strain: C57BL/6J.
      Tissue: Inner ear.
    3. Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.
      Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Salivary gland.

    Entry informationi

    Entry nameiEI2BD_MOUSE
    AccessioniPrimary (citable) accession number: Q61749
    Secondary accession number(s): Q3TYW7, Q61748, Q8VC35
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: November 1, 1997
    Last sequence update: July 27, 2011
    Last modified: October 1, 2014
    This is version 102 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. MGD cross-references
      Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
    2. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3