Q61749 (EI2BD_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 29, 2013.
Version 89.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Translation initiation factor eIF-2B subunit delta Alternative name(s): eIF-2B GDP-GTP exchange factor subunit delta | ||||
| Gene names |
| ||||
| Organism | Mus musculus (Mouse) [Reference proteome] | ||||
| Taxonomic identifier | 10090 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus![]() |
Protein attributes
| Sequence length | 524 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Function | Catalyzes the exchange of eukaryotic initiation factor 2-bound GDP for GTP. |
| Subunit structure | Complex of five different subunits; alpha, beta, gamma, delta and epsilon. |
| Sequence similarities | Belongs to the eIF-2B alpha/beta/delta subunits family. |
Ontologies
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q61749-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q61749-2) The sequence of this isoform differs from the canonical sequence as follows: 1-10: MAAVAVAVRE → MPTQQPAAPTSLPKSSRSLSGSLCALFSDA |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 524 | 524 | Translation initiation factor eIF-2B subunit delta | PRO_0000156068 | |||||
Amino acid modifications | |||||||||
| Modified residue | 86 | 1 | Phosphothreonine By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 10 | 10 | MAAVAVAVRE → MPTQQPAAPTSLPKSSRSLS GSLCALFSDA in isoform 2. | VSP_001434 | |||||
Experimental info | |||||||||
| Sequence conflict | 302 | 1 | R → K in AAA68046. Ref.1 | ||||||
| Sequence conflict | 302 | 1 | R → K in AAA68047. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "The delta-subunit of murine guanine nucleotide exchange factor eIF-2B. Characterization of cDNAs predicts isoforms differing at the amino-terminal end." Henderson R.A., Krissansen G.W., Yong R.Y., Leung E., Watson J.D., Dholakia J.N. J. Biol. Chem. 269:30517-30523(1994) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2). Strain: CBA/J. Tissue: Spleen. |
| [2] | "The transcriptional landscape of the mammalian genome." Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. Hayashizaki Y.Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA]. Strain: C57BL/6J. Tissue: Inner ear. |
| [3] | Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C. Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Salivary gland. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | M98036 mRNA. Translation: AAA68047.1. M98035 mRNA. Translation: AAA68046.1. AK158282 mRNA. Translation: BAE34444.1. CH466524 Genomic DNA. Translation: EDL37345.1. BC021884 mRNA. Translation: AAH21884.1. |
| IPI | IPI00124879. IPI00221819. |
| PIR | A55146. |
| RefSeq | NP_001120827.1. NM_001127355.1. NP_001120828.1. NM_001127356.1. NP_034252.2. NM_010122.2. |
| UniGene | Mm.29394. |
3D structure databases | |
| ProteinModelPortal | Q61749. |
| SMR | Q61749. Positions 207-522. |
| ModBase | Search... |
PTM databases | |
| PhosphoSite | Q61749. |
Proteomic databases | |
| PaxDb | Q61749. |
| PRIDE | Q61749. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENSMUST00000077693; ENSMUSP00000076875; ENSMUSG00000029145. ENSMUST00000114603; ENSMUSP00000110250; ENSMUSG00000029145. ENSMUST00000166769; ENSMUSP00000130880; ENSMUSG00000029145. |
| GeneID | 13667. |
| KEGG | mmu:13667. |
| UCSC | uc008wxk.2. mouse. uc008wxl.2. mouse. |
Organism-specific databases | |
| CTD | 8890. |
| MGI | MGI:95300. Eif2b4. |
Phylogenomic databases | |
| eggNOG | COG1184. |
| GeneTree | ENSGT00550000075009. |
| HOGENOM | HOG000176924. |
| HOVERGEN | HBG051459. |
| KO | K03680. |
Gene expression databases | |
| ArrayExpress | Q61749. |
| Bgee | Q61749. |
| Genevestigator | Q61749. |
| GermOnline | ENSMUSG00000029145. Mus musculus. |
Family and domain databases | |
| InterPro | IPR000649. IF-2B-related. [Graphical view] |
| PANTHER | PTHR10233. PTHR10233. 1 hit. |
| Pfam | PF01008. IF-2B. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | EIF2B4. mouse. |
| NextBio | 284424. |
| SOURCE | Search... |
Entry information
| Entry name | EI2BD_MOUSE | ||||||||
| Accession | Primary (citable) accession number: Q61749 Secondary accession number(s): Q3TYW7, Q61748, Q8VC35 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
